F483378
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 848 | 405 | 763 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300048927|Ga0496124_0447722|Ga0496124_0447722_30_818 |
| Length | 262 |
| Sequence | MGNEQAGQHGDVLRVKMQSSSISYRSKSKPSFLRYVSKRLISTGATMEPAFWHKRWADNQIGFHQAQVNPYLQAHWPALALPAGSRVLVPLCGKSLDLAWLAGQGHRVLGVELSRRAVEGFFQEHGLEADVTQKGAFEVWRSAEVELWCGDFFALQAQDVADCAGFYDRAALIALPPEMRLSYMRLLADVLPAGCQGLLVTLDYDQALMAGPPFSVADDEVRHGFAGRQVEPLEVLEIIEQSPKFAQAGATSLLERVYRIGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 2 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 3 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 4 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 5 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 6 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 7 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 8 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 9 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 10 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 11 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 12 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 13 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 14 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 15 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 16 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 17 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 18 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 19 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 20 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 21 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 22 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 23 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 24 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 25 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 26 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 27 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 28 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 29 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 30 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 31 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 32 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 33 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 34 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 35 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 36 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 37 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 38 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 39 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 40 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 41 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 42 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 43 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 44 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 45 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 46 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 47 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 48 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 49 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 50 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 51 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 52 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 53 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 54 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 55 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 56 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 57 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 58 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 59 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 60 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 61 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 62 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 63 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 64 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 65 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 66 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 67 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 68 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 69 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 70 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 71 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 72 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 73 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 74 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 75 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 76 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 77 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 78 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 79 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 80 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 81 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 82 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 85 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 88 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 90 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 91 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 92 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 93 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 94 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 98 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 102 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 110 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 118 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 119 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 120 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 121 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 122 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 127 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 129 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 130 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 131 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 132 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 133 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 134 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 135 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 136 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 138 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 140 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 141 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 152 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 154 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 166 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 171 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 172 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 175 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 184 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 238 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 239 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 240 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 241 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 242 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 248 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 249 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 250 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 253 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 254 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 255 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 256 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 257 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 258 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 259 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 260 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 261 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 262 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 268 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 275 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 276 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 277 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 283 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 284 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 285 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 286 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 287 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 288 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 289 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 290 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 291 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 292 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 293 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 294 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 295 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 298 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 299 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 351 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 358 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 359 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 362 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 363 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 364 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 365 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 366 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 367 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 368 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 385 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 391 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 394 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 396 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 397 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 398 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 399 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 400 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 401 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 402 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 403 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 404 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 405 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.03 |
| Metatranscriptomes | 0.94 |
| Isolates | 10.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.66 |
| Nodule | 0.83 |
| Rhizoplane | 3.54 |
| Rhizosphere | 76.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1006336 | 3300002737 | Bacteria | 2066 |
| 2 | JGI25164J39214_1000421 | 3300002772 | Bacteria | 23796 |
| 3 | JGI25165J46597_1015099 | 3300003214 | Bacteria | 1045 |
| 4 | rootH2_10073649 | 3300003320 | Bacteria | 1918 |
| 5 | rootH1_10045656 | 3300003323 | Bacteria | 1476 |
| 6 | Ga0055538_1000141 | 3300003751 | Bacteria | 50563 |
| 7 | Ga0055539_1000134 | 3300003752 | Bacteria | 78300 |
| 8 | Ga0055539_1000192 | 3300003752 | Bacteria | 50563 |
| 9 | Ga0055533_1000138 | 3300003756 | Bacteria | 78275 |
| 10 | Ga0055533_1000192 | 3300003756 | Bacteria | 50563 |
| 11 | Ga0055532_1000142 | 3300003758 | Bacteria | 69999 |
| 12 | Ga0055525_1000183 | 3300003759 | Bacteria | 78300 |
| 13 | Ga0055525_1000260 | 3300003759 | Bacteria | 50563 |
| 14 | Ga0055535_1009015 | 3300003761 | Bacteria | 1749 |
| 15 | Ga0055529_1001465 | 3300003763 | Bacteria | 7167 |
| 16 | Ga0055536_1006580 | 3300003781 | Bacteria | 5383 |
| 17 | Ga0055531_10013344 | 3300003794 | Bacteria | 3792 |
| 18 | Ga0055541_1000089 | 3300003841 | Bacteria | 78275 |
| 19 | Ga0055541_1000127 | 3300003841 | Bacteria | 50563 |
| 20 | Ga0065714_10004793 | 3300005288 | Bacteria | 4968 |
| 21 | Ga0065714_10010006 | 3300005288 | Bacteria | 3039 |
| 22 | Ga0065704_10117506 | 3300005289 | Bacteria | 1832 |
| 23 | Ga0065704_10125447 | 3300005289 | Bacteria | 1697 |
| 24 | Ga0065704_10297990 | 3300005289 | Bacteria | 891 |
| 25 | Ga0065715_10191057 | 3300005293 | Bacteria | 1395 |
| 26 | Ga0070658_10106431 | 3300005327 | Bacteria | 2320 |
| 27 | Ga0070658_11123616 | 3300005327 | Bacteria | 683 |
| 28 | Ga0070690_100150586 | 3300005330 | Bacteria | 1587 |
| 29 | Ga0070670_100019616 | 3300005331 | Bacteria | 5804 |
| 30 | Ga0070670_100063254 | 3300005331 | Bacteria | 3176 |
| 31 | Ga0070670_100080503 | 3300005331 | Bacteria | 2799 |
| 32 | Ga0068869_100115454 | 3300005334 | Bacteria | 2047 |
| 33 | Ga0070666_10471987 | 3300005335 | Unclassified | 908 |
| 34 | Ga0070680_100213575 | 3300005336 | Bacteria | 1628 |
| 35 | Ga0070680_100290896 | 3300005336 | Bacteria | 1385 |
| 36 | Ga0070660_100062431 | 3300005339 | Bacteria | 2894 |
| 37 | Ga0070660_100078446 | 3300005339 | Bacteria | 2590 |
| 38 | Ga0070660_100160873 | 3300005339 | Bacteria | 1809 |
| 39 | Ga0070689_100424543 | 3300005340 | Unclassified | 1127 |
| 40 | Ga0070691_10038752 | 3300005341 | Bacteria | 2251 |
| 41 | Ga0070661_100000029 | 3300005344 | Bacteria | 117682 |
| 42 | Ga0070669_100000316 | 3300005353 | Bacteria | 37853 |
| 43 | Ga0070669_100284249 | 3300005353 | Bacteria | 1326 |
| 44 | Ga0070675_100000292 | 3300005354 | Bacteria | 33370 |
| 45 | Ga0070675_100022809 | 3300005354 | Bacteria | 5001 |
| 46 | Ga0070671_100010060 | 3300005355 | Bacteria | 7597 |
| 47 | Ga0070671_100083924 | 3300005355 | Bacteria | 2664 |
| 48 | Ga0070671_100193137 | 3300005355 | Bacteria | 1725 |
| 49 | Ga0070674_100243978 | 3300005356 | Bacteria | 1408 |
| 50 | Ga0070673_100001571 | 3300005364 | Bacteria | 13458 |
| 51 | Ga0070673_100198282 | 3300005364 | Bacteria | 1728 |
| 52 | Ga0070688_100007205 | 3300005365 | Bacteria | 5989 |
| 53 | Ga0070688_100010533 | 3300005365 | Bacteria | 5103 |
| 54 | Ga0070659_100021330 | 3300005366 | Bacteria | 4932 |
| 55 | Ga0070659_100058659 | 3300005366 | Bacteria | 3038 |
| 56 | Ga0070659_100102032 | 3300005366 | Bacteria | 2309 |
| 57 | Ga0070659_100991625 | 3300005366 | Bacteria | 737 |
| 58 | Ga0070709_10737823 | 3300005434 | Bacteria | 769 |
| 59 | Ga0070714_100000439 | 3300005435 | Bacteria | 30200 |
| 60 | Ga0070710_10174017 | 3300005437 | Bacteria | 1343 |
| 61 | Ga0070694_100130410 | 3300005444 | Bacteria | 1815 |
| 62 | Ga0070663_100504945 | 3300005455 | Unclassified | 1005 |
| 63 | Ga0070662_100001079 | 3300005457 | Bacteria | 16619 |
| 64 | Ga0070662_100079179 | 3300005457 | Bacteria | 2443 |
| 65 | Ga0070681_10000122 | 3300005458 | Bacteria | 58332 |
| 66 | Ga0070681_10150461 | 3300005458 | Bacteria | 2254 |
| 67 | Ga0070681_10181002 | 3300005458 | Bacteria | 2029 |
| 68 | Ga0068867_100056297 | 3300005459 | Bacteria | 2909 |
| 69 | Ga0070685_10018927 | 3300005466 | Bacteria | 3710 |
| 70 | Ga0070679_100046779 | 3300005530 | Bacteria | 4313 |
| 71 | Ga0070679_100125107 | 3300005530 | Bacteria | 2553 |
| 72 | Ga0070679_100203184 | 3300005530 | Bacteria | 1946 |
| 73 | Ga0070679_100500581 | 3300005530 | Bacteria | 1159 |
| 74 | Ga0068853_100033679 | 3300005539 | Bacteria | 4347 |
| 75 | Ga0068853_100034758 | 3300005539 | Bacteria | 4279 |
| 76 | Ga0068853_100079556 | 3300005539 | Bacteria | 2867 |
| 77 | Ga0070672_100002632 | 3300005543 | Bacteria | 11477 |
| 78 | Ga0070672_100005875 | 3300005543 | Bacteria | 8185 |
| 79 | Ga0070672_100029504 | 3300005543 | Bacteria | 4114 |
| 80 | Ga0070696_100015274 | 3300005546 | Bacteria | 5154 |
| 81 | Ga0070693_100041808 | 3300005547 | Bacteria | 2580 |
| 82 | Ga0070665_100355473 | 3300005548 | Unclassified | 1471 |
| 83 | Ga0068855_100000651 | 3300005563 | Bacteria | 42448 |
| 84 | Ga0068855_100036971 | 3300005563 | Bacteria | 5809 |
| 85 | Ga0068855_100076888 | 3300005563 | Bacteria | 3873 |
| 86 | Ga0068855_100127016 | 3300005563 | Bacteria | 2915 |
| 87 | Ga0070664_100054591 | 3300005564 | Bacteria | 3390 |
| 88 | Ga0068857_100102455 | 3300005577 | Bacteria | 2569 |
| 89 | Ga0068857_100104147 | 3300005577 | Bacteria | 2548 |
| 90 | Ga0068854_100021927 | 3300005578 | Bacteria | 4341 |
| 91 | Ga0068854_100244340 | 3300005578 | Bacteria | 1431 |
| 92 | Ga0068859_100006693 | 3300005617 | Bacteria | 11704 |
| 93 | Ga0068859_100051096 | 3300005617 | Bacteria | 4154 |
| 94 | Ga0068851_10000050 | 3300005834 | Bacteria | 72913 |
| 95 | Ga0068860_100005405 | 3300005843 | Bacteria | 12963 |
| 96 | Ga0068862_100057164 | 3300005844 | Bacteria | 3344 |
| 97 | Ga0075364_10001303 | 3300006051 | Bacteria | 13417 |
| 98 | Ga0075364_10126192 | 3300006051 | Bacteria | 1716 |
| 99 | Ga0075432_10034834 | 3300006058 | Bacteria | 1749 |
| 100 | Ga0075432_10091504 | 3300006058 | Bacteria | 1114 |
| 101 | Ga0097621_100008706 | 3300006237 | Bacteria | 7328 |
| 102 | Ga0097621_100147890 | 3300006237 | Bacteria | 2013 |
| 103 | Ga0068871_100006865 | 3300006358 | Bacteria | 8105 |
| 104 | Ga0097620_100006693 | 3300006931 | Bacteria | 11704 |
| 105 | Ga0097620_100051097 | 3300006931 | Bacteria | 4154 |
| 106 | Ga0079104_1004393 | 3300006946 | Bacteria | 6076 |
| 107 | Ga0099795_10000002 | 3300007788 | Bacteria | 161112 |
| 108 | Ga0105251_10003076 | 3300009011 | Bacteria | 12398 |
| 109 | Ga0105251_10003160 | 3300009011 | Bacteria | 12198 |
| 110 | Ga0105251_10011010 | 3300009011 | Bacteria | 5193 |
| 111 | Ga0105251_10011378 | 3300009011 | Bacteria | 5086 |
| 112 | Ga0105251_10016935 | 3300009011 | Bacteria | 3919 |
| 113 | Ga0105251_10019280 | 3300009011 | Bacteria | 3607 |
| 114 | Ga0105251_10055081 | 3300009011 | Bacteria | 1887 |
| 115 | Ga0105251_10208169 | 3300009011 | Bacteria | 881 |
| 116 | Ga0105244_10018125 | 3300009036 | Bacteria | 3960 |
| 117 | Ga0105244_10023700 | 3300009036 | Bacteria | 3361 |
| 118 | Ga0105244_10027086 | 3300009036 | Bacteria | 3094 |
| 119 | Ga0105244_10074517 | 3300009036 | Bacteria | 1688 |
| 120 | Ga0105244_10084971 | 3300009036 | Bacteria | 1562 |
| 121 | Ga0105250_10000319 | 3300009092 | Bacteria | 37054 |
| 122 | Ga0105250_10001554 | 3300009092 | Bacteria | 12329 |
| 123 | Ga0105250_10044287 | 3300009092 | Bacteria | 1784 |
| 124 | Ga0105250_10161435 | 3300009092 | Bacteria | 936 |
| 125 | Ga0105240_10037357 | 3300009093 | Bacteria | 6242 |
| 126 | Ga0111539_10061200 | 3300009094 | Bacteria | 4460 |
| 127 | Ga0111539_10205844 | 3300009094 | Bacteria | 2293 |
| 128 | Ga0105243_10035319 | 3300009148 | Bacteria | 3875 |
| 129 | Ga0105243_10068799 | 3300009148 | Bacteria | 2854 |
| 130 | Ga0105242_10289139 | 3300009176 | Bacteria | 1492 |
| 131 | Ga0105248_10000530 | 3300009177 | Bacteria | 43488 |
| 132 | Ga0105248_10110797 | 3300009177 | Bacteria | 3095 |
| 133 | Ga0105237_10004758 | 3300009545 | Bacteria | 15608 |
| 134 | Ga0105238_10000006 | 3300009551 | Bacteria | 346249 |
| 135 | Ga0105238_10108385 | 3300009551 | Bacteria | 2758 |
| 136 | Ga0105238_10177113 | 3300009551 | Bacteria | 2109 |
| 137 | Ga0099796_10000017 | 3300010159 | Bacteria | 48991 |
| 138 | Ga0105239_10037141 | 3300010375 | Bacteria | 5343 |
| 139 | Ga0157343_1001722 | 3300012488 | Bacteria | 1109 |
| 140 | Ga0157373_10007084 | 3300013100 | Bacteria | 8360 |
| 141 | Ga0157373_10051241 | 3300013100 | Bacteria | 2941 |
| 142 | Ga0157373_10062624 | 3300013100 | Bacteria | 2635 |
| 143 | Ga0157373_10147481 | 3300013100 | Bacteria | 1655 |
| 144 | Ga0157373_10154374 | 3300013100 | Bacteria | 1615 |
| 145 | Ga0157373_10345309 | 3300013100 | Bacteria | 1061 |
| 146 | Ga0157371_10001274 | 3300013102 | Bacteria | 26576 |
| 147 | Ga0157371_10045728 | 3300013102 | Bacteria | 3114 |
| 148 | Ga0157371_10049940 | 3300013102 | Bacteria | 2972 |
| 149 | Ga0157371_10081826 | 3300013102 | Bacteria | 2286 |
| 150 | Ga0157370_10021678 | 3300013104 | Bacteria | 6401 |
| 151 | Ga0157370_10172186 | 3300013104 | Bacteria | 2012 |
| 152 | Ga0157370_10230410 | 3300013104 | Bacteria | 1715 |
| 153 | Ga0157370_10271459 | 3300013104 | Bacteria | 1567 |
| 154 | Ga0157369_10009316 | 3300013105 | Bacteria | 11230 |
| 155 | Ga0157369_10070491 | 3300013105 | Bacteria | 3755 |
| 156 | Ga0157369_10094848 | 3300013105 | Bacteria | 3185 |
| 157 | Ga0157369_10180466 | 3300013105 | Bacteria | 2221 |
| 158 | Ga0157374_10068556 | 3300013296 | Bacteria | 3338 |
| 159 | Ga0157374_10323168 | 3300013296 | Unclassified | 1529 |
| 160 | Ga0157378_10046334 | 3300013297 | Bacteria | 3865 |
| 161 | Ga0163162_10002174 | 3300013306 | Bacteria | 18411 |
| 162 | Ga0163162_10084203 | 3300013306 | Bacteria | 3255 |
| 163 | Ga0157372_10035376 | 3300013307 | Bacteria | 5498 |
| 164 | Ga0157372_10254085 | 3300013307 | Bacteria | 2040 |
| 165 | Ga0157372_10477907 | 3300013307 | Bacteria | 1453 |
| 166 | Ga0157372_10719518 | 3300013307 | Bacteria | 1161 |
| 167 | Ga0157375_10000876 | 3300013308 | Bacteria | 26145 |
| 168 | Ga0157375_10013741 | 3300013308 | Bacteria | 7217 |
| 169 | Ga0157375_10318207 | 3300013308 | Bacteria | 1721 |
| 170 | Ga0157375_10348151 | 3300013308 | Unclassified | 1647 |
| 171 | Ga0163163_10014069 | 3300014325 | Bacteria | 7346 |
| 172 | Ga0163163_10753547 | 3300014325 | Bacteria | 1037 |
| 173 | Ga0157380_10177604 | 3300014326 | Bacteria | 1868 |
| 174 | Ga0157380_10410763 | 3300014326 | Unclassified | 1287 |
| 175 | Ga0182008_10020662 | 3300014497 | Bacteria | 3387 |
| 176 | Ga0182008_10026957 | 3300014497 | Bacteria | 2912 |
| 177 | Ga0182008_10032622 | 3300014497 | Bacteria | 2615 |
| 178 | Ga0182008_10033434 | 3300014497 | Bacteria | 2580 |
| 179 | Ga0157377_10564228 | 3300014745 | Bacteria | 806 |
| 180 | Ga0157379_10000084 | 3300014968 | Bacteria | 62328 |
| 181 | Ga0157376_10026920 | 3300014969 | Bacteria | 4551 |
| 182 | Ga0182006_1001091 | 3300015261 | Bacteria | 17388 |
| 183 | Ga0182007_10024101 | 3300015262 | Bacteria | 2133 |
| 184 | Ga0182007_10028919 | 3300015262 | Bacteria | 1900 |
| 185 | Ga0182007_10066083 | 3300015262 | Bacteria | 1184 |
| 186 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 187 | Ga0163161_10073587 | 3300017792 | Bacteria | 2504 |
| 188 | Ga0163161_10089807 | 3300017792 | Unclassified | 2273 |
| 189 | Ga0163161_10139001 | 3300017792 | Bacteria | 1838 |
| 190 | Ga0206354_10029098 | 3300020081 | Bacteria | 777 |
| 191 | Ga0213872_10002881 | 3300021361 | Bacteria | 9791 |
| 192 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 193 | Ga0209784_100040 | 3300025224 | Bacteria | 231812 |
| 194 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 195 | Ga0209566_100051 | 3300025225 | Bacteria | 231920 |
| 196 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 197 | Ga0209674_100072 | 3300025226 | Bacteria | 231812 |
| 198 | Ga0209147_100067 | 3300025229 | Bacteria | 231812 |
| 199 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 200 | Ga0209563_100073 | 3300025230 | Bacteria | 231920 |
| 201 | Ga0207427_100049 | 3300025231 | Bacteria | 237504 |
| 202 | Ga0209437_100083 | 3300025233 | Bacteria | 256005 |
| 203 | Ga0209258_100585 | 3300025242 | Bacteria | 30446 |
| 204 | Ga0209646_1000575 | 3300025246 | Bacteria | 15286 |
| 205 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 206 | Ga0209677_100121 | 3300025253 | Bacteria | 80378 |
| 207 | Ga0209233_1000075 | 3300025261 | Bacteria | 356837 |
| 208 | Ga0209675_1008687 | 3300025291 | Bacteria | 3690 |
| 209 | Ga0209676_1000891 | 3300025292 | Bacteria | 38072 |
| 210 | Ga0209676_1002024 | 3300025292 | Bacteria | 15917 |
| 211 | Ga0209025_1016319 | 3300025294 | Bacteria | 4397 |
| 212 | Ga0209025_1133987 | 3300025294 | Bacteria | 714 |
| 213 | Ga0209050_1022212 | 3300025298 | Bacteria | 2279 |
| 214 | Ga0209257_1000180 | 3300025304 | Bacteria | 158090 |
| 215 | Ga0207656_10000235 | 3300025321 | Bacteria | 19518 |
| 216 | Ga0207696_1000019 | 3300025711 | Bacteria | 476309 |
| 217 | Ga0207696_1000171 | 3300025711 | Bacteria | 102599 |
| 218 | Ga0207696_1000191 | 3300025711 | Bacteria | 94782 |
| 219 | Ga0207696_1008253 | 3300025711 | Bacteria | 4006 |
| 220 | Ga0207655_1000035 | 3300025728 | Bacteria | 359016 |
| 221 | Ga0207655_1000614 | 3300025728 | Bacteria | 42960 |
| 222 | Ga0207655_1056983 | 3300025728 | Bacteria | 1537 |
| 223 | Ga0207713_1000166 | 3300025735 | Bacteria | 96359 |
| 224 | Ga0207713_1000173 | 3300025735 | Bacteria | 92859 |
| 225 | Ga0207713_1002517 | 3300025735 | Bacteria | 13272 |
| 226 | Ga0207713_1007526 | 3300025735 | Bacteria | 6408 |
| 227 | Ga0207713_1009283 | 3300025735 | Bacteria | 5567 |
| 228 | Ga0207713_1009510 | 3300025735 | Bacteria | 5471 |
| 229 | Ga0207713_1019125 | 3300025735 | Bacteria | 3364 |
| 230 | Ga0207713_1021048 | 3300025735 | Bacteria | 3136 |
| 231 | Ga0207713_1043939 | 3300025735 | Bacteria | 1841 |
| 232 | Ga0207692_10141484 | 3300025898 | Bacteria | 1369 |
| 233 | Ga0207705_10123947 | 3300025909 | Bacteria | 1919 |
| 234 | Ga0207705_10128389 | 3300025909 | Bacteria | 1885 |
| 235 | Ga0207707_10000310 | 3300025912 | Bacteria | 51190 |
| 236 | Ga0207707_10033751 | 3300025912 | Bacteria | 4478 |
| 237 | Ga0207707_10235982 | 3300025912 | Bacteria | 1591 |
| 238 | Ga0207707_10597336 | 3300025912 | Bacteria | 934 |
| 239 | Ga0207695_10003954 | 3300025913 | Bacteria | 20489 |
| 240 | Ga0207671_10002838 | 3300025914 | Bacteria | 18016 |
| 241 | Ga0207660_10113778 | 3300025917 | Bacteria | 2040 |
| 242 | Ga0207660_10312036 | 3300025917 | Bacteria | 1254 |
| 243 | Ga0207662_10230881 | 3300025918 | Unclassified | 1209 |
| 244 | Ga0207657_10024061 | 3300025919 | Bacteria | 5654 |
| 245 | Ga0207657_10029629 | 3300025919 | Bacteria | 4980 |
| 246 | Ga0207657_10051681 | 3300025919 | Bacteria | 3571 |
| 247 | Ga0207652_10017245 | 3300025921 | Bacteria | 5908 |
| 248 | Ga0207652_10407264 | 3300025921 | Bacteria | 1227 |
| 249 | Ga0207681_10000491 | 3300025923 | Bacteria | 27650 |
| 250 | Ga0207694_10000110 | 3300025924 | Bacteria | 85854 |
| 251 | Ga0207694_10196036 | 3300025924 | Bacteria | 1642 |
| 252 | Ga0207650_10000174 | 3300025925 | Bacteria | 75634 |
| 253 | Ga0207650_10033727 | 3300025925 | Bacteria | 3709 |
| 254 | Ga0207659_10002211 | 3300025926 | Bacteria | 11576 |
| 255 | Ga0207659_10003140 | 3300025926 | Bacteria | 9876 |
| 256 | Ga0207659_10012864 | 3300025926 | Bacteria | 5343 |
| 257 | Ga0207659_10309181 | 3300025926 | Bacteria | 1301 |
| 258 | Ga0207659_10732366 | 3300025926 | Unclassified | 848 |
| 259 | Ga0207659_10746209 | 3300025926 | Bacteria | 839 |
| 260 | Ga0207664_10003938 | 3300025929 | Bacteria | 9986 |
| 261 | Ga0207644_10125044 | 3300025931 | Bacteria | 1962 |
| 262 | Ga0207644_10239101 | 3300025931 | Unclassified | 1445 |
| 263 | Ga0207690_10002939 | 3300025932 | Bacteria | 10269 |
| 264 | Ga0207690_10024721 | 3300025932 | Bacteria | 3764 |
| 265 | Ga0207706_10002445 | 3300025933 | Bacteria | 18134 |
| 266 | Ga0207709_10027997 | 3300025935 | Bacteria | 3254 |
| 267 | Ga0207709_10051919 | 3300025935 | Bacteria | 2515 |
| 268 | Ga0207669_10183917 | 3300025937 | Bacteria | 1501 |
| 269 | Ga0207704_10524697 | 3300025938 | Bacteria | 958 |
| 270 | Ga0207691_10017313 | 3300025940 | Bacteria | 6835 |
| 271 | Ga0207691_10031440 | 3300025940 | Bacteria | 4954 |
| 272 | Ga0207691_10031677 | 3300025940 | Bacteria | 4934 |
| 273 | Ga0207711_10151337 | 3300025941 | Bacteria | 2094 |
| 274 | Ga0207679_10011336 | 3300025945 | Bacteria | 5768 |
| 275 | Ga0207679_10149977 | 3300025945 | Bacteria | 1896 |
| 276 | Ga0207667_10000120 | 3300025949 | Bacteria | 123800 |
| 277 | Ga0207667_10049964 | 3300025949 | Bacteria | 4414 |
| 278 | Ga0207667_10114060 | 3300025949 | Bacteria | 2786 |
| 279 | Ga0207668_10085836 | 3300025972 | Bacteria | 2298 |
| 280 | Ga0207703_10012102 | 3300026035 | Bacteria | 6722 |
| 281 | Ga0207639_10003873 | 3300026041 | Bacteria | 10082 |
| 282 | Ga0207639_10012151 | 3300026041 | Bacteria | 5990 |
| 283 | Ga0207678_10578362 | 3300026067 | Bacteria | 984 |
| 284 | Ga0207648_10038161 | 3300026089 | Bacteria | 4228 |
| 285 | Ga0207676_10234177 | 3300026095 | Bacteria | 1644 |
| 286 | Ga0207674_10031883 | 3300026116 | Bacteria | 5532 |
| 287 | Ga0207674_10063737 | 3300026116 | Bacteria | 3719 |
| 288 | Ga0207698_10349682 | 3300026142 | Bacteria | 1396 |
| 289 | Ga0209281_1003625 | 3300027111 | Bacteria | 4992 |
| 290 | Ga0209389_1000037 | 3300027296 | Bacteria | 125897 |
| 291 | Ga0209984_1006779 | 3300027424 | Bacteria | 1411 |
| 292 | Ga0209179_1000024 | 3300027512 | Bacteria | 39428 |
| 293 | Ga0209982_1001893 | 3300027552 | Bacteria | 2895 |
| 294 | Ga0209983_1001409 | 3300027665 | Bacteria | 5358 |
| 295 | Ga0209983_1017829 | 3300027665 | Bacteria | 1471 |
| 296 | Ga0209971_1000854 | 3300027682 | Bacteria | 7847 |
| 297 | Ga0209974_10003051 | 3300027876 | Bacteria | 6058 |
| 298 | Ga0209974_10092894 | 3300027876 | Bacteria | 1048 |
| 299 | Ga0268266_10353131 | 3300028379 | Bacteria | 1382 |
| 300 | Ga0268264_10029942 | 3300028381 | Bacteria | 4463 |
| 301 | Ga0307515_10211654 | 3300028794 | Bacteria | 1781 |
| 302 | Ga0316177_1063096 | 3300030731 | Bacteria | 1911 |
| 303 | Ga0316182_1080836 | 3300030745 | Bacteria | 1868 |
| 304 | Ga0265328_10005946 | 3300031239 | Bacteria | 5199 |
| 305 | Ga0265340_10190618 | 3300031247 | Bacteria | 924 |
| 306 | Ga0265331_10000138 | 3300031250 | Bacteria | 96032 |
| 307 | Ga0265331_10028049 | 3300031250 | Bacteria | 2818 |
| 308 | Ga0265331_10102939 | 3300031250 | Bacteria | 1313 |
| 309 | Ga0265327_10000299 | 3300031251 | Bacteria | 96033 |
| 310 | Ga0265327_10011689 | 3300031251 | Bacteria | 6016 |
| 311 | Ga0307513_10011784 | 3300031456 | Bacteria | 10841 |
| 312 | Ga0307513_10130008 | 3300031456 | Bacteria | 2466 |
| 313 | Ga0307509_10014264 | 3300031507 | Bacteria | 9356 |
| 314 | Ga0307408_100519480 | 3300031548 | Bacteria | 1045 |
| 315 | Ga0316575_10002178 | 3300031665 | Bacteria | 6535 |
| 316 | Ga0316575_10053165 | 3300031665 | Bacteria | 1613 |
| 317 | Ga0316575_10115968 | 3300031665 | Unclassified | 1094 |
| 318 | Ga0316575_10217424 | 3300031665 | Unclassified | 797 |
| 319 | Ga0316579_10006228 | 3300031691 | Bacteria | 4858 |
| 320 | Ga0316579_10080796 | 3300031691 | Bacteria | 1547 |
| 321 | Ga0316579_10101258 | 3300031691 | Bacteria | 1380 |
| 322 | Ga0316579_10113393 | 3300031691 | Bacteria | 1301 |
| 323 | Ga0316579_10162846 | 3300031691 | Bacteria | 1078 |
| 324 | Ga0316579_10268748 | 3300031691 | Bacteria | 824 |
| 325 | Ga0316579_10284286 | 3300031691 | Unclassified | 799 |
| 326 | Ga0316576_10002007 | 3300031727 | Bacteria | 11393 |
| 327 | Ga0316576_10033272 | 3300031727 | Bacteria | 3668 |
| 328 | Ga0316576_10054937 | 3300031727 | Bacteria | 2905 |
| 329 | Ga0316576_10055448 | 3300031727 | Bacteria | 2893 |
| 330 | Ga0316576_10057837 | 3300031727 | Bacteria | 2834 |
| 331 | Ga0316576_10109338 | 3300031727 | Bacteria | 2071 |
| 332 | Ga0316576_10133579 | 3300031727 | Bacteria | 1867 |
| 333 | Ga0316576_10183899 | 3300031727 | Bacteria | 1576 |
| 334 | Ga0316578_10000355 | 3300031728 | Bacteria | 14513 |
| 335 | Ga0316578_10000750 | 3300031728 | Bacteria | 11856 |
| 336 | Ga0316578_10003780 | 3300031728 | Bacteria | 7004 |
| 337 | Ga0316578_10034817 | 3300031728 | Bacteria | 2893 |
| 338 | Ga0316578_10035569 | 3300031728 | Bacteria | 2864 |
| 339 | Ga0316578_10053223 | 3300031728 | Bacteria | 2371 |
| 340 | Ga0316578_10067463 | 3300031728 | Bacteria | 2114 |
| 341 | Ga0316578_10100615 | 3300031728 | Bacteria | 1733 |
| 342 | Ga0307405_10056530 | 3300031731 | Bacteria | 2461 |
| 343 | Ga0307405_10283396 | 3300031731 | Bacteria | 1248 |
| 344 | Ga0316577_10019867 | 3300031733 | Bacteria | 3722 |
| 345 | Ga0316577_10046641 | 3300031733 | Bacteria | 2420 |
| 346 | Ga0316577_10062082 | 3300031733 | Bacteria | 2086 |
| 347 | Ga0316577_10116922 | 3300031733 | Unclassified | 1498 |
| 348 | Ga0307413_10000289 | 3300031824 | Bacteria | 15520 |
| 349 | Ga0307413_10442498 | 3300031824 | Bacteria | 1029 |
| 350 | Ga0307412_10245541 | 3300031911 | Bacteria | 1387 |
| 351 | Ga0307412_10270504 | 3300031911 | Bacteria | 1329 |
| 352 | Ga0307409_100946664 | 3300031995 | Bacteria | 877 |
| 353 | Ga0307414_10003488 | 3300032004 | Bacteria | 8404 |
| 354 | Ga0307414_10020803 | 3300032004 | Bacteria | 4099 |
| 355 | Ga0307414_10234978 | 3300032004 | Bacteria | 1514 |
| 356 | Ga0307414_10442546 | 3300032004 | Bacteria | 1138 |
| 357 | Ga0307414_10784114 | 3300032004 | Bacteria | 868 |
| 358 | Ga0307414_11021017 | 3300032004 | Bacteria | 762 |
| 359 | Ga0307411_10793140 | 3300032005 | Bacteria | 833 |
| 360 | Ga0307415_100530263 | 3300032126 | Bacteria | 1035 |
| 361 | Ga0316583_10005875 | 3300032133 | Bacteria | 4414 |
| 362 | Ga0316583_10023784 | 3300032133 | Bacteria | 2187 |
| 363 | Ga0316583_10066017 | 3300032133 | Bacteria | 1266 |
| 364 | Ga0316583_10132983 | 3300032133 | Bacteria | 867 |
| 365 | Ga0316583_10145219 | 3300032133 | Bacteria | 826 |
| 366 | Ga0316585_10012810 | 3300032137 | Unclassified | 2490 |
| 367 | Ga0316585_10016266 | 3300032137 | Bacteria | 2239 |
| 368 | Ga0316585_10053025 | 3300032137 | Bacteria | 1304 |
| 369 | Ga0316585_10096263 | 3300032137 | Bacteria | 969 |
| 370 | Ga0316580_10002337 | 3300032139 | Bacteria | 5200 |
| 371 | Ga0316580_10016466 | 3300032139 | Bacteria | 2269 |
| 372 | Ga0316580_10017836 | 3300032139 | Bacteria | 2184 |
| 373 | Ga0316580_10122293 | 3300032139 | Bacteria | 797 |
| 374 | Ga0316593_10000460 | 3300032168 | Bacteria | 7478 |
| 375 | Ga0316593_10016799 | 3300032168 | Bacteria | 2224 |
| 376 | Ga0316593_10019164 | 3300032168 | Bacteria | 2112 |
| 377 | Ga0316593_10021839 | 3300032168 | Bacteria | 2005 |
| 378 | Ga0316592_1003346 | 3300033524 | Bacteria | 2881 |
| 379 | Ga0316596_1004284 | 3300033541 | Bacteria | 3190 |
| 380 | Ga0316596_1013151 | 3300033541 | Bacteria | 2041 |
| 381 | Ga0316574_0004485 | 3300035398 | Bacteria | 7325 |
| 382 | Ga0316574_0020422 | 3300035398 | Unclassified | 3921 |
| 383 | Ga0316574_0041419 | 3300035398 | Bacteria | 2839 |
| 384 | Ga0316574_0055978 | 3300035398 | Bacteria | 2466 |
| 385 | Ga0316574_0130892 | 3300035398 | Bacteria | 1614 |
| 386 | Ga0316574_0136143 | 3300035398 | Unclassified | 1582 |
| 387 | Ga0316574_0160823 | 3300035398 | Bacteria | 1446 |
| 388 | Ga0316574_0230902 | 3300035398 | Bacteria | 1184 |
| 389 | Ga0373937_0092457 | 3300036401 | Bacteria | 2804 |
| 390 | Ga0373937_0529841 | 3300036401 | Unclassified | 1119 |
| 391 | Ga0316582_0004837 | 3300036647 | Bacteria | 6871 |
| 392 | Ga0316582_0007864 | 3300036647 | Bacteria | 5696 |
| 393 | Ga0316582_0017707 | 3300036647 | Bacteria | 4129 |
| 394 | Ga0316582_0025344 | 3300036647 | Bacteria | 3560 |
| 395 | Ga0316582_0028543 | 3300036647 | Bacteria | 3381 |
| 396 | Ga0316582_0049248 | 3300036647 | Bacteria | 2665 |
| 397 | Ga0316582_0084178 | 3300036647 | Bacteria | 2082 |
| 398 | Ga0316582_0404374 | 3300036647 | Bacteria | 941 |
| 399 | Ga0316584_0003319 | 3300036712 | Bacteria | 10429 |
| 400 | Ga0316584_0004559 | 3300036712 | Bacteria | 9179 |
| 401 | Ga0316584_0008175 | 3300036712 | Bacteria | 7193 |
| 402 | Ga0316584_0010547 | 3300036712 | Bacteria | 6463 |
| 403 | Ga0316584_0010728 | 3300036712 | Bacteria | 6416 |
| 404 | Ga0316584_0078102 | 3300036712 | Bacteria | 2479 |
| 405 | Ga0316584_0133226 | 3300036712 | Bacteria | 1855 |
| 406 | Ga0316584_0155307 | 3300036712 | Bacteria | 1702 |
| 407 | Ga0316584_0217487 | 3300036712 | Bacteria | 1405 |
| 408 | Ga0316584_0223445 | 3300036712 | Bacteria | 1382 |
| 409 | Ga0316584_0311626 | 3300036712 | Bacteria | 1137 |
| 410 | Ga0316584_0644380 | 3300036712 | Unclassified | 731 |
| 411 | Ga0395899_0008193 | 3300037312 | Bacteria | 8051 |
| 412 | Ga0395899_0088087 | 3300037312 | Bacteria | 2252 |
| 413 | Ga0395899_0123826 | 3300037312 | Bacteria | 1850 |
| 414 | Ga0395900_0000396 | 3300037418 | Bacteria | 62949 |
| 415 | Ga0395900_0009362 | 3300037418 | Bacteria | 10044 |
| 416 | Ga0395900_0017708 | 3300037418 | Bacteria | 7272 |
| 417 | Ga0395900_0060291 | 3300037418 | Bacteria | 3905 |
| 418 | Ga0395900_0310412 | 3300037418 | Bacteria | 1560 |
| 419 | Ga0395900_0529338 | 3300037418 | Bacteria | 1125 |
| 420 | Ga0395898_0007612 | 3300037466 | Bacteria | 11496 |
| 421 | Ga0395898_0066793 | 3300037466 | Bacteria | 3482 |
| 422 | Ga0395898_0173676 | 3300037466 | Bacteria | 2060 |
| 423 | Ga0395905_0104207 | 3300037471 | Bacteria | 2663 |
| 424 | Ga0395901_0084987 | 3300038443 | Bacteria | 3307 |
| 425 | Ga0395901_0108002 | 3300038443 | Bacteria | 2921 |
| 426 | Ga0395901_0186164 | 3300038443 | Bacteria | 2177 |
| 427 | Ga0395901_0231505 | 3300038443 | Bacteria | 1929 |
| 428 | Ga0395901_0432806 | 3300038443 | Bacteria | 1348 |
| 429 | Ga0436361_0054021 | 3300039447 | Bacteria | 15580 |
| 430 | Ga0439436_0021020 | 3300041404 | Bacteria | 1943 |
| 431 | Ga0439436_0028016 | 3300041404 | Bacteria | 1645 |
| 432 | Ga0439436_0041862 | 3300041404 | Bacteria | 1310 |
| 433 | Ga0439465_0019807 | 3300041413 | Bacteria | 2104 |
| 434 | Ga0451791_0899248 | 3300041451 | Bacteria | 1550 |
| 435 | Ga0451793_0779673 | 3300041452 | Bacteria | 833 |
| 436 | Ga0451802_1216571 | 3300041460 | Bacteria | 4210 |
| 437 | Ga0451804_0273946 | 3300041463 | Bacteria | 909 |
| 438 | Ga0451807_0125265 | 3300041486 | Bacteria | 1490 |
| 439 | Ga0451807_0309351 | 3300041486 | Bacteria | 1142 |
| 440 | Ga0451843_0937299 | 3300041509 | Bacteria | 3038 |
| 441 | Ga0451853_2200120 | 3300041512 | Bacteria | 1502 |
| 442 | Ga0439432_002171 | 3300042006 | Bacteria | 7404 |
| 443 | Ga0439432_019482 | 3300042006 | Bacteria | 2260 |
| 444 | Ga0439449_0002465 | 3300042007 | Bacteria | 7234 |
| 445 | Ga0439449_0050398 | 3300042007 | Bacteria | 1540 |
| 446 | Ga0439449_0079319 | 3300042007 | Bacteria | 1210 |
| 447 | Ga0439456_002488 | 3300042013 | Bacteria | 3716 |
| 448 | Ga0439463_043094 | 3300042016 | Bacteria | 1148 |
| 449 | Ga0450911_013117 | 3300042115 | Bacteria | 1112 |
| 450 | Ga0450911_025422 | 3300042115 | Bacteria | 768 |
| 451 | Ga0450898_004210 | 3300042134 | Bacteria | 2111 |
| 452 | Ga0450902_000311 | 3300042137 | Bacteria | 5871 |
| 453 | Ga0450902_017535 | 3300042137 | Bacteria | 1171 |
| 454 | Ga0450905_002952 | 3300042142 | Bacteria | 2217 |
| 455 | Ga0439464_0035796 | 3300042439 | Bacteria | 1403 |
| 456 | Ga0450901_000303 | 3300042533 | Bacteria | 6044 |
| 457 | Ga0451577_0008692 | 3300042876 | Bacteria | 9855 |
| 458 | Ga0451577_0076360 | 3300042876 | Bacteria | 2987 |
| 459 | Ga0451577_0077718 | 3300042876 | Bacteria | 2959 |
| 460 | Ga0451577_0114257 | 3300042876 | Bacteria | 2417 |
| 461 | Ga0451577_0170983 | 3300042876 | Unclassified | 1958 |
| 462 | Ga0451577_0248917 | 3300042876 | Bacteria | 1608 |
| 463 | Ga0451577_0429540 | 3300042876 | Bacteria | 1199 |
| 464 | Ga0451577_0699290 | 3300042876 | Bacteria | 918 |
| 465 | Ga0453683_0022770 | 3300044673 | Bacteria | 3994 |
| 466 | Ga0453684_0023479 | 3300044712 | Bacteria | 9075 |
| 467 | Ga0453684_0548431 | 3300044712 | Bacteria | 1274 |
| 468 | Ga0453684_0559808 | 3300044712 | Bacteria | 1258 |
| 469 | Ga0466959_0001261 | 3300045049 | Bacteria | 15290 |
| 470 | Ga0451576_0015411 | 3300045051 | Bacteria | 8468 |
| 471 | Ga0451576_0128369 | 3300045051 | Bacteria | 2642 |
| 472 | Ga0451576_0716079 | 3300045051 | Unclassified | 1051 |
| 473 | Ga0495627_000152 | 3300046453 | Bacteria | 81535 |
| 474 | Ga0495627_007838 | 3300046453 | Bacteria | 4059 |
| 475 | Ga0495627_007952 | 3300046453 | Bacteria | 4015 |
| 476 | Ga0495591_000827 | 3300046458 | Bacteria | 21897 |
| 477 | Ga0495591_010352 | 3300046458 | Bacteria | 3622 |
| 478 | Ga0495591_013962 | 3300046458 | Bacteria | 2910 |
| 479 | Ga0495591_022796 | 3300046458 | Bacteria | 2018 |
| 480 | Ga0495638_0020231 | 3300046460 | Bacteria | 4397 |
| 481 | Ga0495638_0069505 | 3300046460 | Bacteria | 2158 |
| 482 | Ga0495638_0098960 | 3300046460 | Bacteria | 1746 |
| 483 | Ga0495638_0175430 | 3300046460 | Bacteria | 1227 |
| 484 | Ga0495650_0021106 | 3300046471 | Bacteria | 3157 |
| 485 | Ga0495650_0025875 | 3300046471 | Bacteria | 2740 |
| 486 | Ga0495605_0000088 | 3300046474 | Bacteria | 119191 |
| 487 | Ga0495605_0045745 | 3300046474 | Bacteria | 2155 |
| 488 | Ga0495605_0051487 | 3300046474 | Bacteria | 2005 |
| 489 | Ga0495605_0067067 | 3300046474 | Bacteria | 1703 |
| 490 | Ga0495584_0050990 | 3300046491 | Bacteria | 2084 |
| 491 | Ga0495585_0046471 | 3300046492 | Bacteria | 2421 |
| 492 | Ga0495594_0112091 | 3300046499 | Bacteria | 1538 |
| 493 | Ga0495596_0073563 | 3300046500 | Bacteria | 1327 |
| 494 | Ga0495607_0033814 | 3300046501 | Bacteria | 3108 |
| 495 | Ga0495607_0054139 | 3300046501 | Bacteria | 2313 |
| 496 | Ga0495583_0000135 | 3300046506 | Bacteria | 123916 |
| 497 | Ga0495583_0017540 | 3300046506 | Bacteria | 3796 |
| 498 | Ga0495606_0027400 | 3300046507 | Bacteria | 4042 |
| 499 | Ga0495606_0071235 | 3300046507 | Bacteria | 2189 |
| 500 | Ga0495610_0015133 | 3300046512 | Bacteria | 4497 |
| 501 | Ga0495610_0018248 | 3300046512 | Bacteria | 3969 |
| 502 | Ga0495610_0026675 | 3300046512 | Bacteria | 3081 |
| 503 | Ga0495610_0066035 | 3300046512 | Bacteria | 1705 |
| 504 | Ga0495610_0181756 | 3300046512 | Bacteria | 874 |
| 505 | Ga0495610_0188260 | 3300046512 | Bacteria | 853 |
| 506 | Ga0495616_0220097 | 3300046513 | Bacteria | 827 |
| 507 | Ga0495620_0000034 | 3300046515 | Bacteria | 117942 |
| 508 | Ga0495620_0000450 | 3300046515 | Bacteria | 27327 |
| 509 | Ga0495620_0016959 | 3300046515 | Bacteria | 3641 |
| 510 | Ga0495620_0019389 | 3300046515 | Bacteria | 3346 |
| 511 | Ga0495620_0040801 | 3300046515 | Bacteria | 2040 |
| 512 | Ga0495630_0046527 | 3300046517 | Bacteria | 3243 |
| 513 | Ga0495631_0030875 | 3300046518 | Bacteria | 2428 |
| 514 | Ga0495631_0052270 | 3300046518 | Bacteria | 1784 |
| 515 | Ga0495631_0291972 | 3300046518 | Bacteria | 694 |
| 516 | Ga0495632_0000578 | 3300046519 | Bacteria | 33996 |
| 517 | Ga0495632_0023328 | 3300046519 | Bacteria | 3305 |
| 518 | Ga0495632_0155789 | 3300046519 | Bacteria | 1054 |
| 519 | Ga0495637_0011562 | 3300046520 | Bacteria | 4240 |
| 520 | Ga0495637_0030568 | 3300046520 | Bacteria | 2388 |
| 521 | Ga0495637_0113627 | 3300046520 | Bacteria | 1047 |
| 522 | Ga0495643_0001366 | 3300046522 | Bacteria | 22850 |
| 523 | Ga0495643_0073894 | 3300046522 | Bacteria | 1786 |
| 524 | Ga0495648_0021576 | 3300046524 | Bacteria | 4455 |
| 525 | Ga0495648_0024375 | 3300046524 | Bacteria | 4122 |
| 526 | Ga0495648_0066234 | 3300046524 | Bacteria | 2118 |
| 527 | Ga0495663_0031671 | 3300046525 | Bacteria | 1572 |
| 528 | Ga0495663_0073029 | 3300046525 | Bacteria | 1095 |
| 529 | Ga0495654_0011169 | 3300046530 | Bacteria | 4874 |
| 530 | Ga0495654_0012081 | 3300046530 | Bacteria | 4649 |
| 531 | Ga0495654_0015779 | 3300046530 | Bacteria | 4006 |
| 532 | Ga0495654_0045449 | 3300046530 | Bacteria | 2166 |
| 533 | Ga0495654_0119478 | 3300046530 | Bacteria | 1194 |
| 534 | Ga0495654_0178096 | 3300046530 | Bacteria | 922 |
| 535 | Ga0495587_0038456 | 3300046536 | Bacteria | 2868 |
| 536 | Ga0495609_0000247 | 3300046538 | Bacteria | 51172 |
| 537 | Ga0495609_0026730 | 3300046538 | Bacteria | 2641 |
| 538 | Ga0495609_0047382 | 3300046538 | Bacteria | 1923 |
| 539 | Ga0495597_0000050 | 3300046542 | Bacteria | 98185 |
| 540 | Ga0495597_0019436 | 3300046542 | Bacteria | 3179 |
| 541 | Ga0495633_0000468 | 3300046558 | Bacteria | 41323 |
| 542 | Ga0495633_0043664 | 3300046558 | Bacteria | 2126 |
| 543 | Ga0495656_0002924 | 3300046615 | Bacteria | 5726 |
| 544 | Ga0495656_0006875 | 3300046615 | Bacteria | 4000 |
| 545 | Ga0495656_0016521 | 3300046615 | Bacteria | 2801 |
| 546 | Ga0495656_0108296 | 3300046615 | Bacteria | 1295 |
| 547 | Ga0495634_0033626 | 3300046642 | Bacteria | 3523 |
| 548 | Ga0495611_0032571 | 3300046648 | Bacteria | 2297 |
| 549 | Ga0495625_0145309 | 3300046660 | Bacteria | 1597 |
| 550 | Ga0495635_0044746 | 3300046663 | Bacteria | 3053 |
| 551 | Ga0495661_0000078 | 3300046665 | Bacteria | 119097 |
| 552 | Ga0495661_0075057 | 3300046665 | Bacteria | 1965 |
| 553 | Ga0495623_0111725 | 3300046679 | Bacteria | 1655 |
| 554 | Ga0495670_0038487 | 3300046691 | Bacteria | 2384 |
| 555 | Ga0495670_0078535 | 3300046691 | Bacteria | 1679 |
| 556 | Ga0495670_0172881 | 3300046691 | Bacteria | 1138 |
| 557 | Ga0495671_0072757 | 3300046692 | Bacteria | 1687 |
| 558 | Ga0495649_0065648 | 3300046694 | Bacteria | 1948 |
| 559 | Ga0495649_0172365 | 3300046694 | Bacteria | 1131 |
| 560 | Ga0495589_0031553 | 3300046794 | Bacteria | 2666 |
| 561 | Ga0495660_0011997 | 3300046810 | Bacteria | 5026 |
| 562 | Ga0495660_0027659 | 3300046810 | Bacteria | 3208 |
| 563 | Ga0495604_0073965 | 3300047317 | Bacteria | 2570 |
| 564 | Ga0495636_0000568 | 3300047318 | Bacteria | 13596 |
| 565 | Ga0495636_0055237 | 3300047318 | Bacteria | 1670 |
| 566 | Ga0495636_0063315 | 3300047318 | Bacteria | 1567 |
| 567 | Ga0495636_0105227 | 3300047318 | Unclassified | 1237 |
| 568 | Ga0495674_0139503 | 3300047319 | Bacteria | 2038 |
| 569 | Ga0495680_0079386 | 3300047322 | Bacteria | 2481 |
| 570 | Ga0495683_0000108 | 3300047323 | Bacteria | 84498 |
| 571 | Ga0495679_000944 | 3300047446 | Bacteria | 18097 |
| 572 | Ga0495679_067878 | 3300047446 | Bacteria | 1032 |
| 573 | Ga0495673_0011018 | 3300047469 | Bacteria | 4890 |
| 574 | Ga0495673_0018033 | 3300047469 | Bacteria | 3570 |
| 575 | Ga0495673_0031726 | 3300047469 | Bacteria | 2471 |
| 576 | Ga0495681_0019250 | 3300047470 | Bacteria | 3733 |
| 577 | Ga0495681_0025109 | 3300047470 | Bacteria | 3123 |
| 578 | Ga0495681_0034385 | 3300047470 | Bacteria | 2526 |
| 579 | Ga0495681_0114252 | 3300047470 | Bacteria | 1165 |
| 580 | Ga0495686_0047547 | 3300047472 | Bacteria | 2708 |
| 581 | Ga0495593_0017139 | 3300047673 | Bacteria | 4076 |
| 582 | Ga0496100_0341465 | 3300048903 | Unclassified | 1129 |
| 583 | Ga0496101_0216069 | 3300048904 | Bacteria | 1487 |
| 584 | Ga0496102_0051425 | 3300048905 | Bacteria | 3753 |
| 585 | Ga0496103_0035071 | 3300048906 | Bacteria | 3070 |
| 586 | Ga0496107_0367802 | 3300048910 | Bacteria | 1070 |
| 587 | Ga0496107_0727762 | 3300048910 | Bacteria | 729 |
| 588 | Ga0496108_0322647 | 3300048911 | Bacteria | 1346 |
| 589 | Ga0496113_0237843 | 3300048916 | Bacteria | 1453 |
| 590 | Ga0496114_0007715 | 3300048917 | Bacteria | 8512 |
| 591 | Ga0496114_0065411 | 3300048917 | Bacteria | 3046 |
| 592 | Ga0496115_0084376 | 3300048918 | Bacteria | 2590 |
| 593 | Ga0496115_0229988 | 3300048918 | Unclassified | 1529 |
| 594 | Ga0496116_0054876 | 3300048919 | Bacteria | 2621 |
| 595 | Ga0496116_0069835 | 3300048919 | Bacteria | 2232 |
| 596 | Ga0496117_0001939 | 3300048920 | Bacteria | 27596 |
| 597 | Ga0496117_0032706 | 3300048920 | Bacteria | 3948 |
| 598 | Ga0496117_0061673 | 3300048920 | Bacteria | 2575 |
| 599 | Ga0496117_0067095 | 3300048920 | Bacteria | 2429 |
| 600 | Ga0496117_0115973 | 3300048920 | Bacteria | 1656 |
| 601 | Ga0496117_0192870 | 3300048920 | Bacteria | 1158 |
| 602 | Ga0496118_0000183 | 3300048921 | Bacteria | 110206 |
| 603 | Ga0496118_0006923 | 3300048921 | Bacteria | 12264 |
| 604 | Ga0496118_0007851 | 3300048921 | Bacteria | 11189 |
| 605 | Ga0496118_0061865 | 3300048921 | Bacteria | 2768 |
| 606 | Ga0496118_0079734 | 3300048921 | Bacteria | 2308 |
| 607 | Ga0496118_0121677 | 3300048921 | Bacteria | 1699 |
| 608 | Ga0496118_0151384 | 3300048921 | Bacteria | 1451 |
| 609 | Ga0496118_0173652 | 3300048921 | Bacteria | 1312 |
| 610 | Ga0496119_0000130 | 3300048922 | Bacteria | 106433 |
| 611 | Ga0496119_0027855 | 3300048922 | Bacteria | 3871 |
| 612 | Ga0496119_0081607 | 3300048922 | Bacteria | 1861 |
| 613 | Ga0496119_0106743 | 3300048922 | Bacteria | 1562 |
| 614 | Ga0496119_0204940 | 3300048922 | Bacteria | 1018 |
| 615 | Ga0496120_0005328 | 3300048923 | Bacteria | 10302 |
| 616 | Ga0496120_0029447 | 3300048923 | Bacteria | 3351 |
| 617 | Ga0496120_0073795 | 3300048923 | Bacteria | 1865 |
| 618 | Ga0496120_0088019 | 3300048923 | Bacteria | 1665 |
| 619 | Ga0496121_0012278 | 3300048924 | Bacteria | 9376 |
| 620 | Ga0496121_0031139 | 3300048924 | Bacteria | 4882 |
| 621 | Ga0496121_0053409 | 3300048924 | Bacteria | 3385 |
| 622 | Ga0496121_0055119 | 3300048924 | Bacteria | 3315 |
| 623 | Ga0496121_0061803 | 3300048924 | Bacteria | 3071 |
| 624 | Ga0496121_0082346 | 3300048924 | Bacteria | 2544 |
| 625 | Ga0496121_0108155 | 3300048924 | Bacteria | 2127 |
| 626 | Ga0496121_0131317 | 3300048924 | Bacteria | 1874 |
| 627 | Ga0496121_0221315 | 3300048924 | Bacteria | 1333 |
| 628 | Ga0496122_0003935 | 3300048925 | Bacteria | 18981 |
| 629 | Ga0496122_0018800 | 3300048925 | Bacteria | 6355 |
| 630 | Ga0496122_0086182 | 3300048925 | Bacteria | 2163 |
| 631 | Ga0496122_0089975 | 3300048925 | Bacteria | 2096 |
| 632 | Ga0496122_0119626 | 3300048925 | Bacteria | 1702 |
| 633 | Ga0496122_0124505 | 3300048925 | Bacteria | 1653 |
| 634 | Ga0496122_0178592 | 3300048925 | Bacteria | 1269 |
| 635 | Ga0496123_0002092 | 3300048926 | Bacteria | 25681 |
| 636 | Ga0496123_0058032 | 3300048926 | Bacteria | 2514 |
| 637 | Ga0496123_0061878 | 3300048926 | Bacteria | 2402 |
| 638 | Ga0496123_0073574 | 3300048926 | Bacteria | 2119 |
| 639 | Ga0496123_0085420 | 3300048926 | Bacteria | 1898 |
| 640 | Ga0496123_0092142 | 3300048926 | Bacteria | 1794 |
| 641 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 642 | Ga0496124_0000658 | 3300048927 | Bacteria | 56989 |
| 643 | Ga0496124_0040787 | 3300048927 | Bacteria | 4012 |
| 644 | Ga0496124_0042651 | 3300048927 | Bacteria | 3905 |
| 645 | Ga0496124_0058616 | 3300048927 | Bacteria | 3237 |
| 646 | Ga0496124_0073900 | 3300048927 | Bacteria | 2819 |
| 647 | Ga0496124_0091823 | 3300048927 | Bacteria | 2473 |
| 648 | Ga0496124_0141188 | 3300048927 | Bacteria | 1900 |
| 649 | Ga0496124_0280236 | 3300048927 | Bacteria | 1216 |
| 650 | Ga0496124_0331306 | 3300048927 | Bacteria | 1085 |
| 651 | Ga0496124_0447722 | 3300048927 | Bacteria | 881 |
| 652 | Ga0496125_0008568 | 3300048928 | Bacteria | 10681 |
| 653 | Ga0496125_0033943 | 3300048928 | Bacteria | 4506 |
| 654 | Ga0496125_0036932 | 3300048928 | Bacteria | 4255 |
| 655 | Ga0496125_0051851 | 3300048928 | Bacteria | 3379 |
| 656 | Ga0496125_0075077 | 3300048928 | Bacteria | 2618 |
| 657 | Ga0496125_0087719 | 3300048928 | Bacteria | 2349 |
| 658 | Ga0496125_0149824 | 3300048928 | Bacteria | 1604 |
| 659 | Ga0496125_0344078 | 3300048928 | Bacteria | 893 |
| 660 | Ga0496126_0072160 | 3300048929 | Bacteria | 3071 |
| 661 | Ga0496126_0101104 | 3300048929 | Bacteria | 2522 |
| 662 | Ga0496126_0185396 | 3300048929 | Bacteria | 1765 |
| 663 | Ga0496126_0193110 | 3300048929 | Bacteria | 1723 |
| 664 | Ga0496126_0222319 | 3300048929 | Bacteria | 1585 |
| 665 | Ga0495678_000081 | 3300049459 | Bacteria | 118700 |
| 666 | Ga0495682_0000120 | 3300049460 | Bacteria | 68718 |
| 667 | Ga0495682_0025725 | 3300049460 | Bacteria | 2189 |
| 668 | Ga0501031_0003171 | 3300049568 | Bacteria | 10552 |
| 669 | Ga0501031_0021912 | 3300049568 | Bacteria | 4163 |
| 670 | Ga0501031_0028905 | 3300049568 | Bacteria | 3614 |
| 671 | Ga0501032_0086669 | 3300049569 | Bacteria | 2081 |
| 672 | Ga0501032_0217537 | 3300049569 | Bacteria | 1244 |
| 673 | Ga0501032_0244603 | 3300049569 | Bacteria | 1165 |
| 674 | Ga0501033_0000683 | 3300049570 | Bacteria | 31408 |
| 675 | Ga0501033_0001210 | 3300049570 | Bacteria | 23194 |
| 676 | Ga0501033_0004171 | 3300049570 | Bacteria | 11633 |
| 677 | Ga0501033_0037101 | 3300049570 | Bacteria | 3649 |
| 678 | Ga0501033_0102546 | 3300049570 | Bacteria | 2087 |
| 679 | Ga0501033_0129147 | 3300049570 | Bacteria | 1831 |
| 680 | Ga0501033_0153969 | 3300049570 | Bacteria | 1657 |
| 681 | Ga0501033_0381657 | 3300049570 | Bacteria | 984 |
| 682 | Ga0501034_0000325 | 3300049571 | Bacteria | 83662 |
| 683 | Ga0501034_0031276 | 3300049571 | Bacteria | 5406 |
| 684 | Ga0501034_0071383 | 3300049571 | Bacteria | 3482 |
| 685 | Ga0501034_0290428 | 3300049571 | Bacteria | 1573 |
| 686 | Ga0501034_0314562 | 3300049571 | Bacteria | 1500 |
| 687 | Ga0501034_0441955 | 3300049571 | Bacteria | 1219 |
| 688 | Ga0501034_0621404 | 3300049571 | Bacteria | 984 |
| 689 | Ga0501034_0777371 | 3300049571 | Bacteria | 851 |
| 690 | Ga0501036_0027681 | 3300049572 | Bacteria | 4791 |
| 691 | Ga0501036_0076796 | 3300049572 | Bacteria | 2826 |
| 692 | Ga0501036_0277301 | 3300049572 | Bacteria | 1403 |
| 693 | Ga0501037_0006686 | 3300049573 | Bacteria | 8432 |
| 694 | Ga0501037_0030003 | 3300049573 | Bacteria | 4017 |
| 695 | Ga0501037_0045277 | 3300049573 | Bacteria | 3230 |
| 696 | Ga0501037_0247053 | 3300049573 | Bacteria | 1249 |
| 697 | Ga0501037_0280683 | 3300049573 | Bacteria | 1160 |
| 698 | Ga0501038_0032416 | 3300049574 | Bacteria | 4610 |
| 699 | Ga0501038_0060072 | 3300049574 | Bacteria | 3254 |
| 700 | Ga0501038_0063225 | 3300049574 | Bacteria | 3160 |
| 701 | Ga0501038_0112856 | 3300049574 | Bacteria | 2250 |
| 702 | Ga0501043_0021707 | 3300049579 | Bacteria | 5033 |
| 703 | Ga0501043_0055597 | 3300049579 | Bacteria | 3109 |
| 704 | Ga0501043_0055862 | 3300049579 | Bacteria | 3101 |
| 705 | Ga0501043_0131236 | 3300049579 | Bacteria | 1963 |
| 706 | Ga0501043_0179101 | 3300049579 | Bacteria | 1652 |
| 707 | Ga0501043_0404042 | 3300049579 | Bacteria | 1032 |
| 708 | Ga0501046_0040047 | 3300049580 | Bacteria | 3747 |
| 709 | Ga0501046_0062908 | 3300049580 | Bacteria | 2899 |
| 710 | Ga0501046_0148899 | 3300049580 | Bacteria | 1766 |
| 711 | Ga0501046_0262877 | 3300049580 | Bacteria | 1267 |
| 712 | Ga0501047_0043531 | 3300049581 | Bacteria | 4337 |
| 713 | Ga0501047_0045001 | 3300049581 | Bacteria | 4266 |
| 714 | Ga0501047_0050180 | 3300049581 | Bacteria | 4029 |
| 715 | Ga0501047_0088139 | 3300049581 | Bacteria | 2980 |
| 716 | Ga0501047_0155707 | 3300049581 | Bacteria | 2159 |
| 717 | Ga0501047_0312368 | 3300049581 | Bacteria | 1412 |
| 718 | Ga0501047_0599375 | 3300049581 | Bacteria | 923 |
| 719 | Ga0501070_0015349 | 3300049586 | Bacteria | 6445 |
| 720 | Ga0501070_0144596 | 3300049586 | Bacteria | 1963 |
| 721 | Ga0501070_0356438 | 3300049586 | Bacteria | 1187 |
| 722 | Ga0501073_0270312 | 3300049589 | Bacteria | 1173 |
| 723 | Ga0501073_0512599 | 3300049589 | Bacteria | 829 |
| 724 | Ga0501074_0709059 | 3300049590 | Bacteria | 710 |
| 725 | Ga0501077_0088828 | 3300049593 | Bacteria | 1959 |
| 726 | Ga0501235_020753 | 3300049669 | Bacteria | 1459 |
| 727 | Ga0501250_013566 | 3300049680 | Bacteria | 979 |
| 728 | Ga0501080_0007824 | 3300049742 | Bacteria | 9669 |
| 729 | Ga0501080_0192536 | 3300049742 | Bacteria | 1874 |
| 730 | Ga0501035_0005012 | 3300049822 | Bacteria | 12540 |
| 731 | Ga0501035_0008708 | 3300049822 | Bacteria | 9449 |
| 732 | Ga0501035_0013853 | 3300049822 | Bacteria | 7443 |
| 733 | Ga0501035_0016440 | 3300049822 | Bacteria | 6825 |
| 734 | Ga0501035_0044579 | 3300049822 | Bacteria | 3993 |
| 735 | Ga0501035_0049900 | 3300049822 | Bacteria | 3751 |
| 736 | Ga0501035_0050686 | 3300049822 | Bacteria | 3719 |
| 737 | Ga0501035_0140616 | 3300049822 | Bacteria | 2099 |
| 738 | Ga0501035_0412737 | 3300049822 | Bacteria | 1122 |
| 739 | Ga0501035_0530788 | 3300049822 | Bacteria | 966 |
| 740 | Ga0501044_0000162 | 3300049823 | Bacteria | 82725 |
| 741 | Ga0501044_0001700 | 3300049823 | Bacteria | 25816 |
| 742 | Ga0501044_0005271 | 3300049823 | Bacteria | 14380 |
| 743 | Ga0501044_0009521 | 3300049823 | Bacteria | 10577 |
| 744 | Ga0501044_0042804 | 3300049823 | Bacteria | 4708 |
| 745 | Ga0501044_0090225 | 3300049823 | Bacteria | 3092 |
| 746 | Ga0501044_0090995 | 3300049823 | Bacteria | 3077 |
| 747 | Ga0501044_0108156 | 3300049823 | Bacteria | 2791 |
| 748 | Ga0501044_0160875 | 3300049823 | Bacteria | 2222 |
| 749 | Ga0501044_0266207 | 3300049823 | Bacteria | 1651 |
| 750 | Ga0501044_0415913 | 3300049823 | Bacteria | 1255 |
| 751 | Ga0501044_0562410 | 3300049823 | Bacteria | 1036 |
| 752 | Ga0501044_0640692 | 3300049823 | Bacteria | 952 |
| 753 | Ga0501045_0384267 | 3300049824 | Bacteria | 1045 |
| 754 | Ga0501045_0389256 | 3300049824 | Bacteria | 1038 |
| 755 | nmdc:mga00v17_1308_c1 | 3300050491 | Bacteria | 13041 |
| 756 | nmdc:mga00v17_180342_c1 | 3300050491 | Bacteria | 1363 |
| 757 | nmdc:mga07m45_71143_c1 | 3300050496 | Bacteria | 1979 |
| 758 | nmdc:mga08y16_148230_c1 | 3300050511 | Unclassified | 2439 |
| 759 | nmdc:mga08y16_330237_c1 | 3300050511 | Unclassified | 1569 |
| 760 | Ga0500595_018129 | 3300053119 | Bacteria | 2581 |
| 761 | Ga0500618_002180 | 3300053125 | Bacteria | 7680 |
| 762 | Ga0500618_007900 | 3300053125 | Bacteria | 3004 |
| 763 | Ga0500659_0066937 | 3300053135 | Bacteria | 1909 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046518 | Ga0495631_0291972 | Ga0495631_0291972_104_655 | 183 |
| 2 | 3300049573 | Ga0501037_0045277 | Ga0501037_0045277_24_614 | 195 |
| 3 | 3300049590 | Ga0501074_0709059 | Ga0501074_0709059_102_692 | 196 |
| 4 | 3300009036 | Ga0105244_10084971 | Ga0105244_100849712 | 199 |
| 5 | 3300009148 | Ga0105243_10035319 | Ga0105243_100353193 | 199 |
| 6 | 3300025728 | Ga0207655_1056983 | Ga0207655_10569832 | 199 |
| 7 | 3300025935 | Ga0207709_10027997 | Ga0207709_100279973 | 199 |
| 8 | 3300048920 | Ga0496117_0061673 | Ga0496117_0061673_1104_1892 | 199 |
| 9 | 3300049586 | Ga0501070_0144596 | Ga0501070_0144596_663_1316 | 203 |
| 10 | 3300031507 | Ga0307509_10014264 | Ga0307509_100142647 | 205 |
| 11 | 3300046471 | Ga0495650_0021106 | Ga0495650_0021106_2224_2856 | 205 |
| 12 | 3300046500 | Ga0495596_0073563 | Ga0495596_0073563_369_1001 | 205 |
| 13 | 3300046515 | Ga0495620_0000450 | Ga0495620_0000450_16837_17577 | 206 |
| 14 | 3300046519 | Ga0495632_0000578 | Ga0495632_0000578_24689_25429 | 206 |
| 15 | 3300046522 | Ga0495643_0001366 | Ga0495643_0001366_16896_17636 | 206 |
| 16 | 3300046524 | Ga0495648_0021576 | Ga0495648_0021576_1867_2607 | 206 |
| 17 | 3300046460 | Ga0495638_0098960 | Ga0495638_0098960_112_777 | 207 |
| 18 | 3300046460 | Ga0495638_0175430 | Ga0495638_0175430_265_945 | 207 |
| 19 | 3300049460 | Ga0495682_0025725 | Ga0495682_0025725_1066_1731 | 207 |
| 20 | 3300048922 | Ga0496119_0106743 | Ga0496119_0106743_472_1212 | 208 |
| 21 | 3300048924 | Ga0496121_0131317 | Ga0496121_0131317_746_1486 | 208 |
| 22 | 3300048927 | Ga0496124_0141188 | Ga0496124_0141188_298_1038 | 208 |
| 23 | 3300006058 | Ga0075432_10034834 | Ga0075432_100348342 | 209 |
| 24 | 3300014326 | Ga0157380_10177604 | Ga0157380_101776041 | 210 |
| 25 | 3300014745 | Ga0157377_10564228 | Ga0157377_105642281 | 210 |
| 26 | 3300025926 | Ga0207659_10746209 | Ga0207659_107462091 | 210 |
| 27 | 3300025938 | Ga0207704_10524697 | Ga0207704_105246971 | 210 |
| 28 | 3300049460 | Ga0495682_0000120 | Ga0495682_0000120_18210_18875 | 210 |
| 29 | 3300050511 | nmdc:mga08y16_148230_c1 | nmdc:mga08y16_148230_c1_173_814 | 210 |
| 30 | 3300005355 | Ga0070671_100083924 | Ga0070671_1000839242 | 212 |
| 31 | 3300013297 | Ga0157378_10046334 | Ga0157378_100463342 | 212 |
| 32 | 3300025931 | Ga0207644_10125044 | Ga0207644_101250443 | 212 |
| 33 | 3300046512 | Ga0495610_0018248 | Ga0495610_0018248_1055_1711 | 212 |
| 34 | 3300046515 | Ga0495620_0016959 | Ga0495620_0016959_1883_2539 | 212 |
| 35 | 3300046519 | Ga0495632_0155789 | Ga0495632_0155789_254_910 | 212 |
| 36 | iso_pu_bacteria | 2554235231 | 2555246414 | 212 |
| 37 | iso_pu_bacteria | 2912963787 | 2912967561 | 212 |
| 38 | iso_pu_bacteria | 2919155634 | 2919157406 | 212 |
| 39 | iso_pu_bacteria | 2939651529 | 2939653071 | 212 |
| 40 | iso_pu_bacteria | 3007252601 | 3007253106 | 212 |
| 41 | iso_pu_bacteria | 3007803356 | 3007804344 | 212 |
| 42 | iso_pu_bacteria | 8052494512 | 8052496064 | 212 |
| 43 | 3300005577 | Ga0068857_100104147 | Ga0068857_1001041472 | 213 |
| 44 | 3300009094 | Ga0111539_10061200 | Ga0111539_100612001 | 213 |
| 45 | 3300014325 | Ga0163163_10753547 | Ga0163163_107535471 | 213 |
| 46 | 3300014326 | Ga0157380_10410763 | Ga0157380_104107631 | 213 |
| 47 | 3300025926 | Ga0207659_10732366 | Ga0207659_107323661 | 213 |
| 48 | 3300047470 | Ga0495681_0019250 | Ga0495681_0019250_1944_2600 | 213 |
| 49 | 3300050511 | nmdc:mga08y16_330237_c1 | nmdc:mga08y16_330237_c1_430_1080 | 213 |
| 50 | iso_pu_bacteria | 2511231026 | 2511387357 | 213 |
| 51 | iso_pu_bacteria | 2857542790 | 2857545720 | 213 |
| 52 | iso_pu_bacteria | 2860339153 | 2860340776 | 213 |
| 53 | iso_pu_bacteria | 2931396565 | 2931403329 | 213 |
| 54 | 3300006237 | Ga0097621_100147890 | Ga0097621_1001478902 | 214 |
| 55 | iso_pu_bacteria | 2551306416 | 2553006242 | 214 |
| 56 | iso_pu_bacteria | 2554235132 | 2554814540 | 214 |
| 57 | iso_pu_bacteria | 2571042365 | 2572253433 | 214 |
| 58 | iso_pu_bacteria | 2597489888 | 2597863013 | 214 |
| 59 | iso_pu_bacteria | 2599185167 | 2599401593 | 214 |
| 60 | iso_pu_bacteria | 2599185179 | 2599451866 | 214 |
| 61 | iso_pu_bacteria | 2599185189 | 2599509634 | 214 |
| 62 | iso_pu_bacteria | 2599185190 | 2599514837 | 214 |
| 63 | iso_pu_bacteria | 2599185191 | 2599520935 | 214 |
| 64 | iso_pu_bacteria | 2599185288 | 2599882182 | 214 |
| 65 | iso_pu_bacteria | 2599185290 | 2599894366 | 214 |
| 66 | iso_pu_bacteria | 2599185303 | 2599951574 | 214 |
| 67 | iso_pu_bacteria | 2600254954 | 2600444462 | 214 |
| 68 | iso_pu_bacteria | 2600255296 | 2601694278 | 214 |
| 69 | iso_pu_bacteria | 2600255389 | 2602011547 | 214 |
| 70 | iso_pu_bacteria | 2606217733 | 2608381924 | 214 |
| 71 | iso_pu_bacteria | 2643221633 | 2644187442 | 214 |
| 72 | iso_pu_bacteria | 2643221713 | 2644623528 | 214 |
| 73 | iso_pu_bacteria | 2675903420 | 2677896850 | 214 |
| 74 | iso_pu_bacteria | 2721755607 | 2723247830 | 214 |
| 75 | iso_pu_bacteria | 2738541271 | 2738689047 | 214 |
| 76 | iso_pu_bacteria | 2738541294 | 2738810835 | 214 |
| 77 | iso_pu_bacteria | 2738541309 | 2738898195 | 214 |
| 78 | iso_pu_bacteria | 2738543016 | 2739264434 | 214 |
| 79 | iso_pu_bacteria | 2765235838 | 2765570979 | 214 |
| 80 | iso_pu_bacteria | 2808606385 | 2808979451 | 214 |
| 81 | iso_pu_bacteria | 2808606386 | 2808984849 | 214 |
| 82 | iso_pu_bacteria | 2808606388 | 2808995375 | 214 |
| 83 | iso_pu_bacteria | 2808606415 | 2809128255 | 214 |
| 84 | iso_pu_bacteria | 2808606419 | 2809147876 | 214 |
| 85 | iso_pu_bacteria | 2834028612 | 2834029661 | 214 |
| 86 | iso_pu_bacteria | 2839094727 | 2839099329 | 214 |
| 87 | iso_pu_bacteria | 2842826826 | 2842831976 | 214 |
| 88 | iso_pu_bacteria | 2842837860 | 2842841560 | 214 |
| 89 | iso_pu_bacteria | 2852612431 | 2852618458 | 214 |
| 90 | iso_pu_bacteria | 2852618963 | 2852620713 | 214 |
| 91 | iso_pu_bacteria | 2852667396 | 2852673406 | 214 |
| 92 | iso_pu_bacteria | 2855730933 | 2855734704 | 214 |
| 93 | iso_pu_bacteria | 2855767633 | 2855770488 | 214 |
| 94 | iso_pu_bacteria | 2881927736 | 2881931578 | 214 |
| 95 | iso_pu_bacteria | 2894414249 | 2894415291 | 214 |
| 96 | iso_pu_bacteria | 2894510363 | 2894513732 | 214 |
| 97 | iso_pu_bacteria | 2895395659 | 2895399032 | 214 |
| 98 | iso_pu_bacteria | 2895498888 | 2895499225 | 214 |
| 99 | iso_pu_bacteria | 2895511927 | 2895512246 | 214 |
| 100 | iso_pu_bacteria | 2895522137 | 2895522257 | 214 |
| 101 | iso_pu_bacteria | 2895525241 | 2895527300 | 214 |
| 102 | iso_pu_bacteria | 2904439833 | 2904443358 | 214 |
| 103 | iso_pu_bacteria | 2904530477 | 2904533069 | 214 |
| 104 | iso_pu_bacteria | 2904584206 | 2904585622 | 214 |
| 105 | iso_pu_bacteria | 2904589729 | 2904593971 | 214 |
| 106 | iso_pu_bacteria | 2904601388 | 2904603876 | 214 |
| 107 | iso_pu_bacteria | 2908446538 | 2908448575 | 214 |
| 108 | iso_pu_bacteria | 2919046199 | 2919047583 | 214 |
| 109 | iso_pu_bacteria | 2919079590 | 2919081886 | 214 |
| 110 | iso_pu_bacteria | 2919513703 | 2919516565 | 214 |
| 111 | iso_pu_bacteria | 2919675420 | 2919678548 | 214 |
| 112 | iso_pu_bacteria | 2923510766 | 2923513492 | 214 |
| 113 | iso_pu_bacteria | 2931390751 | 2931392728 | 214 |
| 114 | iso_pu_bacteria | 2945928738 | 2945928936 | 214 |
| 115 | iso_pu_bacteria | 2945961074 | 2945962267 | 214 |
| 116 | iso_pu_bacteria | 2946006987 | 2946011161 | 214 |
| 117 | iso_pu_bacteria | 2990196909 | 2990199053 | 214 |
| 118 | iso_pu_bacteria | 640427133 | 640488485 | 214 |
| 119 | iso_pu_bacteria | 651053060 | 651176521 | 214 |
| 120 | iso_pu_bacteria | 8034962539 | 8034964939 | 214 |
| 121 | iso_pu_bacteria | 8054285046 | 8054288176 | 214 |
| 122 | iso_pu_bacteria | 8054347763 | 8054352092 | 214 |
| 123 | iso_pu_bacteria | 8054503363 | 8054505231 | 214 |
| 124 | iso_pu_bacteria | 8055817908 | 8055819774 | 214 |
| 125 | iso_pu_bacteria | 8056131705 | 8056133558 | 214 |
| 126 | iso_pu_bacteria | 8056161164 | 8056164981 | 214 |
| 127 | 3300005330 | Ga0070690_100150586 | Ga0070690_1001505862 | 215 |
| 128 | 3300005331 | Ga0070670_100019616 | Ga0070670_1000196165 | 215 |
| 129 | 3300005334 | Ga0068869_100115454 | Ga0068869_1001154543 | 215 |
| 130 | 3300005335 | Ga0070666_10471987 | Ga0070666_104719872 | 215 |
| 131 | 3300005340 | Ga0070689_100424543 | Ga0070689_1004245432 | 215 |
| 132 | 3300005354 | Ga0070675_100000292 | Ga0070675_10000029210 | 215 |
| 133 | 3300005354 | Ga0070675_100022809 | Ga0070675_1000228092 | 215 |
| 134 | 3300005355 | Ga0070671_100010060 | Ga0070671_1000100602 | 215 |
| 135 | 3300005364 | Ga0070673_100001571 | Ga0070673_10000157110 | 215 |
| 136 | 3300005365 | Ga0070688_100007205 | Ga0070688_1000072056 | 215 |
| 137 | 3300005365 | Ga0070688_100010533 | Ga0070688_1000105335 | 215 |
| 138 | 3300005457 | Ga0070662_100079179 | Ga0070662_1000791793 | 215 |
| 139 | 3300005466 | Ga0070685_10018927 | Ga0070685_100189273 | 215 |
| 140 | 3300005543 | Ga0070672_100002632 | Ga0070672_1000026325 | 215 |
| 141 | 3300005548 | Ga0070665_100355473 | Ga0070665_1003554732 | 215 |
| 142 | 3300005564 | Ga0070664_100054591 | Ga0070664_1000545914 | 215 |
| 143 | 3300005617 | Ga0068859_100006693 | Ga0068859_1000066934 | 215 |
| 144 | 3300005617 | Ga0068859_100051096 | Ga0068859_1000510964 | 215 |
| 145 | 3300005843 | Ga0068860_100005405 | Ga0068860_1000054057 | 215 |
| 146 | 3300005844 | Ga0068862_100057164 | Ga0068862_1000571644 | 215 |
| 147 | 3300006237 | Ga0097621_100008706 | Ga0097621_1000087064 | 215 |
| 148 | 3300006358 | Ga0068871_100006865 | Ga0068871_1000068655 | 215 |
| 149 | 3300006931 | Ga0097620_100006693 | Ga0097620_1000066934 | 215 |
| 150 | 3300006931 | Ga0097620_100051097 | Ga0097620_1000510974 | 215 |
| 151 | 3300007788 | Ga0099795_10000002 | Ga0099795_1000000226 | 215 |
| 152 | 3300009094 | Ga0111539_10205844 | Ga0111539_102058443 | 215 |
| 153 | 3300009177 | Ga0105248_10000530 | Ga0105248_1000053024 | 215 |
| 154 | 3300010159 | Ga0099796_10000017 | Ga0099796_1000001724 | 215 |
| 155 | 3300013296 | Ga0157374_10323168 | Ga0157374_103231682 | 215 |
| 156 | 3300013306 | Ga0163162_10002174 | Ga0163162_1000217417 | 215 |
| 157 | 3300013308 | Ga0157375_10000876 | Ga0157375_100008761 | 215 |
| 158 | 3300014325 | Ga0163163_10014069 | Ga0163163_100140694 | 215 |
| 159 | 3300014968 | Ga0157379_10000084 | Ga0157379_1000008450 | 215 |
| 160 | 3300017792 | Ga0163161_10089807 | Ga0163161_100898073 | 215 |
| 161 | 3300025918 | Ga0207662_10230881 | Ga0207662_102308812 | 215 |
| 162 | 3300025926 | Ga0207659_10002211 | Ga0207659_100022118 | 215 |
| 163 | 3300025926 | Ga0207659_10003140 | Ga0207659_100031403 | 215 |
| 164 | 3300025926 | Ga0207659_10012864 | Ga0207659_100128647 | 215 |
| 165 | 3300025931 | Ga0207644_10239101 | Ga0207644_102391012 | 215 |
| 166 | 3300025940 | Ga0207691_10031440 | Ga0207691_100314402 | 215 |
| 167 | 3300025945 | Ga0207679_10011336 | Ga0207679_100113363 | 215 |
| 168 | 3300026035 | Ga0207703_10012102 | Ga0207703_100121025 | 215 |
| 169 | 3300027512 | Ga0209179_1000024 | Ga0209179_100002419 | 215 |
| 170 | 3300028381 | Ga0268264_10029942 | Ga0268264_100299423 | 215 |
| 171 | 3300031250 | Ga0265331_10102939 | Ga0265331_101029392 | 215 |
| 172 | 3300045049 | Ga0466959_0001261 | Ga0466959_0001261_5888_6541 | 215 |
| 173 | 3300047318 | Ga0495636_0105227 | Ga0495636_0105227_207_872 | 215 |
| 174 | 3300048921 | Ga0496118_0000183 | Ga0496118_0000183_22709_23362 | 215 |
| 175 | 3300049581 | Ga0501047_0155707 | Ga0501047_0155707_1125_1781 | 215 |
| 176 | 3300049589 | Ga0501073_0270312 | Ga0501073_0270312_227_943 | 215 |
| 177 | 3300049742 | Ga0501080_0007824 | Ga0501080_0007824_6647_7363 | 215 |
| 178 | 3300050491 | nmdc:mga00v17_180342_c1 | nmdc:mga00v17_180342_c1_315_965 | 215 |
| 179 | 3300053119 | Ga0500595_018129 | Ga0500595_018129_199_864 | 215 |
| 180 | 3300005289 | Ga0065704_10125447 | Ga0065704_101254472 | 216 |
| 181 | 3300006058 | Ga0075432_10091504 | Ga0075432_100915042 | 216 |
| 182 | 3300009011 | Ga0105251_10208169 | Ga0105251_102081692 | 216 |
| 183 | 3300009036 | Ga0105244_10018125 | Ga0105244_100181252 | 216 |
| 184 | 3300009036 | Ga0105244_10023700 | Ga0105244_100237002 | 216 |
| 185 | 3300009036 | Ga0105244_10074517 | Ga0105244_100745172 | 216 |
| 186 | 3300009092 | Ga0105250_10044287 | Ga0105250_100442872 | 216 |
| 187 | 3300009092 | Ga0105250_10161435 | Ga0105250_101614352 | 216 |
| 188 | 3300009148 | Ga0105243_10068799 | Ga0105243_100687992 | 216 |
| 189 | 3300013102 | Ga0157371_10081826 | Ga0157371_100818262 | 216 |
| 190 | 3300025292 | Ga0209676_1002024 | Ga0209676_100202411 | 216 |
| 191 | 3300025711 | Ga0207696_1000019 | Ga0207696_1000019120 | 216 |
| 192 | 3300025711 | Ga0207696_1008253 | Ga0207696_10082533 | 216 |
| 193 | 3300025728 | Ga0207655_1000614 | Ga0207655_100061411 | 216 |
| 194 | 3300025735 | Ga0207713_1009283 | Ga0207713_10092833 | 216 |
| 195 | 3300025735 | Ga0207713_1019125 | Ga0207713_10191252 | 216 |
| 196 | 3300025935 | Ga0207709_10051919 | Ga0207709_100519193 | 216 |
| 197 | 3300027296 | Ga0209389_1000037 | Ga0209389_100003722 | 216 |
| 198 | 3300031247 | Ga0265340_10190618 | Ga0265340_101906182 | 216 |
| 199 | 3300036401 | Ga0373937_0092457 | Ga0373937_0092457_2013_2678 | 216 |
| 200 | 3300036401 | Ga0373937_0529841 | Ga0373937_0529841_228_884 | 216 |
| 201 | 3300042013 | Ga0439456_002488 | Ga0439456_002488_1962_2612 | 216 |
| 202 | 3300042137 | Ga0450902_000311 | Ga0450902_000311_4740_5450 | 216 |
| 203 | 3300042137 | Ga0450902_017535 | Ga0450902_017535_304_954 | 216 |
| 204 | 3300042142 | Ga0450905_002952 | Ga0450905_002952_1010_1660 | 216 |
| 205 | 3300042439 | Ga0439464_0035796 | Ga0439464_0035796_587_1237 | 216 |
| 206 | 3300042533 | Ga0450901_000303 | Ga0450901_000303_869_1579 | 216 |
| 207 | 3300046515 | Ga0495620_0040801 | Ga0495620_0040801_1012_1662 | 216 |
| 208 | 3300046524 | Ga0495648_0066234 | Ga0495648_0066234_442_1095 | 216 |
| 209 | 3300048917 | Ga0496114_0065411 | Ga0496114_0065411_505_1155 | 216 |
| 210 | 3300048920 | Ga0496117_0001939 | Ga0496117_0001939_493_1233 | 216 |
| 211 | 3300048921 | Ga0496118_0006923 | Ga0496118_0006923_9892_10632 | 216 |
| 212 | 3300048921 | Ga0496118_0007851 | Ga0496118_0007851_10149_10799 | 216 |
| 213 | 3300048922 | Ga0496119_0000130 | Ga0496119_0000130_35158_35808 | 216 |
| 214 | 3300048923 | Ga0496120_0005328 | Ga0496120_0005328_7700_8350 | 216 |
| 215 | 3300048924 | Ga0496121_0055119 | Ga0496121_0055119_864_1514 | 216 |
| 216 | 3300048924 | Ga0496121_0108155 | Ga0496121_0108155_1006_1656 | 216 |
| 217 | 3300048925 | Ga0496122_0003935 | Ga0496122_0003935_8062_8712 | 216 |
| 218 | 3300048925 | Ga0496122_0089975 | Ga0496122_0089975_1053_1703 | 216 |
| 219 | 3300048926 | Ga0496123_0002092 | Ga0496123_0002092_17319_17969 | 216 |
| 220 | 3300048926 | Ga0496123_0058032 | Ga0496123_0058032_1039_1689 | 216 |
| 221 | 3300048927 | Ga0496124_0040787 | Ga0496124_0040787_1929_2579 | 216 |
| 222 | 3300048927 | Ga0496124_0073900 | Ga0496124_0073900_1542_2192 | 216 |
| 223 | 3300048927 | Ga0496124_0447722 | Ga0496124_0447722_30_818 | 216 |
| 224 | 3300048928 | Ga0496125_0008568 | Ga0496125_0008568_7481_8221 | 216 |
| 225 | 3300048928 | Ga0496125_0075077 | Ga0496125_0075077_909_1559 | 216 |
| 226 | 3300048929 | Ga0496126_0101104 | Ga0496126_0101104_138_878 | 216 |
| 227 | 3300048929 | Ga0496126_0185396 | Ga0496126_0185396_302_952 | 216 |
| 228 | 3300049571 | Ga0501034_0000325 | Ga0501034_0000325_6226_6876 | 216 |
| 229 | 3300049580 | Ga0501046_0148899 | Ga0501046_0148899_996_1646 | 216 |
| 230 | 3300049823 | Ga0501044_0640692 | Ga0501044_0640692_36_686 | 216 |
| 231 | 3300053135 | Ga0500659_0066937 | Ga0500659_0066937_914_1564 | 216 |
| 232 | 3300003323 | rootH1_10045656 | rootH1_100456562 | 217 |
| 233 | 3300005539 | Ga0068853_100079556 | Ga0068853_1000795562 | 217 |
| 234 | 3300006946 | Ga0079104_1004393 | Ga0079104_10043935 | 217 |
| 235 | 3300009011 | Ga0105251_10003076 | Ga0105251_1000307610 | 217 |
| 236 | 3300009092 | Ga0105250_10001554 | Ga0105250_1000155410 | 217 |
| 237 | 3300013102 | Ga0157371_10049940 | Ga0157371_100499402 | 217 |
| 238 | 3300013104 | Ga0157370_10230410 | Ga0157370_102304102 | 217 |
| 239 | 3300025711 | Ga0207696_1000191 | Ga0207696_100019114 | 217 |
| 240 | 3300025735 | Ga0207713_1000166 | Ga0207713_100016612 | 217 |
| 241 | 3300027111 | Ga0209281_1003625 | Ga0209281_10036252 | 217 |
| 242 | 3300030731 | Ga0316177_1063096 | Ga0316177_10630962 | 217 |
| 243 | 3300037418 | Ga0395900_0310412 | Ga0395900_0310412_64_720 | 217 |
| 244 | 3300038443 | Ga0395901_0231505 | Ga0395901_0231505_871_1527 | 217 |
| 245 | 3300041404 | Ga0439436_0041862 | Ga0439436_0041862_161_817 | 217 |
| 246 | 3300041486 | Ga0451807_0125265 | Ga0451807_0125265_152_808 | 217 |
| 247 | 3300041512 | Ga0451853_2200120 | Ga0451853_2200120_522_1178 | 217 |
| 248 | 3300042007 | Ga0439449_0050398 | Ga0439449_0050398_76_729 | 217 |
| 249 | 3300042876 | Ga0451577_0699290 | Ga0451577_0699290_130_789 | 217 |
| 250 | 3300046474 | Ga0495605_0045745 | Ga0495605_0045745_350_1003 | 217 |
| 251 | 3300046517 | Ga0495630_0046527 | Ga0495630_0046527_1624_2277 | 217 |
| 252 | 3300046536 | Ga0495587_0038456 | Ga0495587_0038456_1233_1886 | 217 |
| 253 | 3300046642 | Ga0495634_0033626 | Ga0495634_0033626_1886_2539 | 217 |
| 254 | 3300046663 | Ga0495635_0044746 | Ga0495635_0044746_1808_2461 | 217 |
| 255 | 3300046679 | Ga0495623_0111725 | Ga0495623_0111725_956_1609 | 217 |
| 256 | 3300047317 | Ga0495604_0073965 | Ga0495604_0073965_941_1594 | 217 |
| 257 | 3300047319 | Ga0495674_0139503 | Ga0495674_0139503_1366_2019 | 217 |
| 258 | 3300047322 | Ga0495680_0079386 | Ga0495680_0079386_1182_1835 | 217 |
| 259 | 3300047469 | Ga0495673_0018033 | Ga0495673_0018033_1986_2639 | 217 |
| 260 | 3300047673 | Ga0495593_0017139 | Ga0495593_0017139_1375_2028 | 217 |
| 261 | 3300048905 | Ga0496102_0051425 | Ga0496102_0051425_1290_1943 | 217 |
| 262 | 3300048906 | Ga0496103_0035071 | Ga0496103_0035071_1738_2391 | 217 |
| 263 | 3300048918 | Ga0496115_0084376 | Ga0496115_0084376_1731_2384 | 217 |
| 264 | 3300048919 | Ga0496116_0069835 | Ga0496116_0069835_1019_1672 | 217 |
| 265 | 3300048921 | Ga0496118_0061865 | Ga0496118_0061865_716_1369 | 217 |
| 266 | 3300048924 | Ga0496121_0082346 | Ga0496121_0082346_1817_2470 | 217 |
| 267 | 3300048927 | Ga0496124_0000004 | Ga0496124_0000004_178031_178690 | 217 |
| 268 | 3300049568 | Ga0501031_0003171 | Ga0501031_0003171_6199_6855 | 217 |
| 269 | 3300049570 | Ga0501033_0001210 | Ga0501033_0001210_21385_22038 | 217 |
| 270 | 3300049570 | Ga0501033_0004171 | Ga0501033_0004171_9934_10590 | 217 |
| 271 | 3300049570 | Ga0501033_0381657 | Ga0501033_0381657_253_909 | 217 |
| 272 | 3300049571 | Ga0501034_0031276 | Ga0501034_0031276_1044_1700 | 217 |
| 273 | 3300049571 | Ga0501034_0777371 | Ga0501034_0777371_161_814 | 217 |
| 274 | 3300049573 | Ga0501037_0030003 | Ga0501037_0030003_1139_1795 | 217 |
| 275 | 3300049574 | Ga0501038_0063225 | Ga0501038_0063225_1408_2064 | 217 |
| 276 | 3300049579 | Ga0501043_0055597 | Ga0501043_0055597_1297_1953 | 217 |
| 277 | 3300049580 | Ga0501046_0040047 | Ga0501046_0040047_1409_2065 | 217 |
| 278 | 3300049581 | Ga0501047_0088139 | Ga0501047_0088139_1281_1937 | 217 |
| 279 | 3300049822 | Ga0501035_0412737 | Ga0501035_0412737_231_893 | 217 |
| 280 | 3300049823 | Ga0501044_0090225 | Ga0501044_0090225_1029_1685 | 217 |
| 281 | 3300050496 | nmdc:mga07m45_71143_c1 | nmdc:mga07m45_71143_c1_462_1121 | 217 |
| 282 | 3300002737 | JGI25162J39368_1006336 | JGI25162J39368_10063362 | 218 |
| 283 | 3300002772 | JGI25164J39214_1000421 | JGI25164J39214_10004214 | 218 |
| 284 | 3300003214 | JGI25165J46597_1015099 | JGI25165J46597_10150992 | 218 |
| 285 | 3300003320 | rootH2_10073649 | rootH2_100736492 | 218 |
| 286 | 3300003751 | Ga0055538_1000141 | Ga0055538_100014137 | 218 |
| 287 | 3300003752 | Ga0055539_1000134 | Ga0055539_100013441 | 218 |
| 288 | 3300003752 | Ga0055539_1000192 | Ga0055539_100019237 | 218 |
| 289 | 3300003756 | Ga0055533_1000138 | Ga0055533_100013841 | 218 |
| 290 | 3300003756 | Ga0055533_1000192 | Ga0055533_100019237 | 218 |
| 291 | 3300003758 | Ga0055532_1000142 | Ga0055532_100014241 | 218 |
| 292 | 3300003759 | Ga0055525_1000183 | Ga0055525_100018341 | 218 |
| 293 | 3300003759 | Ga0055525_1000260 | Ga0055525_100026013 | 218 |
| 294 | 3300003761 | Ga0055535_1009015 | Ga0055535_10090152 | 218 |
| 295 | 3300003763 | Ga0055529_1001465 | Ga0055529_10014654 | 218 |
| 296 | 3300003781 | Ga0055536_1006580 | Ga0055536_10065803 | 218 |
| 297 | 3300003794 | Ga0055531_10013344 | Ga0055531_100133442 | 218 |
| 298 | 3300003841 | Ga0055541_1000089 | Ga0055541_100008941 | 218 |
| 299 | 3300003841 | Ga0055541_1000127 | Ga0055541_100012737 | 218 |
| 300 | 3300005288 | Ga0065714_10004793 | Ga0065714_100047932 | 218 |
| 301 | 3300005288 | Ga0065714_10010006 | Ga0065714_100100062 | 218 |
| 302 | 3300005289 | Ga0065704_10117506 | Ga0065704_101175061 | 218 |
| 303 | 3300005289 | Ga0065704_10297990 | Ga0065704_102979901 | 218 |
| 304 | 3300005293 | Ga0065715_10191057 | Ga0065715_101910572 | 218 |
| 305 | 3300005327 | Ga0070658_10106431 | Ga0070658_101064312 | 218 |
| 306 | 3300005327 | Ga0070658_11123616 | Ga0070658_111236161 | 218 |
| 307 | 3300005331 | Ga0070670_100063254 | Ga0070670_1000632543 | 218 |
| 308 | 3300005331 | Ga0070670_100080503 | Ga0070670_1000805033 | 218 |
| 309 | 3300005336 | Ga0070680_100213575 | Ga0070680_1002135752 | 218 |
| 310 | 3300005336 | Ga0070680_100290896 | Ga0070680_1002908962 | 218 |
| 311 | 3300005339 | Ga0070660_100062431 | Ga0070660_1000624312 | 218 |
| 312 | 3300005339 | Ga0070660_100078446 | Ga0070660_1000784461 | 218 |
| 313 | 3300005339 | Ga0070660_100160873 | Ga0070660_1001608732 | 218 |
| 314 | 3300005341 | Ga0070691_10038752 | Ga0070691_100387522 | 218 |
| 315 | 3300005344 | Ga0070661_100000029 | Ga0070661_1000000293 | 218 |
| 316 | 3300005353 | Ga0070669_100000316 | Ga0070669_10000031635 | 218 |
| 317 | 3300005353 | Ga0070669_100284249 | Ga0070669_1002842491 | 218 |
| 318 | 3300005355 | Ga0070671_100193137 | Ga0070671_1001931372 | 218 |
| 319 | 3300005356 | Ga0070674_100243978 | Ga0070674_1002439782 | 218 |
| 320 | 3300005364 | Ga0070673_100198282 | Ga0070673_1001982822 | 218 |
| 321 | 3300005366 | Ga0070659_100021330 | Ga0070659_1000213303 | 218 |
| 322 | 3300005366 | Ga0070659_100058659 | Ga0070659_1000586592 | 218 |
| 323 | 3300005366 | Ga0070659_100102032 | Ga0070659_1001020322 | 218 |
| 324 | 3300005366 | Ga0070659_100991625 | Ga0070659_1009916251 | 218 |
| 325 | 3300005434 | Ga0070709_10737823 | Ga0070709_107378231 | 218 |
| 326 | 3300005435 | Ga0070714_100000439 | Ga0070714_1000004393 | 218 |
| 327 | 3300005437 | Ga0070710_10174017 | Ga0070710_101740172 | 218 |
| 328 | 3300005444 | Ga0070694_100130410 | Ga0070694_1001304103 | 218 |
| 329 | 3300005455 | Ga0070663_100504945 | Ga0070663_1005049451 | 218 |
| 330 | 3300005457 | Ga0070662_100001079 | Ga0070662_10000107914 | 218 |
| 331 | 3300005458 | Ga0070681_10000122 | Ga0070681_1000012248 | 218 |
| 332 | 3300005458 | Ga0070681_10150461 | Ga0070681_101504612 | 218 |
| 333 | 3300005458 | Ga0070681_10181002 | Ga0070681_101810023 | 218 |
| 334 | 3300005459 | Ga0068867_100056297 | Ga0068867_1000562972 | 218 |
| 335 | 3300005530 | Ga0070679_100046779 | Ga0070679_1000467795 | 218 |
| 336 | 3300005530 | Ga0070679_100125107 | Ga0070679_1001251073 | 218 |
| 337 | 3300005530 | Ga0070679_100203184 | Ga0070679_1002031842 | 218 |
| 338 | 3300005530 | Ga0070679_100500581 | Ga0070679_1005005812 | 218 |
| 339 | 3300005539 | Ga0068853_100033679 | Ga0068853_1000336792 | 218 |
| 340 | 3300005539 | Ga0068853_100034758 | Ga0068853_1000347583 | 218 |
| 341 | 3300005543 | Ga0070672_100005875 | Ga0070672_1000058756 | 218 |
| 342 | 3300005543 | Ga0070672_100029504 | Ga0070672_1000295042 | 218 |
| 343 | 3300005546 | Ga0070696_100015274 | Ga0070696_1000152742 | 218 |
| 344 | 3300005547 | Ga0070693_100041808 | Ga0070693_1000418084 | 218 |
| 345 | 3300005563 | Ga0068855_100000651 | Ga0068855_10000065130 | 218 |
| 346 | 3300005563 | Ga0068855_100036971 | Ga0068855_1000369717 | 218 |
| 347 | 3300005563 | Ga0068855_100076888 | Ga0068855_1000768882 | 218 |
| 348 | 3300005563 | Ga0068855_100127016 | Ga0068855_1001270163 | 218 |
| 349 | 3300005577 | Ga0068857_100102455 | Ga0068857_1001024552 | 218 |
| 350 | 3300005578 | Ga0068854_100021927 | Ga0068854_1000219273 | 218 |
| 351 | 3300005578 | Ga0068854_100244340 | Ga0068854_1002443402 | 218 |
| 352 | 3300005834 | Ga0068851_10000050 | Ga0068851_1000005017 | 218 |
| 353 | 3300006051 | Ga0075364_10001303 | Ga0075364_100013036 | 218 |
| 354 | 3300006051 | Ga0075364_10126192 | Ga0075364_101261922 | 218 |
| 355 | 3300009011 | Ga0105251_10003160 | Ga0105251_1000316012 | 218 |
| 356 | 3300009011 | Ga0105251_10011010 | Ga0105251_100110103 | 218 |
| 357 | 3300009011 | Ga0105251_10011378 | Ga0105251_100113783 | 218 |
| 358 | 3300009011 | Ga0105251_10016935 | Ga0105251_100169353 | 218 |
| 359 | 3300009011 | Ga0105251_10019280 | Ga0105251_100192802 | 218 |
| 360 | 3300009011 | Ga0105251_10055081 | Ga0105251_100550812 | 218 |
| 361 | 3300009036 | Ga0105244_10027086 | Ga0105244_100270863 | 218 |
| 362 | 3300009092 | Ga0105250_10000319 | Ga0105250_100003194 | 218 |
| 363 | 3300009093 | Ga0105240_10037357 | Ga0105240_100373573 | 218 |
| 364 | 3300009176 | Ga0105242_10289139 | Ga0105242_102891392 | 218 |
| 365 | 3300009177 | Ga0105248_10110797 | Ga0105248_101107973 | 218 |
| 366 | 3300009545 | Ga0105237_10004758 | Ga0105237_1000475811 | 218 |
| 367 | 3300009551 | Ga0105238_10000006 | Ga0105238_10000006257 | 218 |
| 368 | 3300009551 | Ga0105238_10108385 | Ga0105238_101083852 | 218 |
| 369 | 3300009551 | Ga0105238_10177113 | Ga0105238_101771132 | 218 |
| 370 | 3300010375 | Ga0105239_10037141 | Ga0105239_100371413 | 218 |
| 371 | 3300012488 | Ga0157343_1001722 | Ga0157343_10017221 | 218 |
| 372 | 3300013100 | Ga0157373_10007084 | Ga0157373_100070846 | 218 |
| 373 | 3300013100 | Ga0157373_10051241 | Ga0157373_100512412 | 218 |
| 374 | 3300013100 | Ga0157373_10062624 | Ga0157373_100626243 | 218 |
| 375 | 3300013100 | Ga0157373_10147481 | Ga0157373_101474812 | 218 |
| 376 | 3300013100 | Ga0157373_10154374 | Ga0157373_101543742 | 218 |
| 377 | 3300013100 | Ga0157373_10345309 | Ga0157373_103453091 | 218 |
| 378 | 3300013102 | Ga0157371_10001274 | Ga0157371_1000127423 | 218 |
| 379 | 3300013102 | Ga0157371_10045728 | Ga0157371_100457282 | 218 |
| 380 | 3300013104 | Ga0157370_10021678 | Ga0157370_100216785 | 218 |
| 381 | 3300013104 | Ga0157370_10172186 | Ga0157370_101721862 | 218 |
| 382 | 3300013104 | Ga0157370_10271459 | Ga0157370_102714592 | 218 |
| 383 | 3300013105 | Ga0157369_10009316 | Ga0157369_1000931610 | 218 |
| 384 | 3300013105 | Ga0157369_10070491 | Ga0157369_100704914 | 218 |
| 385 | 3300013105 | Ga0157369_10094848 | Ga0157369_100948482 | 218 |
| 386 | 3300013105 | Ga0157369_10180466 | Ga0157369_101804663 | 218 |
| 387 | 3300013296 | Ga0157374_10068556 | Ga0157374_100685561 | 218 |
| 388 | 3300013306 | Ga0163162_10084203 | Ga0163162_100842032 | 218 |
| 389 | 3300013307 | Ga0157372_10035376 | Ga0157372_100353766 | 218 |
| 390 | 3300013307 | Ga0157372_10254085 | Ga0157372_102540852 | 218 |
| 391 | 3300013307 | Ga0157372_10477907 | Ga0157372_104779072 | 218 |
| 392 | 3300013307 | Ga0157372_10719518 | Ga0157372_107195181 | 218 |
| 393 | 3300013308 | Ga0157375_10013741 | Ga0157375_100137414 | 218 |
| 394 | 3300013308 | Ga0157375_10318207 | Ga0157375_103182072 | 218 |
| 395 | 3300013308 | Ga0157375_10348151 | Ga0157375_103481512 | 218 |
| 396 | 3300014497 | Ga0182008_10020662 | Ga0182008_100206623 | 218 |
| 397 | 3300014497 | Ga0182008_10026957 | Ga0182008_100269571 | 218 |
| 398 | 3300014497 | Ga0182008_10032622 | Ga0182008_100326222 | 218 |
| 399 | 3300014497 | Ga0182008_10033434 | Ga0182008_100334343 | 218 |
| 400 | 3300014969 | Ga0157376_10026920 | Ga0157376_100269205 | 218 |
| 401 | 3300015261 | Ga0182006_1001091 | Ga0182006_100109117 | 218 |
| 402 | 3300015262 | Ga0182007_10024101 | Ga0182007_100241012 | 218 |
| 403 | 3300015262 | Ga0182007_10028919 | Ga0182007_100289192 | 218 |
| 404 | 3300015262 | Ga0182007_10066083 | Ga0182007_100660832 | 218 |
| 405 | 3300015685 | Ga0183369_1003 | Ga0183369_100353 | 218 |
| 406 | 3300017792 | Ga0163161_10073587 | Ga0163161_100735872 | 218 |
| 407 | 3300017792 | Ga0163161_10139001 | Ga0163161_101390012 | 218 |
| 408 | 3300020081 | Ga0206354_10029098 | Ga0206354_100290981 | 218 |
| 409 | 3300021361 | Ga0213872_10002881 | Ga0213872_100028813 | 218 |
| 410 | 3300025224 | Ga0209784_100009 | Ga0209784_100009551 | 218 |
| 411 | 3300025224 | Ga0209784_100040 | Ga0209784_100040188 | 218 |
| 412 | 3300025225 | Ga0209566_100007 | Ga0209566_100007551 | 218 |
| 413 | 3300025225 | Ga0209566_100051 | Ga0209566_100051188 | 218 |
| 414 | 3300025226 | Ga0209674_100018 | Ga0209674_100018551 | 218 |
| 415 | 3300025226 | Ga0209674_100072 | Ga0209674_100072188 | 218 |
| 416 | 3300025229 | Ga0209147_100067 | Ga0209147_100067188 | 218 |
| 417 | 3300025230 | Ga0209563_100020 | Ga0209563_100020551 | 218 |
| 418 | 3300025230 | Ga0209563_100073 | Ga0209563_100073188 | 218 |
| 419 | 3300025231 | Ga0207427_100049 | Ga0207427_100049197 | 218 |
| 420 | 3300025233 | Ga0209437_100083 | Ga0209437_10008344 | 218 |
| 421 | 3300025242 | Ga0209258_100585 | Ga0209258_1005853 | 218 |
| 422 | 3300025246 | Ga0209646_1000575 | Ga0209646_100057512 | 218 |
| 423 | 3300025253 | Ga0209677_100010 | Ga0209677_100010551 | 218 |
| 424 | 3300025253 | Ga0209677_100121 | Ga0209677_10012141 | 218 |
| 425 | 3300025261 | Ga0209233_1000075 | Ga0209233_1000075279 | 218 |
| 426 | 3300025291 | Ga0209675_1008687 | Ga0209675_10086872 | 218 |
| 427 | 3300025292 | Ga0209676_1000891 | Ga0209676_100089124 | 218 |
| 428 | 3300025294 | Ga0209025_1016319 | Ga0209025_10163193 | 218 |
| 429 | 3300025294 | Ga0209025_1133987 | Ga0209025_11339871 | 218 |
| 430 | 3300025298 | Ga0209050_1022212 | Ga0209050_10222122 | 218 |
| 431 | 3300025304 | Ga0209257_1000180 | Ga0209257_10001809 | 218 |
| 432 | 3300025321 | Ga0207656_10000235 | Ga0207656_100002353 | 218 |
| 433 | 3300025711 | Ga0207696_1000171 | Ga0207696_100017166 | 218 |
| 434 | 3300025728 | Ga0207655_1000035 | Ga0207655_100003540 | 218 |
| 435 | 3300025735 | Ga0207713_1000173 | Ga0207713_100017310 | 218 |
| 436 | 3300025735 | Ga0207713_1002517 | Ga0207713_100251710 | 218 |
| 437 | 3300025735 | Ga0207713_1007526 | Ga0207713_10075263 | 218 |
| 438 | 3300025735 | Ga0207713_1009510 | Ga0207713_10095103 | 218 |
| 439 | 3300025735 | Ga0207713_1021048 | Ga0207713_10210483 | 218 |
| 440 | 3300025735 | Ga0207713_1043939 | Ga0207713_10439392 | 218 |
| 441 | 3300025898 | Ga0207692_10141484 | Ga0207692_101414842 | 218 |
| 442 | 3300025909 | Ga0207705_10123947 | Ga0207705_101239471 | 218 |
| 443 | 3300025909 | Ga0207705_10128389 | Ga0207705_101283892 | 218 |
| 444 | 3300025912 | Ga0207707_10000310 | Ga0207707_1000031043 | 218 |
| 445 | 3300025912 | Ga0207707_10033751 | Ga0207707_100337514 | 218 |
| 446 | 3300025912 | Ga0207707_10235982 | Ga0207707_102359822 | 218 |
| 447 | 3300025912 | Ga0207707_10597336 | Ga0207707_105973362 | 218 |
| 448 | 3300025913 | Ga0207695_10003954 | Ga0207695_1000395415 | 218 |
| 449 | 3300025914 | Ga0207671_10002838 | Ga0207671_100028383 | 218 |
| 450 | 3300025917 | Ga0207660_10113778 | Ga0207660_101137782 | 218 |
| 451 | 3300025917 | Ga0207660_10312036 | Ga0207660_103120362 | 218 |
| 452 | 3300025919 | Ga0207657_10024061 | Ga0207657_100240615 | 218 |
| 453 | 3300025919 | Ga0207657_10029629 | Ga0207657_100296294 | 218 |
| 454 | 3300025919 | Ga0207657_10051681 | Ga0207657_100516814 | 218 |
| 455 | 3300025921 | Ga0207652_10017245 | Ga0207652_100172456 | 218 |
| 456 | 3300025921 | Ga0207652_10407264 | Ga0207652_104072641 | 218 |
| 457 | 3300025923 | Ga0207681_10000491 | Ga0207681_100004915 | 218 |
| 458 | 3300025924 | Ga0207694_10000110 | Ga0207694_1000011028 | 218 |
| 459 | 3300025924 | Ga0207694_10196036 | Ga0207694_101960362 | 218 |
| 460 | 3300025925 | Ga0207650_10000174 | Ga0207650_1000017461 | 218 |
| 461 | 3300025925 | Ga0207650_10033727 | Ga0207650_100337273 | 218 |
| 462 | 3300025926 | Ga0207659_10309181 | Ga0207659_103091812 | 218 |
| 463 | 3300025929 | Ga0207664_10003938 | Ga0207664_100039384 | 218 |
| 464 | 3300025932 | Ga0207690_10002939 | Ga0207690_100029394 | 218 |
| 465 | 3300025932 | Ga0207690_10024721 | Ga0207690_100247214 | 218 |
| 466 | 3300025933 | Ga0207706_10002445 | Ga0207706_100024452 | 218 |
| 467 | 3300025937 | Ga0207669_10183917 | Ga0207669_101839172 | 218 |
| 468 | 3300025940 | Ga0207691_10017313 | Ga0207691_100173135 | 218 |
| 469 | 3300025940 | Ga0207691_10031677 | Ga0207691_100316773 | 218 |
| 470 | 3300025941 | Ga0207711_10151337 | Ga0207711_101513372 | 218 |
| 471 | 3300025945 | Ga0207679_10149977 | Ga0207679_101499772 | 218 |
| 472 | 3300025949 | Ga0207667_10000120 | Ga0207667_1000012012 | 218 |
| 473 | 3300025949 | Ga0207667_10049964 | Ga0207667_100499645 | 218 |
| 474 | 3300025949 | Ga0207667_10114060 | Ga0207667_101140603 | 218 |
| 475 | 3300025972 | Ga0207668_10085836 | Ga0207668_100858362 | 218 |
| 476 | 3300026041 | Ga0207639_10003873 | Ga0207639_100038739 | 218 |
| 477 | 3300026041 | Ga0207639_10012151 | Ga0207639_100121513 | 218 |
| 478 | 3300026067 | Ga0207678_10578362 | Ga0207678_105783621 | 218 |
| 479 | 3300026089 | Ga0207648_10038161 | Ga0207648_100381612 | 218 |
| 480 | 3300026095 | Ga0207676_10234177 | Ga0207676_102341771 | 218 |
| 481 | 3300026116 | Ga0207674_10031883 | Ga0207674_100318833 | 218 |
| 482 | 3300026116 | Ga0207674_10063737 | Ga0207674_100637376 | 218 |
| 483 | 3300026142 | Ga0207698_10349682 | Ga0207698_103496821 | 218 |
| 484 | 3300027424 | Ga0209984_1006779 | Ga0209984_10067792 | 218 |
| 485 | 3300027552 | Ga0209982_1001893 | Ga0209982_10018932 | 218 |
| 486 | 3300027665 | Ga0209983_1001409 | Ga0209983_10014096 | 218 |
| 487 | 3300027665 | Ga0209983_1017829 | Ga0209983_10178292 | 218 |
| 488 | 3300027682 | Ga0209971_1000854 | Ga0209971_10008546 | 218 |
| 489 | 3300027876 | Ga0209974_10003051 | Ga0209974_100030513 | 218 |
| 490 | 3300027876 | Ga0209974_10092894 | Ga0209974_100928942 | 218 |
| 491 | 3300028379 | Ga0268266_10353131 | Ga0268266_103531312 | 218 |
| 492 | 3300028794 | Ga0307515_10211654 | Ga0307515_102116541 | 218 |
| 493 | 3300030745 | Ga0316182_1080836 | Ga0316182_10808362 | 218 |
| 494 | 3300031239 | Ga0265328_10005946 | Ga0265328_100059465 | 218 |
| 495 | 3300031250 | Ga0265331_10000138 | Ga0265331_1000013816 | 218 |
| 496 | 3300031250 | Ga0265331_10028049 | Ga0265331_100280492 | 218 |
| 497 | 3300031251 | Ga0265327_10000299 | Ga0265327_1000029978 | 218 |
| 498 | 3300031251 | Ga0265327_10011689 | Ga0265327_100116896 | 218 |
| 499 | 3300031456 | Ga0307513_10011784 | Ga0307513_100117842 | 218 |
| 500 | 3300031456 | Ga0307513_10130008 | Ga0307513_101300082 | 218 |
| 501 | 3300031548 | Ga0307408_100519480 | Ga0307408_1005194802 | 218 |
| 502 | 3300031665 | Ga0316575_10002178 | Ga0316575_100021784 | 218 |
| 503 | 3300031665 | Ga0316575_10053165 | Ga0316575_100531652 | 218 |
| 504 | 3300031665 | Ga0316575_10115968 | Ga0316575_101159682 | 218 |
| 505 | 3300031665 | Ga0316575_10217424 | Ga0316575_102174241 | 218 |
| 506 | 3300031691 | Ga0316579_10006228 | Ga0316579_100062283 | 218 |
| 507 | 3300031691 | Ga0316579_10080796 | Ga0316579_100807962 | 218 |
| 508 | 3300031691 | Ga0316579_10101258 | Ga0316579_101012582 | 218 |
| 509 | 3300031691 | Ga0316579_10113393 | Ga0316579_101133932 | 218 |
| 510 | 3300031691 | Ga0316579_10162846 | Ga0316579_101628461 | 218 |
| 511 | 3300031691 | Ga0316579_10268748 | Ga0316579_102687481 | 218 |
| 512 | 3300031691 | Ga0316579_10284286 | Ga0316579_102842861 | 218 |
| 513 | 3300031727 | Ga0316576_10002007 | Ga0316576_100020077 | 218 |
| 514 | 3300031727 | Ga0316576_10033272 | Ga0316576_100332723 | 218 |
| 515 | 3300031727 | Ga0316576_10054937 | Ga0316576_100549372 | 218 |
| 516 | 3300031727 | Ga0316576_10055448 | Ga0316576_100554483 | 218 |
| 517 | 3300031727 | Ga0316576_10057837 | Ga0316576_100578373 | 218 |
| 518 | 3300031727 | Ga0316576_10109338 | Ga0316576_101093382 | 218 |
| 519 | 3300031727 | Ga0316576_10133579 | Ga0316576_101335792 | 218 |
| 520 | 3300031727 | Ga0316576_10183899 | Ga0316576_101838992 | 218 |
| 521 | 3300031728 | Ga0316578_10000355 | Ga0316578_1000035514 | 218 |
| 522 | 3300031728 | Ga0316578_10000750 | Ga0316578_100007509 | 218 |
| 523 | 3300031728 | Ga0316578_10003780 | Ga0316578_100037806 | 218 |
| 524 | 3300031728 | Ga0316578_10034817 | Ga0316578_100348172 | 218 |
| 525 | 3300031728 | Ga0316578_10035569 | Ga0316578_100355691 | 218 |
| 526 | 3300031728 | Ga0316578_10053223 | Ga0316578_100532234 | 218 |
| 527 | 3300031728 | Ga0316578_10067463 | Ga0316578_100674632 | 218 |
| 528 | 3300031728 | Ga0316578_10100615 | Ga0316578_101006153 | 218 |
| 529 | 3300031731 | Ga0307405_10056530 | Ga0307405_100565303 | 218 |
| 530 | 3300031731 | Ga0307405_10283396 | Ga0307405_102833961 | 218 |
| 531 | 3300031733 | Ga0316577_10019867 | Ga0316577_100198672 | 218 |
| 532 | 3300031733 | Ga0316577_10046641 | Ga0316577_100466411 | 218 |
| 533 | 3300031733 | Ga0316577_10062082 | Ga0316577_100620822 | 218 |
| 534 | 3300031733 | Ga0316577_10116922 | Ga0316577_101169223 | 218 |
| 535 | 3300031824 | Ga0307413_10000289 | Ga0307413_100002895 | 218 |
| 536 | 3300031824 | Ga0307413_10442498 | Ga0307413_104424982 | 218 |
| 537 | 3300031911 | Ga0307412_10245541 | Ga0307412_102455411 | 218 |
| 538 | 3300031911 | Ga0307412_10270504 | Ga0307412_102705042 | 218 |
| 539 | 3300031995 | Ga0307409_100946664 | Ga0307409_1009466642 | 218 |
| 540 | 3300032004 | Ga0307414_10003488 | Ga0307414_100034882 | 218 |
| 541 | 3300032004 | Ga0307414_10020803 | Ga0307414_100208035 | 218 |
| 542 | 3300032004 | Ga0307414_10234978 | Ga0307414_102349782 | 218 |
| 543 | 3300032004 | Ga0307414_10442546 | Ga0307414_104425462 | 218 |
| 544 | 3300032004 | Ga0307414_10784114 | Ga0307414_107841141 | 218 |
| 545 | 3300032004 | Ga0307414_11021017 | Ga0307414_110210171 | 218 |
| 546 | 3300032005 | Ga0307411_10793140 | Ga0307411_107931401 | 218 |
| 547 | 3300032126 | Ga0307415_100530263 | Ga0307415_1005302632 | 218 |
| 548 | 3300032133 | Ga0316583_10005875 | Ga0316583_100058754 | 218 |
| 549 | 3300032133 | Ga0316583_10023784 | Ga0316583_100237842 | 218 |
| 550 | 3300032133 | Ga0316583_10066017 | Ga0316583_100660172 | 218 |
| 551 | 3300032133 | Ga0316583_10132983 | Ga0316583_101329832 | 218 |
| 552 | 3300032133 | Ga0316583_10145219 | Ga0316583_101452191 | 218 |
| 553 | 3300032137 | Ga0316585_10012810 | Ga0316585_100128101 | 218 |
| 554 | 3300032137 | Ga0316585_10016266 | Ga0316585_100162662 | 218 |
| 555 | 3300032137 | Ga0316585_10053025 | Ga0316585_100530252 | 218 |
| 556 | 3300032137 | Ga0316585_10096263 | Ga0316585_100962632 | 218 |
| 557 | 3300032139 | Ga0316580_10002337 | Ga0316580_100023371 | 218 |
| 558 | 3300032139 | Ga0316580_10016466 | Ga0316580_100164663 | 218 |
| 559 | 3300032139 | Ga0316580_10017836 | Ga0316580_100178362 | 218 |
| 560 | 3300032139 | Ga0316580_10122293 | Ga0316580_101222931 | 218 |
| 561 | 3300032168 | Ga0316593_10000460 | Ga0316593_100004602 | 218 |
| 562 | 3300032168 | Ga0316593_10016799 | Ga0316593_100167993 | 218 |
| 563 | 3300032168 | Ga0316593_10019164 | Ga0316593_100191641 | 218 |
| 564 | 3300032168 | Ga0316593_10021839 | Ga0316593_100218392 | 218 |
| 565 | 3300033524 | Ga0316592_1003346 | Ga0316592_10033463 | 218 |
| 566 | 3300033541 | Ga0316596_1004284 | Ga0316596_10042843 | 218 |
| 567 | 3300033541 | Ga0316596_1013151 | Ga0316596_10131512 | 218 |
| 568 | 3300035398 | Ga0316574_0004485 | Ga0316574_0004485_5427_6146 | 218 |
| 569 | 3300035398 | Ga0316574_0020422 | Ga0316574_0020422_2352_3008 | 218 |
| 570 | 3300035398 | Ga0316574_0041419 | Ga0316574_0041419_1097_1762 | 218 |
| 571 | 3300035398 | Ga0316574_0055978 | Ga0316574_0055978_799_1470 | 218 |
| 572 | 3300035398 | Ga0316574_0130892 | Ga0316574_0130892_921_1589 | 218 |
| 573 | 3300035398 | Ga0316574_0136143 | Ga0316574_0136143_175_831 | 218 |
| 574 | 3300035398 | Ga0316574_0160823 | Ga0316574_0160823_468_1223 | 218 |
| 575 | 3300035398 | Ga0316574_0230902 | Ga0316574_0230902_189_848 | 218 |
| 576 | 3300036647 | Ga0316582_0004837 | Ga0316582_0004837_262_918 | 218 |
| 577 | 3300036647 | Ga0316582_0007864 | Ga0316582_0007864_1727_2482 | 218 |
| 578 | 3300036647 | Ga0316582_0017707 | Ga0316582_0017707_192_848 | 218 |
| 579 | 3300036647 | Ga0316582_0025344 | Ga0316582_0025344_1297_1956 | 218 |
| 580 | 3300036647 | Ga0316582_0028543 | Ga0316582_0028543_2099_2818 | 218 |
| 581 | 3300036647 | Ga0316582_0049248 | Ga0316582_0049248_1772_2443 | 218 |
| 582 | 3300036647 | Ga0316582_0084178 | Ga0316582_0084178_316_972 | 218 |
| 583 | 3300036647 | Ga0316582_0404374 | Ga0316582_0404374_79_741 | 218 |
| 584 | 3300036712 | Ga0316584_0003319 | Ga0316584_0003319_4556_5284 | 218 |
| 585 | 3300036712 | Ga0316584_0004559 | Ga0316584_0004559_4778_5449 | 218 |
| 586 | 3300036712 | Ga0316584_0008175 | Ga0316584_0008175_5765_6421 | 218 |
| 587 | 3300036712 | Ga0316584_0010547 | Ga0316584_0010547_1238_1894 | 218 |
| 588 | 3300036712 | Ga0316584_0010728 | Ga0316584_0010728_4739_5410 | 218 |
| 589 | 3300036712 | Ga0316584_0078102 | Ga0316584_0078102_842_1498 | 218 |
| 590 | 3300036712 | Ga0316584_0133226 | Ga0316584_0133226_913_1632 | 218 |
| 591 | 3300036712 | Ga0316584_0155307 | Ga0316584_0155307_406_1062 | 218 |
| 592 | 3300036712 | Ga0316584_0217487 | Ga0316584_0217487_668_1324 | 218 |
| 593 | 3300036712 | Ga0316584_0223445 | Ga0316584_0223445_431_1096 | 218 |
| 594 | 3300036712 | Ga0316584_0311626 | Ga0316584_0311626_27_782 | 218 |
| 595 | 3300036712 | Ga0316584_0644380 | Ga0316584_0644380_59_715 | 218 |
| 596 | 3300037312 | Ga0395899_0008193 | Ga0395899_0008193_634_1293 | 218 |
| 597 | 3300037312 | Ga0395899_0088087 | Ga0395899_0088087_842_1501 | 218 |
| 598 | 3300037312 | Ga0395899_0123826 | Ga0395899_0123826_1122_1778 | 218 |
| 599 | 3300037418 | Ga0395900_0000396 | Ga0395900_0000396_61953_62615 | 218 |
| 600 | 3300037418 | Ga0395900_0009362 | Ga0395900_0009362_8988_9647 | 218 |
| 601 | 3300037418 | Ga0395900_0017708 | Ga0395900_0017708_1514_2173 | 218 |
| 602 | 3300037418 | Ga0395900_0060291 | Ga0395900_0060291_2170_2826 | 218 |
| 603 | 3300037418 | Ga0395900_0529338 | Ga0395900_0529338_51_710 | 218 |
| 604 | 3300037466 | Ga0395898_0007612 | Ga0395898_0007612_2346_3005 | 218 |
| 605 | 3300037466 | Ga0395898_0066793 | Ga0395898_0066793_563_1222 | 218 |
| 606 | 3300037466 | Ga0395898_0173676 | Ga0395898_0173676_948_1604 | 218 |
| 607 | 3300037471 | Ga0395905_0104207 | Ga0395905_0104207_189_845 | 218 |
| 608 | 3300038443 | Ga0395901_0084987 | Ga0395901_0084987_2408_3067 | 218 |
| 609 | 3300038443 | Ga0395901_0108002 | Ga0395901_0108002_1715_2374 | 218 |
| 610 | 3300038443 | Ga0395901_0186164 | Ga0395901_0186164_1263_1922 | 218 |
| 611 | 3300038443 | Ga0395901_0432806 | Ga0395901_0432806_109_765 | 218 |
| 612 | 3300039447 | Ga0436361_0054021 | Ga0436361_0054021_6647_7306 | 218 |
| 613 | 3300041404 | Ga0439436_0021020 | Ga0439436_0021020_1227_1886 | 218 |
| 614 | 3300041404 | Ga0439436_0028016 | Ga0439436_0028016_155_841 | 218 |
| 615 | 3300041413 | Ga0439465_0019807 | Ga0439465_0019807_1109_1768 | 218 |
| 616 | 3300041451 | Ga0451791_0899248 | Ga0451791_0899248_31_738 | 218 |
| 617 | 3300041452 | Ga0451793_0779673 | Ga0451793_0779673_104_811 | 218 |
| 618 | 3300041460 | Ga0451802_1216571 | Ga0451802_1216571_847_1503 | 218 |
| 619 | 3300041463 | Ga0451804_0273946 | Ga0451804_0273946_130_786 | 218 |
| 620 | 3300041486 | Ga0451807_0309351 | Ga0451807_0309351_404_1060 | 218 |
| 621 | 3300041509 | Ga0451843_0937299 | Ga0451843_0937299_1204_1860 | 218 |
| 622 | 3300042006 | Ga0439432_002171 | Ga0439432_002171_5315_5971 | 218 |
| 623 | 3300042006 | Ga0439432_019482 | Ga0439432_019482_990_1646 | 218 |
| 624 | 3300042007 | Ga0439449_0002465 | Ga0439449_0002465_3741_4397 | 218 |
| 625 | 3300042007 | Ga0439449_0079319 | Ga0439449_0079319_116_772 | 218 |
| 626 | 3300042016 | Ga0439463_043094 | Ga0439463_043094_383_1039 | 218 |
| 627 | 3300042115 | Ga0450911_013117 | Ga0450911_013117_26_682 | 218 |
| 628 | 3300042115 | Ga0450911_025422 | Ga0450911_025422_26_682 | 218 |
| 629 | 3300042134 | Ga0450898_004210 | Ga0450898_004210_460_1116 | 218 |
| 630 | 3300042876 | Ga0451577_0008692 | Ga0451577_0008692_1537_2193 | 218 |
| 631 | 3300042876 | Ga0451577_0076360 | Ga0451577_0076360_2252_2908 | 218 |
| 632 | 3300042876 | Ga0451577_0077718 | Ga0451577_0077718_491_1150 | 218 |
| 633 | 3300042876 | Ga0451577_0114257 | Ga0451577_0114257_725_1384 | 218 |
| 634 | 3300042876 | Ga0451577_0170983 | Ga0451577_0170983_143_802 | 218 |
| 635 | 3300042876 | Ga0451577_0248917 | Ga0451577_0248917_402_1061 | 218 |
| 636 | 3300042876 | Ga0451577_0429540 | Ga0451577_0429540_220_906 | 218 |
| 637 | 3300044673 | Ga0453683_0022770 | Ga0453683_0022770_1828_2484 | 218 |
| 638 | 3300044712 | Ga0453684_0023479 | Ga0453684_0023479_5525_6181 | 218 |
| 639 | 3300044712 | Ga0453684_0548431 | Ga0453684_0548431_397_1053 | 218 |
| 640 | 3300044712 | Ga0453684_0559808 | Ga0453684_0559808_99_755 | 218 |
| 641 | 3300045051 | Ga0451576_0015411 | Ga0451576_0015411_3683_4342 | 218 |
| 642 | 3300045051 | Ga0451576_0128369 | Ga0451576_0128369_1610_2269 | 218 |
| 643 | 3300045051 | Ga0451576_0716079 | Ga0451576_0716079_108_764 | 218 |
| 644 | 3300046453 | Ga0495627_000152 | Ga0495627_000152_9083_9739 | 218 |
| 645 | 3300046453 | Ga0495627_007838 | Ga0495627_007838_150_815 | 218 |
| 646 | 3300046453 | Ga0495627_007952 | Ga0495627_007952_1072_1728 | 218 |
| 647 | 3300046458 | Ga0495591_000827 | Ga0495591_000827_11808_12464 | 218 |
| 648 | 3300046458 | Ga0495591_010352 | Ga0495591_010352_1953_2609 | 218 |
| 649 | 3300046458 | Ga0495591_013962 | Ga0495591_013962_1564_2220 | 218 |
| 650 | 3300046458 | Ga0495591_022796 | Ga0495591_022796_371_1027 | 218 |
| 651 | 3300046460 | Ga0495638_0020231 | Ga0495638_0020231_2990_3646 | 218 |
| 652 | 3300046460 | Ga0495638_0069505 | Ga0495638_0069505_1074_1730 | 218 |
| 653 | 3300046471 | Ga0495650_0025875 | Ga0495650_0025875_1524_2189 | 218 |
| 654 | 3300046474 | Ga0495605_0000088 | Ga0495605_0000088_40210_40875 | 218 |
| 655 | 3300046474 | Ga0495605_0051487 | Ga0495605_0051487_265_921 | 218 |
| 656 | 3300046474 | Ga0495605_0067067 | Ga0495605_0067067_944_1600 | 218 |
| 657 | 3300046491 | Ga0495584_0050990 | Ga0495584_0050990_821_1477 | 218 |
| 658 | 3300046492 | Ga0495585_0046471 | Ga0495585_0046471_1062_1718 | 218 |
| 659 | 3300046499 | Ga0495594_0112091 | Ga0495594_0112091_782_1447 | 218 |
| 660 | 3300046501 | Ga0495607_0033814 | Ga0495607_0033814_506_1162 | 218 |
| 661 | 3300046501 | Ga0495607_0054139 | Ga0495607_0054139_319_975 | 218 |
| 662 | 3300046506 | Ga0495583_0000135 | Ga0495583_0000135_45011_45676 | 218 |
| 663 | 3300046506 | Ga0495583_0017540 | Ga0495583_0017540_2586_3242 | 218 |
| 664 | 3300046507 | Ga0495606_0027400 | Ga0495606_0027400_2373_3029 | 218 |
| 665 | 3300046507 | Ga0495606_0071235 | Ga0495606_0071235_944_1600 | 218 |
| 666 | 3300046512 | Ga0495610_0015133 | Ga0495610_0015133_3472_4137 | 218 |
| 667 | 3300046512 | Ga0495610_0026675 | Ga0495610_0026675_1663_2319 | 218 |
| 668 | 3300046512 | Ga0495610_0066035 | Ga0495610_0066035_35_691 | 218 |
| 669 | 3300046512 | Ga0495610_0181756 | Ga0495610_0181756_76_732 | 218 |
| 670 | 3300046512 | Ga0495610_0188260 | Ga0495610_0188260_149_805 | 218 |
| 671 | 3300046513 | Ga0495616_0220097 | Ga0495616_0220097_74_739 | 218 |
| 672 | 3300046515 | Ga0495620_0000034 | Ga0495620_0000034_77180_77845 | 218 |
| 673 | 3300046515 | Ga0495620_0019389 | Ga0495620_0019389_2285_2941 | 218 |
| 674 | 3300046518 | Ga0495631_0030875 | Ga0495631_0030875_524_1189 | 218 |
| 675 | 3300046518 | Ga0495631_0052270 | Ga0495631_0052270_259_915 | 218 |
| 676 | 3300046519 | Ga0495632_0023328 | Ga0495632_0023328_977_1633 | 218 |
| 677 | 3300046520 | Ga0495637_0011562 | Ga0495637_0011562_1766_2422 | 218 |
| 678 | 3300046520 | Ga0495637_0030568 | Ga0495637_0030568_333_989 | 218 |
| 679 | 3300046520 | Ga0495637_0113627 | Ga0495637_0113627_320_976 | 218 |
| 680 | 3300046522 | Ga0495643_0073894 | Ga0495643_0073894_410_1066 | 218 |
| 681 | 3300046524 | Ga0495648_0024375 | Ga0495648_0024375_1929_2594 | 218 |
| 682 | 3300046525 | Ga0495663_0031671 | Ga0495663_0031671_135_791 | 218 |
| 683 | 3300046525 | Ga0495663_0073029 | Ga0495663_0073029_63_737 | 218 |
| 684 | 3300046530 | Ga0495654_0011169 | Ga0495654_0011169_1921_2586 | 218 |
| 685 | 3300046530 | Ga0495654_0012081 | Ga0495654_0012081_761_1417 | 218 |
| 686 | 3300046530 | Ga0495654_0015779 | Ga0495654_0015779_707_1363 | 218 |
| 687 | 3300046530 | Ga0495654_0045449 | Ga0495654_0045449_336_992 | 218 |
| 688 | 3300046530 | Ga0495654_0119478 | Ga0495654_0119478_93_782 | 218 |
| 689 | 3300046530 | Ga0495654_0178096 | Ga0495654_0178096_63_719 | 218 |
| 690 | 3300046538 | Ga0495609_0000247 | Ga0495609_0000247_5503_6168 | 218 |
| 691 | 3300046538 | Ga0495609_0026730 | Ga0495609_0026730_404_1060 | 218 |
| 692 | 3300046538 | Ga0495609_0047382 | Ga0495609_0047382_259_948 | 218 |
| 693 | 3300046542 | Ga0495597_0000050 | Ga0495597_0000050_1929_2585 | 218 |
| 694 | 3300046542 | Ga0495597_0019436 | Ga0495597_0019436_532_1197 | 218 |
| 695 | 3300046558 | Ga0495633_0000468 | Ga0495633_0000468_40055_40720 | 218 |
| 696 | 3300046558 | Ga0495633_0043664 | Ga0495633_0043664_376_1044 | 218 |
| 697 | 3300046615 | Ga0495656_0002924 | Ga0495656_0002924_641_1297 | 218 |
| 698 | 3300046615 | Ga0495656_0006875 | Ga0495656_0006875_1668_2342 | 218 |
| 699 | 3300046615 | Ga0495656_0016521 | Ga0495656_0016521_66_740 | 218 |
| 700 | 3300046615 | Ga0495656_0108296 | Ga0495656_0108296_260_916 | 218 |
| 701 | 3300046648 | Ga0495611_0032571 | Ga0495611_0032571_1107_1772 | 218 |
| 702 | 3300046660 | Ga0495625_0145309 | Ga0495625_0145309_95_751 | 218 |
| 703 | 3300046665 | Ga0495661_0000078 | Ga0495661_0000078_40108_40773 | 218 |
| 704 | 3300046665 | Ga0495661_0075057 | Ga0495661_0075057_177_833 | 218 |
| 705 | 3300046691 | Ga0495670_0038487 | Ga0495670_0038487_490_1179 | 218 |
| 706 | 3300046691 | Ga0495670_0078535 | Ga0495670_0078535_670_1344 | 218 |
| 707 | 3300046691 | Ga0495670_0172881 | Ga0495670_0172881_317_973 | 218 |
| 708 | 3300046692 | Ga0495671_0072757 | Ga0495671_0072757_683_1348 | 218 |
| 709 | 3300046694 | Ga0495649_0065648 | Ga0495649_0065648_189_878 | 218 |
| 710 | 3300046694 | Ga0495649_0172365 | Ga0495649_0172365_413_1069 | 218 |
| 711 | 3300046794 | Ga0495589_0031553 | Ga0495589_0031553_530_1195 | 218 |
| 712 | 3300046810 | Ga0495660_0011997 | Ga0495660_0011997_1834_2490 | 218 |
| 713 | 3300046810 | Ga0495660_0027659 | Ga0495660_0027659_534_1199 | 218 |
| 714 | 3300047318 | Ga0495636_0000568 | Ga0495636_0000568_9839_10495 | 218 |
| 715 | 3300047318 | Ga0495636_0055237 | Ga0495636_0055237_763_1455 | 218 |
| 716 | 3300047318 | Ga0495636_0063315 | Ga0495636_0063315_446_1120 | 218 |
| 717 | 3300047323 | Ga0495683_0000108 | Ga0495683_0000108_78291_78956 | 218 |
| 718 | 3300047446 | Ga0495679_000944 | Ga0495679_000944_8705_9370 | 218 |
| 719 | 3300047446 | Ga0495679_067878 | Ga0495679_067878_327_983 | 218 |
| 720 | 3300047469 | Ga0495673_0011018 | Ga0495673_0011018_2344_3000 | 218 |
| 721 | 3300047469 | Ga0495673_0031726 | Ga0495673_0031726_683_1348 | 218 |
| 722 | 3300047470 | Ga0495681_0025109 | Ga0495681_0025109_487_1152 | 218 |
| 723 | 3300047470 | Ga0495681_0034385 | Ga0495681_0034385_745_1401 | 218 |
| 724 | 3300047470 | Ga0495681_0114252 | Ga0495681_0114252_122_778 | 218 |
| 725 | 3300047472 | Ga0495686_0047547 | Ga0495686_0047547_1316_1972 | 218 |
| 726 | 3300048903 | Ga0496100_0341465 | Ga0496100_0341465_153_818 | 218 |
| 727 | 3300048904 | Ga0496101_0216069 | Ga0496101_0216069_50_724 | 218 |
| 728 | 3300048910 | Ga0496107_0367802 | Ga0496107_0367802_28_702 | 218 |
| 729 | 3300048910 | Ga0496107_0727762 | Ga0496107_0727762_48_704 | 218 |
| 730 | 3300048911 | Ga0496108_0322647 | Ga0496108_0322647_598_1272 | 218 |
| 731 | 3300048916 | Ga0496113_0237843 | Ga0496113_0237843_63_737 | 218 |
| 732 | 3300048917 | Ga0496114_0007715 | Ga0496114_0007715_1542_2207 | 218 |
| 733 | 3300048918 | Ga0496115_0229988 | Ga0496115_0229988_135_800 | 218 |
| 734 | 3300048919 | Ga0496116_0054876 | Ga0496116_0054876_130_789 | 218 |
| 735 | 3300048920 | Ga0496117_0032706 | Ga0496117_0032706_2280_2936 | 218 |
| 736 | 3300048920 | Ga0496117_0067095 | Ga0496117_0067095_1298_1954 | 218 |
| 737 | 3300048920 | Ga0496117_0115973 | Ga0496117_0115973_797_1453 | 218 |
| 738 | 3300048920 | Ga0496117_0192870 | Ga0496117_0192870_471_1127 | 218 |
| 739 | 3300048921 | Ga0496118_0079734 | Ga0496118_0079734_657_1313 | 218 |
| 740 | 3300048921 | Ga0496118_0121677 | Ga0496118_0121677_55_711 | 218 |
| 741 | 3300048921 | Ga0496118_0151384 | Ga0496118_0151384_592_1248 | 218 |
| 742 | 3300048921 | Ga0496118_0173652 | Ga0496118_0173652_533_1189 | 218 |
| 743 | 3300048922 | Ga0496119_0027855 | Ga0496119_0027855_1380_2036 | 218 |
| 744 | 3300048922 | Ga0496119_0081607 | Ga0496119_0081607_1019_1675 | 218 |
| 745 | 3300048922 | Ga0496119_0204940 | Ga0496119_0204940_227_883 | 218 |
| 746 | 3300048923 | Ga0496120_0029447 | Ga0496120_0029447_1012_1668 | 218 |
| 747 | 3300048923 | Ga0496120_0073795 | Ga0496120_0073795_189_845 | 218 |
| 748 | 3300048923 | Ga0496120_0088019 | Ga0496120_0088019_29_685 | 218 |
| 749 | 3300048924 | Ga0496121_0012278 | Ga0496121_0012278_3279_3938 | 218 |
| 750 | 3300048924 | Ga0496121_0031139 | Ga0496121_0031139_146_805 | 218 |
| 751 | 3300048924 | Ga0496121_0053409 | Ga0496121_0053409_139_795 | 218 |
| 752 | 3300048924 | Ga0496121_0061803 | Ga0496121_0061803_2275_2931 | 218 |
| 753 | 3300048924 | Ga0496121_0221315 | Ga0496121_0221315_569_1228 | 218 |
| 754 | 3300048925 | Ga0496122_0018800 | Ga0496122_0018800_3754_4419 | 218 |
| 755 | 3300048925 | Ga0496122_0086182 | Ga0496122_0086182_679_1335 | 218 |
| 756 | 3300048925 | Ga0496122_0119626 | Ga0496122_0119626_23_679 | 218 |
| 757 | 3300048925 | Ga0496122_0124505 | Ga0496122_0124505_923_1579 | 218 |
| 758 | 3300048925 | Ga0496122_0178592 | Ga0496122_0178592_465_1121 | 218 |
| 759 | 3300048926 | Ga0496123_0061878 | Ga0496123_0061878_1060_1716 | 218 |
| 760 | 3300048926 | Ga0496123_0073574 | Ga0496123_0073574_1017_1673 | 218 |
| 761 | 3300048926 | Ga0496123_0085420 | Ga0496123_0085420_1213_1878 | 218 |
| 762 | 3300048926 | Ga0496123_0092142 | Ga0496123_0092142_1004_1660 | 218 |
| 763 | 3300048927 | Ga0496124_0000658 | Ga0496124_0000658_29009_29665 | 218 |
| 764 | 3300048927 | Ga0496124_0042651 | Ga0496124_0042651_1009_1665 | 218 |
| 765 | 3300048927 | Ga0496124_0058616 | Ga0496124_0058616_267_923 | 218 |
| 766 | 3300048927 | Ga0496124_0091823 | Ga0496124_0091823_796_1452 | 218 |
| 767 | 3300048927 | Ga0496124_0280236 | Ga0496124_0280236_337_1011 | 218 |
| 768 | 3300048927 | Ga0496124_0331306 | Ga0496124_0331306_52_708 | 218 |
| 769 | 3300048928 | Ga0496125_0033943 | Ga0496125_0033943_2278_2934 | 218 |
| 770 | 3300048928 | Ga0496125_0036932 | Ga0496125_0036932_2272_2928 | 218 |
| 771 | 3300048928 | Ga0496125_0051851 | Ga0496125_0051851_2620_3276 | 218 |
| 772 | 3300048928 | Ga0496125_0087719 | Ga0496125_0087719_1016_1672 | 218 |
| 773 | 3300048928 | Ga0496125_0149824 | Ga0496125_0149824_466_1125 | 218 |
| 774 | 3300048928 | Ga0496125_0344078 | Ga0496125_0344078_104_760 | 218 |
| 775 | 3300048929 | Ga0496126_0072160 | Ga0496126_0072160_92_748 | 218 |
| 776 | 3300048929 | Ga0496126_0193110 | Ga0496126_0193110_707_1363 | 218 |
| 777 | 3300048929 | Ga0496126_0222319 | Ga0496126_0222319_838_1494 | 218 |
| 778 | 3300049459 | Ga0495678_000081 | Ga0495678_000081_39929_40594 | 218 |
| 779 | 3300049568 | Ga0501031_0021912 | Ga0501031_0021912_30_782 | 218 |
| 780 | 3300049568 | Ga0501031_0028905 | Ga0501031_0028905_1990_2646 | 218 |
| 781 | 3300049569 | Ga0501032_0086669 | Ga0501032_0086669_471_1130 | 218 |
| 782 | 3300049569 | Ga0501032_0217537 | Ga0501032_0217537_148_807 | 218 |
| 783 | 3300049569 | Ga0501032_0244603 | Ga0501032_0244603_132_827 | 218 |
| 784 | 3300049570 | Ga0501033_0000683 | Ga0501033_0000683_8224_8886 | 218 |
| 785 | 3300049570 | Ga0501033_0037101 | Ga0501033_0037101_1954_2613 | 218 |
| 786 | 3300049570 | Ga0501033_0102546 | Ga0501033_0102546_273_932 | 218 |
| 787 | 3300049570 | Ga0501033_0129147 | Ga0501033_0129147_1103_1759 | 218 |
| 788 | 3300049570 | Ga0501033_0153969 | Ga0501033_0153969_402_1058 | 218 |
| 789 | 3300049571 | Ga0501034_0071383 | Ga0501034_0071383_1374_2087 | 218 |
| 790 | 3300049571 | Ga0501034_0290428 | Ga0501034_0290428_122_904 | 218 |
| 791 | 3300049571 | Ga0501034_0314562 | Ga0501034_0314562_606_1268 | 218 |
| 792 | 3300049571 | Ga0501034_0441955 | Ga0501034_0441955_545_1204 | 218 |
| 793 | 3300049571 | Ga0501034_0621404 | Ga0501034_0621404_145_801 | 218 |
| 794 | 3300049572 | Ga0501036_0027681 | Ga0501036_0027681_682_1365 | 218 |
| 795 | 3300049572 | Ga0501036_0076796 | Ga0501036_0076796_1830_2567 | 218 |
| 796 | 3300049572 | Ga0501036_0277301 | Ga0501036_0277301_684_1343 | 218 |
| 797 | 3300049573 | Ga0501037_0006686 | Ga0501037_0006686_6372_7055 | 218 |
| 798 | 3300049573 | Ga0501037_0247053 | Ga0501037_0247053_272_931 | 218 |
| 799 | 3300049573 | Ga0501037_0280683 | Ga0501037_0280683_469_1125 | 218 |
| 800 | 3300049574 | Ga0501038_0032416 | Ga0501038_0032416_3249_3911 | 218 |
| 801 | 3300049574 | Ga0501038_0060072 | Ga0501038_0060072_2420_3076 | 218 |
| 802 | 3300049574 | Ga0501038_0112856 | Ga0501038_0112856_908_1567 | 218 |
| 803 | 3300049579 | Ga0501043_0021707 | Ga0501043_0021707_3319_4002 | 218 |
| 804 | 3300049579 | Ga0501043_0055862 | Ga0501043_0055862_2360_3019 | 218 |
| 805 | 3300049579 | Ga0501043_0131236 | Ga0501043_0131236_588_1244 | 218 |
| 806 | 3300049579 | Ga0501043_0179101 | Ga0501043_0179101_21_758 | 218 |
| 807 | 3300049579 | Ga0501043_0404042 | Ga0501043_0404042_246_905 | 218 |
| 808 | 3300049580 | Ga0501046_0062908 | Ga0501046_0062908_2056_2715 | 218 |
| 809 | 3300049580 | Ga0501046_0262877 | Ga0501046_0262877_346_1002 | 218 |
| 810 | 3300049581 | Ga0501047_0043531 | Ga0501047_0043531_2749_3405 | 218 |
| 811 | 3300049581 | Ga0501047_0045001 | Ga0501047_0045001_2058_2717 | 218 |
| 812 | 3300049581 | Ga0501047_0050180 | Ga0501047_0050180_2339_3076 | 218 |
| 813 | 3300049581 | Ga0501047_0312368 | Ga0501047_0312368_56_715 | 218 |
| 814 | 3300049581 | Ga0501047_0599375 | Ga0501047_0599375_14_673 | 218 |
| 815 | 3300049586 | Ga0501070_0015349 | Ga0501070_0015349_1120_1803 | 218 |
| 816 | 3300049586 | Ga0501070_0356438 | Ga0501070_0356438_120_800 | 218 |
| 817 | 3300049589 | Ga0501073_0512599 | Ga0501073_0512599_41_697 | 218 |
| 818 | 3300049593 | Ga0501077_0088828 | Ga0501077_0088828_299_958 | 218 |
| 819 | 3300049669 | Ga0501235_020753 | Ga0501235_020753_669_1325 | 218 |
| 820 | 3300049680 | Ga0501250_013566 | Ga0501250_013566_108_764 | 218 |
| 821 | 3300049742 | Ga0501080_0192536 | Ga0501080_0192536_524_1180 | 218 |
| 822 | 3300049822 | Ga0501035_0005012 | Ga0501035_0005012_5939_6598 | 218 |
| 823 | 3300049822 | Ga0501035_0008708 | Ga0501035_0008708_5873_6556 | 218 |
| 824 | 3300049822 | Ga0501035_0013853 | Ga0501035_0013853_6434_7096 | 218 |
| 825 | 3300049822 | Ga0501035_0016440 | Ga0501035_0016440_5156_5815 | 218 |
| 826 | 3300049822 | Ga0501035_0044579 | Ga0501035_0044579_1339_1998 | 218 |
| 827 | 3300049822 | Ga0501035_0049900 | Ga0501035_0049900_2219_2881 | 218 |
| 828 | 3300049822 | Ga0501035_0050686 | Ga0501035_0050686_2749_3405 | 218 |
| 829 | 3300049822 | Ga0501035_0140616 | Ga0501035_0140616_642_1304 | 218 |
| 830 | 3300049822 | Ga0501035_0530788 | Ga0501035_0530788_117_779 | 218 |
| 831 | 3300049823 | Ga0501044_0000162 | Ga0501044_0000162_61479_62141 | 218 |
| 832 | 3300049823 | Ga0501044_0001700 | Ga0501044_0001700_22719_23432 | 218 |
| 833 | 3300049823 | Ga0501044_0005271 | Ga0501044_0005271_10168_10827 | 218 |
| 834 | 3300049823 | Ga0501044_0009521 | Ga0501044_0009521_4222_4905 | 218 |
| 835 | 3300049823 | Ga0501044_0042804 | Ga0501044_0042804_476_1132 | 218 |
| 836 | 3300049823 | Ga0501044_0090995 | Ga0501044_0090995_837_1496 | 218 |
| 837 | 3300049823 | Ga0501044_0108156 | Ga0501044_0108156_17_676 | 218 |
| 838 | 3300049823 | Ga0501044_0160875 | Ga0501044_0160875_91_828 | 218 |
| 839 | 3300049823 | Ga0501044_0266207 | Ga0501044_0266207_201_896 | 218 |
| 840 | 3300049823 | Ga0501044_0415913 | Ga0501044_0415913_543_1199 | 218 |
| 841 | 3300049823 | Ga0501044_0562410 | Ga0501044_0562410_118_774 | 218 |
| 842 | 3300049824 | Ga0501045_0384267 | Ga0501045_0384267_219_956 | 218 |
| 843 | 3300049824 | Ga0501045_0389256 | Ga0501045_0389256_31_693 | 218 |
| 844 | 3300050491 | nmdc:mga00v17_1308_c1 | nmdc:mga00v17_1308_c1_493_1149 | 218 |
| 845 | 3300053125 | Ga0500618_002180 | Ga0500618_002180_5377_6051 | 218 |
| 846 | 3300053125 | Ga0500618_007900 | Ga0500618_007900_279_944 | 218 |
| 847 | iso_pu_bacteria | 2643221695 | 2644528777 | 218 |
| 848 | iso_pu_bacteria | 2687453130 | 2687581758 | 218 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gb4-assembly1.cif.gz_A | crystal structure of thiopurine methyltransferase (18204406) from mus musculus at 1.35 a resolution | 0.9033 | 1 | 218 |
| 2gb4-assembly1.cif.gz_A | crystal structure of thiopurine methyltransferase (18204406) from mus musculus at 1.35 a resolution | 0.8993 | 1 | 218 |
| 2h11-assembly2.cif.gz_B | amino-terminal truncated thiopurine s-methyltransferase complexed with s-adenosyl-l-homocysteine | 0.8912 | 1 | 218 |
| 2h11-assembly2.cif.gz_B | amino-terminal truncated thiopurine s-methyltransferase complexed with s-adenosyl-l-homocysteine | 0.8873 | 1 | 218 |
| 5dnk-assembly1.cif.gz_B | the structure of pkmt1 from rickettsia prowazekii in complex with adohcy | 0.7812 | 38 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2bzgA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8733 | 1 | 218 | 3.40.50.150 |
| 2bzgA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8695 | 1 | 218 | 3.40.50.150 |
| af_B7E650_31_245_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8107 | 3 | 218 | 3.40.50.150 |
| af_P9WKL5_23_210_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7968 | 21 | 189 | 3.40.50.150 |
| af_Q54U59_216_375_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7867 | 38 | 153 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H1PRK0-F1-model_v4 | deleted | 0.9966 | 142 | 218 |
|
| AF-H8FEH1-F1-model_v4 | deleted | 0.9921 | 145 | 218 |
|
| AF-W4SHG1-F1-model_v4 | Thiopurine S-methyltransferase | 0.9903 | 91 | 218 |
GO:0005737
GO:0008119 GO:0032259 |
| AF-A0A0P8ZSH7-F1-model_v4 | Thiopurine S-methyltransferase (EC 2.1.1.67) | 0.9895 | 42 | 218 |
GO:0005737
GO:0008119 GO:0010038 GO:0032259 |
| AF-A0A2Z7A7M6-F1-model_v4 | thiopurine S-methyltransferase (EC 2.1.1.67) | 0.9887 | 3 | 218 |
GO:0005737
GO:0008119 GO:0010038 GO:0016491 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar