F483378

General Info

Members Datasets Scaffolds Average Seq Length
848 405 763 219

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0447722|Ga0496124_0447722_30_818
Length 262
Sequence MGNEQAGQHGDVLRVKMQSSSISYRSKSKPSFLRYVSKRLISTGATMEPAFWHKRWADNQIGFHQAQVNPYLQAHWPALALPAGSRVLVPLCGKSLDLAWLAGQGHRVLGVELSRRAVEGFFQEHGLEADVTQKGAFEVWRSAEVELWCGDFFALQAQDVADCAGFYDRAALIALPPEMRLSYMRLLADVLPAGCQGLLVTLDYDQALMAGPPFSVADDEVRHGFAGRQVEPLEVLEIIEQSPKFAQAGATSLLERVYRIGL

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
3 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
4 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
5 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
6 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
7 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
8 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
9 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
10 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
11 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
12 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
13 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
14 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
15 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
16 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
17 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
18 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
19 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
20 2643221695 Lysobacter sp. Root494 Isolate Unclassified
21 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
22 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
23 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
24 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
25 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
26 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
27 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
28 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
29 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
30 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
31 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
32 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
33 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
34 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
35 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
36 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
37 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
38 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
39 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
40 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
41 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
42 2855730933 Achromobacter sp. HZ28 Isolate Nodule
43 2855767633 Achromobacter sp. HZ34 Isolate Nodule
44 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
45 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
46 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
47 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
48 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
49 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
50 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
51 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
52 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
53 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
54 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
55 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
56 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
57 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
58 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
59 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
60 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
61 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
62 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
63 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
64 2919513703 Luteimonas sp. 3794 Isolate Unclassified
65 2919675420 Luteimonas terrae 4099 Isolate Unclassified
66 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
67 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
68 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
69 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
70 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
71 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
72 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
73 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
74 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
75 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
76 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
77 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
78 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
79 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
80 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
81 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
82 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
83 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
84 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
85 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
86 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
87 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
88 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
91 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
92 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
93 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
94 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
95 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
96 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
97 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
98 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
99 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
100 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
101 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
102 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
103 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
104 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
105 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
106 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
107 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
108 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
109 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
110 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
111 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
112 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
113 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
114 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
115 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
116 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
117 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
118 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
119 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
120 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
121 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
122 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
123 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
124 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
125 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
126 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
127 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
128 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
129 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
130 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
131 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
132 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
133 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
134 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
135 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
136 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
140 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
141 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
142 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
143 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
148 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
149 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
150 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
151 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
159 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
160 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
161 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
166 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
167 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
170 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
171 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
175 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
184 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
186 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
228 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
229 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
238 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
239 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
240 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
241 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
242 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
243 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
248 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
249 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
250 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
255 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
260 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
261 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
262 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
268 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
275 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
276 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
277 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
278 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
279 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
280 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
281 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
282 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
283 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
284 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
285 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
286 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
287 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
288 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
289 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
290 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
291 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
292 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
293 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
294 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
295 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
298 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
299 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
300 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
303 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
304 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
307 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
308 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
309 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
310 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
311 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
312 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
313 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
314 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
315 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
316 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
317 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
318 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
319 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
320 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
321 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
324 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
332 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
333 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
334 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
335 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
336 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
337 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
338 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
339 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
340 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
341 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
342 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
343 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
344 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
345 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
364 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
365 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
366 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
369 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
381 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
382 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
385 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
395 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
396 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
397 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
398 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
399 8052494512 Pseudomonas putida LD6 Isolate Unclassified
400 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
401 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
402 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
403 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
404 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
405 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.03
Metatranscriptomes 0.94
Isolates 10.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.66
Nodule 0.83
Rhizoplane 3.54
Rhizosphere 76.53
Stem 0
Stem Tuber 0
Unclassified 13.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1006336 3300002737 Bacteria 2066
2 JGI25164J39214_1000421 3300002772 Bacteria 23796
3 JGI25165J46597_1015099 3300003214 Bacteria 1045
4 rootH2_10073649 3300003320 Bacteria 1918
5 rootH1_10045656 3300003323 Bacteria 1476
6 Ga0055538_1000141 3300003751 Bacteria 50563
7 Ga0055539_1000134 3300003752 Bacteria 78300
8 Ga0055539_1000192 3300003752 Bacteria 50563
9 Ga0055533_1000138 3300003756 Bacteria 78275
10 Ga0055533_1000192 3300003756 Bacteria 50563
11 Ga0055532_1000142 3300003758 Bacteria 69999
12 Ga0055525_1000183 3300003759 Bacteria 78300
13 Ga0055525_1000260 3300003759 Bacteria 50563
14 Ga0055535_1009015 3300003761 Bacteria 1749
15 Ga0055529_1001465 3300003763 Bacteria 7167
16 Ga0055536_1006580 3300003781 Bacteria 5383
17 Ga0055531_10013344 3300003794 Bacteria 3792
18 Ga0055541_1000089 3300003841 Bacteria 78275
19 Ga0055541_1000127 3300003841 Bacteria 50563
20 Ga0065714_10004793 3300005288 Bacteria 4968
21 Ga0065714_10010006 3300005288 Bacteria 3039
22 Ga0065704_10117506 3300005289 Bacteria 1832
23 Ga0065704_10125447 3300005289 Bacteria 1697
24 Ga0065704_10297990 3300005289 Bacteria 891
25 Ga0065715_10191057 3300005293 Bacteria 1395
26 Ga0070658_10106431 3300005327 Bacteria 2320
27 Ga0070658_11123616 3300005327 Bacteria 683
28 Ga0070690_100150586 3300005330 Bacteria 1587
29 Ga0070670_100019616 3300005331 Bacteria 5804
30 Ga0070670_100063254 3300005331 Bacteria 3176
31 Ga0070670_100080503 3300005331 Bacteria 2799
32 Ga0068869_100115454 3300005334 Bacteria 2047
33 Ga0070666_10471987 3300005335 Unclassified 908
34 Ga0070680_100213575 3300005336 Bacteria 1628
35 Ga0070680_100290896 3300005336 Bacteria 1385
36 Ga0070660_100062431 3300005339 Bacteria 2894
37 Ga0070660_100078446 3300005339 Bacteria 2590
38 Ga0070660_100160873 3300005339 Bacteria 1809
39 Ga0070689_100424543 3300005340 Unclassified 1127
40 Ga0070691_10038752 3300005341 Bacteria 2251
41 Ga0070661_100000029 3300005344 Bacteria 117682
42 Ga0070669_100000316 3300005353 Bacteria 37853
43 Ga0070669_100284249 3300005353 Bacteria 1326
44 Ga0070675_100000292 3300005354 Bacteria 33370
45 Ga0070675_100022809 3300005354 Bacteria 5001
46 Ga0070671_100010060 3300005355 Bacteria 7597
47 Ga0070671_100083924 3300005355 Bacteria 2664
48 Ga0070671_100193137 3300005355 Bacteria 1725
49 Ga0070674_100243978 3300005356 Bacteria 1408
50 Ga0070673_100001571 3300005364 Bacteria 13458
51 Ga0070673_100198282 3300005364 Bacteria 1728
52 Ga0070688_100007205 3300005365 Bacteria 5989
53 Ga0070688_100010533 3300005365 Bacteria 5103
54 Ga0070659_100021330 3300005366 Bacteria 4932
55 Ga0070659_100058659 3300005366 Bacteria 3038
56 Ga0070659_100102032 3300005366 Bacteria 2309
57 Ga0070659_100991625 3300005366 Bacteria 737
58 Ga0070709_10737823 3300005434 Bacteria 769
59 Ga0070714_100000439 3300005435 Bacteria 30200
60 Ga0070710_10174017 3300005437 Bacteria 1343
61 Ga0070694_100130410 3300005444 Bacteria 1815
62 Ga0070663_100504945 3300005455 Unclassified 1005
63 Ga0070662_100001079 3300005457 Bacteria 16619
64 Ga0070662_100079179 3300005457 Bacteria 2443
65 Ga0070681_10000122 3300005458 Bacteria 58332
66 Ga0070681_10150461 3300005458 Bacteria 2254
67 Ga0070681_10181002 3300005458 Bacteria 2029
68 Ga0068867_100056297 3300005459 Bacteria 2909
69 Ga0070685_10018927 3300005466 Bacteria 3710
70 Ga0070679_100046779 3300005530 Bacteria 4313
71 Ga0070679_100125107 3300005530 Bacteria 2553
72 Ga0070679_100203184 3300005530 Bacteria 1946
73 Ga0070679_100500581 3300005530 Bacteria 1159
74 Ga0068853_100033679 3300005539 Bacteria 4347
75 Ga0068853_100034758 3300005539 Bacteria 4279
76 Ga0068853_100079556 3300005539 Bacteria 2867
77 Ga0070672_100002632 3300005543 Bacteria 11477
78 Ga0070672_100005875 3300005543 Bacteria 8185
79 Ga0070672_100029504 3300005543 Bacteria 4114
80 Ga0070696_100015274 3300005546 Bacteria 5154
81 Ga0070693_100041808 3300005547 Bacteria 2580
82 Ga0070665_100355473 3300005548 Unclassified 1471
83 Ga0068855_100000651 3300005563 Bacteria 42448
84 Ga0068855_100036971 3300005563 Bacteria 5809
85 Ga0068855_100076888 3300005563 Bacteria 3873
86 Ga0068855_100127016 3300005563 Bacteria 2915
87 Ga0070664_100054591 3300005564 Bacteria 3390
88 Ga0068857_100102455 3300005577 Bacteria 2569
89 Ga0068857_100104147 3300005577 Bacteria 2548
90 Ga0068854_100021927 3300005578 Bacteria 4341
91 Ga0068854_100244340 3300005578 Bacteria 1431
92 Ga0068859_100006693 3300005617 Bacteria 11704
93 Ga0068859_100051096 3300005617 Bacteria 4154
94 Ga0068851_10000050 3300005834 Bacteria 72913
95 Ga0068860_100005405 3300005843 Bacteria 12963
96 Ga0068862_100057164 3300005844 Bacteria 3344
97 Ga0075364_10001303 3300006051 Bacteria 13417
98 Ga0075364_10126192 3300006051 Bacteria 1716
99 Ga0075432_10034834 3300006058 Bacteria 1749
100 Ga0075432_10091504 3300006058 Bacteria 1114
101 Ga0097621_100008706 3300006237 Bacteria 7328
102 Ga0097621_100147890 3300006237 Bacteria 2013
103 Ga0068871_100006865 3300006358 Bacteria 8105
104 Ga0097620_100006693 3300006931 Bacteria 11704
105 Ga0097620_100051097 3300006931 Bacteria 4154
106 Ga0079104_1004393 3300006946 Bacteria 6076
107 Ga0099795_10000002 3300007788 Bacteria 161112
108 Ga0105251_10003076 3300009011 Bacteria 12398
109 Ga0105251_10003160 3300009011 Bacteria 12198
110 Ga0105251_10011010 3300009011 Bacteria 5193
111 Ga0105251_10011378 3300009011 Bacteria 5086
112 Ga0105251_10016935 3300009011 Bacteria 3919
113 Ga0105251_10019280 3300009011 Bacteria 3607
114 Ga0105251_10055081 3300009011 Bacteria 1887
115 Ga0105251_10208169 3300009011 Bacteria 881
116 Ga0105244_10018125 3300009036 Bacteria 3960
117 Ga0105244_10023700 3300009036 Bacteria 3361
118 Ga0105244_10027086 3300009036 Bacteria 3094
119 Ga0105244_10074517 3300009036 Bacteria 1688
120 Ga0105244_10084971 3300009036 Bacteria 1562
121 Ga0105250_10000319 3300009092 Bacteria 37054
122 Ga0105250_10001554 3300009092 Bacteria 12329
123 Ga0105250_10044287 3300009092 Bacteria 1784
124 Ga0105250_10161435 3300009092 Bacteria 936
125 Ga0105240_10037357 3300009093 Bacteria 6242
126 Ga0111539_10061200 3300009094 Bacteria 4460
127 Ga0111539_10205844 3300009094 Bacteria 2293
128 Ga0105243_10035319 3300009148 Bacteria 3875
129 Ga0105243_10068799 3300009148 Bacteria 2854
130 Ga0105242_10289139 3300009176 Bacteria 1492
131 Ga0105248_10000530 3300009177 Bacteria 43488
132 Ga0105248_10110797 3300009177 Bacteria 3095
133 Ga0105237_10004758 3300009545 Bacteria 15608
134 Ga0105238_10000006 3300009551 Bacteria 346249
135 Ga0105238_10108385 3300009551 Bacteria 2758
136 Ga0105238_10177113 3300009551 Bacteria 2109
137 Ga0099796_10000017 3300010159 Bacteria 48991
138 Ga0105239_10037141 3300010375 Bacteria 5343
139 Ga0157343_1001722 3300012488 Bacteria 1109
140 Ga0157373_10007084 3300013100 Bacteria 8360
141 Ga0157373_10051241 3300013100 Bacteria 2941
142 Ga0157373_10062624 3300013100 Bacteria 2635
143 Ga0157373_10147481 3300013100 Bacteria 1655
144 Ga0157373_10154374 3300013100 Bacteria 1615
145 Ga0157373_10345309 3300013100 Bacteria 1061
146 Ga0157371_10001274 3300013102 Bacteria 26576
147 Ga0157371_10045728 3300013102 Bacteria 3114
148 Ga0157371_10049940 3300013102 Bacteria 2972
149 Ga0157371_10081826 3300013102 Bacteria 2286
150 Ga0157370_10021678 3300013104 Bacteria 6401
151 Ga0157370_10172186 3300013104 Bacteria 2012
152 Ga0157370_10230410 3300013104 Bacteria 1715
153 Ga0157370_10271459 3300013104 Bacteria 1567
154 Ga0157369_10009316 3300013105 Bacteria 11230
155 Ga0157369_10070491 3300013105 Bacteria 3755
156 Ga0157369_10094848 3300013105 Bacteria 3185
157 Ga0157369_10180466 3300013105 Bacteria 2221
158 Ga0157374_10068556 3300013296 Bacteria 3338
159 Ga0157374_10323168 3300013296 Unclassified 1529
160 Ga0157378_10046334 3300013297 Bacteria 3865
161 Ga0163162_10002174 3300013306 Bacteria 18411
162 Ga0163162_10084203 3300013306 Bacteria 3255
163 Ga0157372_10035376 3300013307 Bacteria 5498
164 Ga0157372_10254085 3300013307 Bacteria 2040
165 Ga0157372_10477907 3300013307 Bacteria 1453
166 Ga0157372_10719518 3300013307 Bacteria 1161
167 Ga0157375_10000876 3300013308 Bacteria 26145
168 Ga0157375_10013741 3300013308 Bacteria 7217
169 Ga0157375_10318207 3300013308 Bacteria 1721
170 Ga0157375_10348151 3300013308 Unclassified 1647
171 Ga0163163_10014069 3300014325 Bacteria 7346
172 Ga0163163_10753547 3300014325 Bacteria 1037
173 Ga0157380_10177604 3300014326 Bacteria 1868
174 Ga0157380_10410763 3300014326 Unclassified 1287
175 Ga0182008_10020662 3300014497 Bacteria 3387
176 Ga0182008_10026957 3300014497 Bacteria 2912
177 Ga0182008_10032622 3300014497 Bacteria 2615
178 Ga0182008_10033434 3300014497 Bacteria 2580
179 Ga0157377_10564228 3300014745 Bacteria 806
180 Ga0157379_10000084 3300014968 Bacteria 62328
181 Ga0157376_10026920 3300014969 Bacteria 4551
182 Ga0182006_1001091 3300015261 Bacteria 17388
183 Ga0182007_10024101 3300015262 Bacteria 2133
184 Ga0182007_10028919 3300015262 Bacteria 1900
185 Ga0182007_10066083 3300015262 Bacteria 1184
186 Ga0183369_1003 3300015685 Bacteria 726443
187 Ga0163161_10073587 3300017792 Bacteria 2504
188 Ga0163161_10089807 3300017792 Unclassified 2273
189 Ga0163161_10139001 3300017792 Bacteria 1838
190 Ga0206354_10029098 3300020081 Bacteria 777
191 Ga0213872_10002881 3300021361 Bacteria 9791
192 Ga0209784_100009 3300025224 Bacteria 688031
193 Ga0209784_100040 3300025224 Bacteria 231812
194 Ga0209566_100007 3300025225 Bacteria 688031
195 Ga0209566_100051 3300025225 Bacteria 231920
196 Ga0209674_100018 3300025226 Bacteria 688031
197 Ga0209674_100072 3300025226 Bacteria 231812
198 Ga0209147_100067 3300025229 Bacteria 231812
199 Ga0209563_100020 3300025230 Bacteria 688031
200 Ga0209563_100073 3300025230 Bacteria 231920
201 Ga0207427_100049 3300025231 Bacteria 237504
202 Ga0209437_100083 3300025233 Bacteria 256005
203 Ga0209258_100585 3300025242 Bacteria 30446
204 Ga0209646_1000575 3300025246 Bacteria 15286
205 Ga0209677_100010 3300025253 Bacteria 688031
206 Ga0209677_100121 3300025253 Bacteria 80378
207 Ga0209233_1000075 3300025261 Bacteria 356837
208 Ga0209675_1008687 3300025291 Bacteria 3690
209 Ga0209676_1000891 3300025292 Bacteria 38072
210 Ga0209676_1002024 3300025292 Bacteria 15917
211 Ga0209025_1016319 3300025294 Bacteria 4397
212 Ga0209025_1133987 3300025294 Bacteria 714
213 Ga0209050_1022212 3300025298 Bacteria 2279
214 Ga0209257_1000180 3300025304 Bacteria 158090
215 Ga0207656_10000235 3300025321 Bacteria 19518
216 Ga0207696_1000019 3300025711 Bacteria 476309
217 Ga0207696_1000171 3300025711 Bacteria 102599
218 Ga0207696_1000191 3300025711 Bacteria 94782
219 Ga0207696_1008253 3300025711 Bacteria 4006
220 Ga0207655_1000035 3300025728 Bacteria 359016
221 Ga0207655_1000614 3300025728 Bacteria 42960
222 Ga0207655_1056983 3300025728 Bacteria 1537
223 Ga0207713_1000166 3300025735 Bacteria 96359
224 Ga0207713_1000173 3300025735 Bacteria 92859
225 Ga0207713_1002517 3300025735 Bacteria 13272
226 Ga0207713_1007526 3300025735 Bacteria 6408
227 Ga0207713_1009283 3300025735 Bacteria 5567
228 Ga0207713_1009510 3300025735 Bacteria 5471
229 Ga0207713_1019125 3300025735 Bacteria 3364
230 Ga0207713_1021048 3300025735 Bacteria 3136
231 Ga0207713_1043939 3300025735 Bacteria 1841
232 Ga0207692_10141484 3300025898 Bacteria 1369
233 Ga0207705_10123947 3300025909 Bacteria 1919
234 Ga0207705_10128389 3300025909 Bacteria 1885
235 Ga0207707_10000310 3300025912 Bacteria 51190
236 Ga0207707_10033751 3300025912 Bacteria 4478
237 Ga0207707_10235982 3300025912 Bacteria 1591
238 Ga0207707_10597336 3300025912 Bacteria 934
239 Ga0207695_10003954 3300025913 Bacteria 20489
240 Ga0207671_10002838 3300025914 Bacteria 18016
241 Ga0207660_10113778 3300025917 Bacteria 2040
242 Ga0207660_10312036 3300025917 Bacteria 1254
243 Ga0207662_10230881 3300025918 Unclassified 1209
244 Ga0207657_10024061 3300025919 Bacteria 5654
245 Ga0207657_10029629 3300025919 Bacteria 4980
246 Ga0207657_10051681 3300025919 Bacteria 3571
247 Ga0207652_10017245 3300025921 Bacteria 5908
248 Ga0207652_10407264 3300025921 Bacteria 1227
249 Ga0207681_10000491 3300025923 Bacteria 27650
250 Ga0207694_10000110 3300025924 Bacteria 85854
251 Ga0207694_10196036 3300025924 Bacteria 1642
252 Ga0207650_10000174 3300025925 Bacteria 75634
253 Ga0207650_10033727 3300025925 Bacteria 3709
254 Ga0207659_10002211 3300025926 Bacteria 11576
255 Ga0207659_10003140 3300025926 Bacteria 9876
256 Ga0207659_10012864 3300025926 Bacteria 5343
257 Ga0207659_10309181 3300025926 Bacteria 1301
258 Ga0207659_10732366 3300025926 Unclassified 848
259 Ga0207659_10746209 3300025926 Bacteria 839
260 Ga0207664_10003938 3300025929 Bacteria 9986
261 Ga0207644_10125044 3300025931 Bacteria 1962
262 Ga0207644_10239101 3300025931 Unclassified 1445
263 Ga0207690_10002939 3300025932 Bacteria 10269
264 Ga0207690_10024721 3300025932 Bacteria 3764
265 Ga0207706_10002445 3300025933 Bacteria 18134
266 Ga0207709_10027997 3300025935 Bacteria 3254
267 Ga0207709_10051919 3300025935 Bacteria 2515
268 Ga0207669_10183917 3300025937 Bacteria 1501
269 Ga0207704_10524697 3300025938 Bacteria 958
270 Ga0207691_10017313 3300025940 Bacteria 6835
271 Ga0207691_10031440 3300025940 Bacteria 4954
272 Ga0207691_10031677 3300025940 Bacteria 4934
273 Ga0207711_10151337 3300025941 Bacteria 2094
274 Ga0207679_10011336 3300025945 Bacteria 5768
275 Ga0207679_10149977 3300025945 Bacteria 1896
276 Ga0207667_10000120 3300025949 Bacteria 123800
277 Ga0207667_10049964 3300025949 Bacteria 4414
278 Ga0207667_10114060 3300025949 Bacteria 2786
279 Ga0207668_10085836 3300025972 Bacteria 2298
280 Ga0207703_10012102 3300026035 Bacteria 6722
281 Ga0207639_10003873 3300026041 Bacteria 10082
282 Ga0207639_10012151 3300026041 Bacteria 5990
283 Ga0207678_10578362 3300026067 Bacteria 984
284 Ga0207648_10038161 3300026089 Bacteria 4228
285 Ga0207676_10234177 3300026095 Bacteria 1644
286 Ga0207674_10031883 3300026116 Bacteria 5532
287 Ga0207674_10063737 3300026116 Bacteria 3719
288 Ga0207698_10349682 3300026142 Bacteria 1396
289 Ga0209281_1003625 3300027111 Bacteria 4992
290 Ga0209389_1000037 3300027296 Bacteria 125897
291 Ga0209984_1006779 3300027424 Bacteria 1411
292 Ga0209179_1000024 3300027512 Bacteria 39428
293 Ga0209982_1001893 3300027552 Bacteria 2895
294 Ga0209983_1001409 3300027665 Bacteria 5358
295 Ga0209983_1017829 3300027665 Bacteria 1471
296 Ga0209971_1000854 3300027682 Bacteria 7847
297 Ga0209974_10003051 3300027876 Bacteria 6058
298 Ga0209974_10092894 3300027876 Bacteria 1048
299 Ga0268266_10353131 3300028379 Bacteria 1382
300 Ga0268264_10029942 3300028381 Bacteria 4463
301 Ga0307515_10211654 3300028794 Bacteria 1781
302 Ga0316177_1063096 3300030731 Bacteria 1911
303 Ga0316182_1080836 3300030745 Bacteria 1868
304 Ga0265328_10005946 3300031239 Bacteria 5199
305 Ga0265340_10190618 3300031247 Bacteria 924
306 Ga0265331_10000138 3300031250 Bacteria 96032
307 Ga0265331_10028049 3300031250 Bacteria 2818
308 Ga0265331_10102939 3300031250 Bacteria 1313
309 Ga0265327_10000299 3300031251 Bacteria 96033
310 Ga0265327_10011689 3300031251 Bacteria 6016
311 Ga0307513_10011784 3300031456 Bacteria 10841
312 Ga0307513_10130008 3300031456 Bacteria 2466
313 Ga0307509_10014264 3300031507 Bacteria 9356
314 Ga0307408_100519480 3300031548 Bacteria 1045
315 Ga0316575_10002178 3300031665 Bacteria 6535
316 Ga0316575_10053165 3300031665 Bacteria 1613
317 Ga0316575_10115968 3300031665 Unclassified 1094
318 Ga0316575_10217424 3300031665 Unclassified 797
319 Ga0316579_10006228 3300031691 Bacteria 4858
320 Ga0316579_10080796 3300031691 Bacteria 1547
321 Ga0316579_10101258 3300031691 Bacteria 1380
322 Ga0316579_10113393 3300031691 Bacteria 1301
323 Ga0316579_10162846 3300031691 Bacteria 1078
324 Ga0316579_10268748 3300031691 Bacteria 824
325 Ga0316579_10284286 3300031691 Unclassified 799
326 Ga0316576_10002007 3300031727 Bacteria 11393
327 Ga0316576_10033272 3300031727 Bacteria 3668
328 Ga0316576_10054937 3300031727 Bacteria 2905
329 Ga0316576_10055448 3300031727 Bacteria 2893
330 Ga0316576_10057837 3300031727 Bacteria 2834
331 Ga0316576_10109338 3300031727 Bacteria 2071
332 Ga0316576_10133579 3300031727 Bacteria 1867
333 Ga0316576_10183899 3300031727 Bacteria 1576
334 Ga0316578_10000355 3300031728 Bacteria 14513
335 Ga0316578_10000750 3300031728 Bacteria 11856
336 Ga0316578_10003780 3300031728 Bacteria 7004
337 Ga0316578_10034817 3300031728 Bacteria 2893
338 Ga0316578_10035569 3300031728 Bacteria 2864
339 Ga0316578_10053223 3300031728 Bacteria 2371
340 Ga0316578_10067463 3300031728 Bacteria 2114
341 Ga0316578_10100615 3300031728 Bacteria 1733
342 Ga0307405_10056530 3300031731 Bacteria 2461
343 Ga0307405_10283396 3300031731 Bacteria 1248
344 Ga0316577_10019867 3300031733 Bacteria 3722
345 Ga0316577_10046641 3300031733 Bacteria 2420
346 Ga0316577_10062082 3300031733 Bacteria 2086
347 Ga0316577_10116922 3300031733 Unclassified 1498
348 Ga0307413_10000289 3300031824 Bacteria 15520
349 Ga0307413_10442498 3300031824 Bacteria 1029
350 Ga0307412_10245541 3300031911 Bacteria 1387
351 Ga0307412_10270504 3300031911 Bacteria 1329
352 Ga0307409_100946664 3300031995 Bacteria 877
353 Ga0307414_10003488 3300032004 Bacteria 8404
354 Ga0307414_10020803 3300032004 Bacteria 4099
355 Ga0307414_10234978 3300032004 Bacteria 1514
356 Ga0307414_10442546 3300032004 Bacteria 1138
357 Ga0307414_10784114 3300032004 Bacteria 868
358 Ga0307414_11021017 3300032004 Bacteria 762
359 Ga0307411_10793140 3300032005 Bacteria 833
360 Ga0307415_100530263 3300032126 Bacteria 1035
361 Ga0316583_10005875 3300032133 Bacteria 4414
362 Ga0316583_10023784 3300032133 Bacteria 2187
363 Ga0316583_10066017 3300032133 Bacteria 1266
364 Ga0316583_10132983 3300032133 Bacteria 867
365 Ga0316583_10145219 3300032133 Bacteria 826
366 Ga0316585_10012810 3300032137 Unclassified 2490
367 Ga0316585_10016266 3300032137 Bacteria 2239
368 Ga0316585_10053025 3300032137 Bacteria 1304
369 Ga0316585_10096263 3300032137 Bacteria 969
370 Ga0316580_10002337 3300032139 Bacteria 5200
371 Ga0316580_10016466 3300032139 Bacteria 2269
372 Ga0316580_10017836 3300032139 Bacteria 2184
373 Ga0316580_10122293 3300032139 Bacteria 797
374 Ga0316593_10000460 3300032168 Bacteria 7478
375 Ga0316593_10016799 3300032168 Bacteria 2224
376 Ga0316593_10019164 3300032168 Bacteria 2112
377 Ga0316593_10021839 3300032168 Bacteria 2005
378 Ga0316592_1003346 3300033524 Bacteria 2881
379 Ga0316596_1004284 3300033541 Bacteria 3190
380 Ga0316596_1013151 3300033541 Bacteria 2041
381 Ga0316574_0004485 3300035398 Bacteria 7325
382 Ga0316574_0020422 3300035398 Unclassified 3921
383 Ga0316574_0041419 3300035398 Bacteria 2839
384 Ga0316574_0055978 3300035398 Bacteria 2466
385 Ga0316574_0130892 3300035398 Bacteria 1614
386 Ga0316574_0136143 3300035398 Unclassified 1582
387 Ga0316574_0160823 3300035398 Bacteria 1446
388 Ga0316574_0230902 3300035398 Bacteria 1184
389 Ga0373937_0092457 3300036401 Bacteria 2804
390 Ga0373937_0529841 3300036401 Unclassified 1119
391 Ga0316582_0004837 3300036647 Bacteria 6871
392 Ga0316582_0007864 3300036647 Bacteria 5696
393 Ga0316582_0017707 3300036647 Bacteria 4129
394 Ga0316582_0025344 3300036647 Bacteria 3560
395 Ga0316582_0028543 3300036647 Bacteria 3381
396 Ga0316582_0049248 3300036647 Bacteria 2665
397 Ga0316582_0084178 3300036647 Bacteria 2082
398 Ga0316582_0404374 3300036647 Bacteria 941
399 Ga0316584_0003319 3300036712 Bacteria 10429
400 Ga0316584_0004559 3300036712 Bacteria 9179
401 Ga0316584_0008175 3300036712 Bacteria 7193
402 Ga0316584_0010547 3300036712 Bacteria 6463
403 Ga0316584_0010728 3300036712 Bacteria 6416
404 Ga0316584_0078102 3300036712 Bacteria 2479
405 Ga0316584_0133226 3300036712 Bacteria 1855
406 Ga0316584_0155307 3300036712 Bacteria 1702
407 Ga0316584_0217487 3300036712 Bacteria 1405
408 Ga0316584_0223445 3300036712 Bacteria 1382
409 Ga0316584_0311626 3300036712 Bacteria 1137
410 Ga0316584_0644380 3300036712 Unclassified 731
411 Ga0395899_0008193 3300037312 Bacteria 8051
412 Ga0395899_0088087 3300037312 Bacteria 2252
413 Ga0395899_0123826 3300037312 Bacteria 1850
414 Ga0395900_0000396 3300037418 Bacteria 62949
415 Ga0395900_0009362 3300037418 Bacteria 10044
416 Ga0395900_0017708 3300037418 Bacteria 7272
417 Ga0395900_0060291 3300037418 Bacteria 3905
418 Ga0395900_0310412 3300037418 Bacteria 1560
419 Ga0395900_0529338 3300037418 Bacteria 1125
420 Ga0395898_0007612 3300037466 Bacteria 11496
421 Ga0395898_0066793 3300037466 Bacteria 3482
422 Ga0395898_0173676 3300037466 Bacteria 2060
423 Ga0395905_0104207 3300037471 Bacteria 2663
424 Ga0395901_0084987 3300038443 Bacteria 3307
425 Ga0395901_0108002 3300038443 Bacteria 2921
426 Ga0395901_0186164 3300038443 Bacteria 2177
427 Ga0395901_0231505 3300038443 Bacteria 1929
428 Ga0395901_0432806 3300038443 Bacteria 1348
429 Ga0436361_0054021 3300039447 Bacteria 15580
430 Ga0439436_0021020 3300041404 Bacteria 1943
431 Ga0439436_0028016 3300041404 Bacteria 1645
432 Ga0439436_0041862 3300041404 Bacteria 1310
433 Ga0439465_0019807 3300041413 Bacteria 2104
434 Ga0451791_0899248 3300041451 Bacteria 1550
435 Ga0451793_0779673 3300041452 Bacteria 833
436 Ga0451802_1216571 3300041460 Bacteria 4210
437 Ga0451804_0273946 3300041463 Bacteria 909
438 Ga0451807_0125265 3300041486 Bacteria 1490
439 Ga0451807_0309351 3300041486 Bacteria 1142
440 Ga0451843_0937299 3300041509 Bacteria 3038
441 Ga0451853_2200120 3300041512 Bacteria 1502
442 Ga0439432_002171 3300042006 Bacteria 7404
443 Ga0439432_019482 3300042006 Bacteria 2260
444 Ga0439449_0002465 3300042007 Bacteria 7234
445 Ga0439449_0050398 3300042007 Bacteria 1540
446 Ga0439449_0079319 3300042007 Bacteria 1210
447 Ga0439456_002488 3300042013 Bacteria 3716
448 Ga0439463_043094 3300042016 Bacteria 1148
449 Ga0450911_013117 3300042115 Bacteria 1112
450 Ga0450911_025422 3300042115 Bacteria 768
451 Ga0450898_004210 3300042134 Bacteria 2111
452 Ga0450902_000311 3300042137 Bacteria 5871
453 Ga0450902_017535 3300042137 Bacteria 1171
454 Ga0450905_002952 3300042142 Bacteria 2217
455 Ga0439464_0035796 3300042439 Bacteria 1403
456 Ga0450901_000303 3300042533 Bacteria 6044
457 Ga0451577_0008692 3300042876 Bacteria 9855
458 Ga0451577_0076360 3300042876 Bacteria 2987
459 Ga0451577_0077718 3300042876 Bacteria 2959
460 Ga0451577_0114257 3300042876 Bacteria 2417
461 Ga0451577_0170983 3300042876 Unclassified 1958
462 Ga0451577_0248917 3300042876 Bacteria 1608
463 Ga0451577_0429540 3300042876 Bacteria 1199
464 Ga0451577_0699290 3300042876 Bacteria 918
465 Ga0453683_0022770 3300044673 Bacteria 3994
466 Ga0453684_0023479 3300044712 Bacteria 9075
467 Ga0453684_0548431 3300044712 Bacteria 1274
468 Ga0453684_0559808 3300044712 Bacteria 1258
469 Ga0466959_0001261 3300045049 Bacteria 15290
470 Ga0451576_0015411 3300045051 Bacteria 8468
471 Ga0451576_0128369 3300045051 Bacteria 2642
472 Ga0451576_0716079 3300045051 Unclassified 1051
473 Ga0495627_000152 3300046453 Bacteria 81535
474 Ga0495627_007838 3300046453 Bacteria 4059
475 Ga0495627_007952 3300046453 Bacteria 4015
476 Ga0495591_000827 3300046458 Bacteria 21897
477 Ga0495591_010352 3300046458 Bacteria 3622
478 Ga0495591_013962 3300046458 Bacteria 2910
479 Ga0495591_022796 3300046458 Bacteria 2018
480 Ga0495638_0020231 3300046460 Bacteria 4397
481 Ga0495638_0069505 3300046460 Bacteria 2158
482 Ga0495638_0098960 3300046460 Bacteria 1746
483 Ga0495638_0175430 3300046460 Bacteria 1227
484 Ga0495650_0021106 3300046471 Bacteria 3157
485 Ga0495650_0025875 3300046471 Bacteria 2740
486 Ga0495605_0000088 3300046474 Bacteria 119191
487 Ga0495605_0045745 3300046474 Bacteria 2155
488 Ga0495605_0051487 3300046474 Bacteria 2005
489 Ga0495605_0067067 3300046474 Bacteria 1703
490 Ga0495584_0050990 3300046491 Bacteria 2084
491 Ga0495585_0046471 3300046492 Bacteria 2421
492 Ga0495594_0112091 3300046499 Bacteria 1538
493 Ga0495596_0073563 3300046500 Bacteria 1327
494 Ga0495607_0033814 3300046501 Bacteria 3108
495 Ga0495607_0054139 3300046501 Bacteria 2313
496 Ga0495583_0000135 3300046506 Bacteria 123916
497 Ga0495583_0017540 3300046506 Bacteria 3796
498 Ga0495606_0027400 3300046507 Bacteria 4042
499 Ga0495606_0071235 3300046507 Bacteria 2189
500 Ga0495610_0015133 3300046512 Bacteria 4497
501 Ga0495610_0018248 3300046512 Bacteria 3969
502 Ga0495610_0026675 3300046512 Bacteria 3081
503 Ga0495610_0066035 3300046512 Bacteria 1705
504 Ga0495610_0181756 3300046512 Bacteria 874
505 Ga0495610_0188260 3300046512 Bacteria 853
506 Ga0495616_0220097 3300046513 Bacteria 827
507 Ga0495620_0000034 3300046515 Bacteria 117942
508 Ga0495620_0000450 3300046515 Bacteria 27327
509 Ga0495620_0016959 3300046515 Bacteria 3641
510 Ga0495620_0019389 3300046515 Bacteria 3346
511 Ga0495620_0040801 3300046515 Bacteria 2040
512 Ga0495630_0046527 3300046517 Bacteria 3243
513 Ga0495631_0030875 3300046518 Bacteria 2428
514 Ga0495631_0052270 3300046518 Bacteria 1784
515 Ga0495631_0291972 3300046518 Bacteria 694
516 Ga0495632_0000578 3300046519 Bacteria 33996
517 Ga0495632_0023328 3300046519 Bacteria 3305
518 Ga0495632_0155789 3300046519 Bacteria 1054
519 Ga0495637_0011562 3300046520 Bacteria 4240
520 Ga0495637_0030568 3300046520 Bacteria 2388
521 Ga0495637_0113627 3300046520 Bacteria 1047
522 Ga0495643_0001366 3300046522 Bacteria 22850
523 Ga0495643_0073894 3300046522 Bacteria 1786
524 Ga0495648_0021576 3300046524 Bacteria 4455
525 Ga0495648_0024375 3300046524 Bacteria 4122
526 Ga0495648_0066234 3300046524 Bacteria 2118
527 Ga0495663_0031671 3300046525 Bacteria 1572
528 Ga0495663_0073029 3300046525 Bacteria 1095
529 Ga0495654_0011169 3300046530 Bacteria 4874
530 Ga0495654_0012081 3300046530 Bacteria 4649
531 Ga0495654_0015779 3300046530 Bacteria 4006
532 Ga0495654_0045449 3300046530 Bacteria 2166
533 Ga0495654_0119478 3300046530 Bacteria 1194
534 Ga0495654_0178096 3300046530 Bacteria 922
535 Ga0495587_0038456 3300046536 Bacteria 2868
536 Ga0495609_0000247 3300046538 Bacteria 51172
537 Ga0495609_0026730 3300046538 Bacteria 2641
538 Ga0495609_0047382 3300046538 Bacteria 1923
539 Ga0495597_0000050 3300046542 Bacteria 98185
540 Ga0495597_0019436 3300046542 Bacteria 3179
541 Ga0495633_0000468 3300046558 Bacteria 41323
542 Ga0495633_0043664 3300046558 Bacteria 2126
543 Ga0495656_0002924 3300046615 Bacteria 5726
544 Ga0495656_0006875 3300046615 Bacteria 4000
545 Ga0495656_0016521 3300046615 Bacteria 2801
546 Ga0495656_0108296 3300046615 Bacteria 1295
547 Ga0495634_0033626 3300046642 Bacteria 3523
548 Ga0495611_0032571 3300046648 Bacteria 2297
549 Ga0495625_0145309 3300046660 Bacteria 1597
550 Ga0495635_0044746 3300046663 Bacteria 3053
551 Ga0495661_0000078 3300046665 Bacteria 119097
552 Ga0495661_0075057 3300046665 Bacteria 1965
553 Ga0495623_0111725 3300046679 Bacteria 1655
554 Ga0495670_0038487 3300046691 Bacteria 2384
555 Ga0495670_0078535 3300046691 Bacteria 1679
556 Ga0495670_0172881 3300046691 Bacteria 1138
557 Ga0495671_0072757 3300046692 Bacteria 1687
558 Ga0495649_0065648 3300046694 Bacteria 1948
559 Ga0495649_0172365 3300046694 Bacteria 1131
560 Ga0495589_0031553 3300046794 Bacteria 2666
561 Ga0495660_0011997 3300046810 Bacteria 5026
562 Ga0495660_0027659 3300046810 Bacteria 3208
563 Ga0495604_0073965 3300047317 Bacteria 2570
564 Ga0495636_0000568 3300047318 Bacteria 13596
565 Ga0495636_0055237 3300047318 Bacteria 1670
566 Ga0495636_0063315 3300047318 Bacteria 1567
567 Ga0495636_0105227 3300047318 Unclassified 1237
568 Ga0495674_0139503 3300047319 Bacteria 2038
569 Ga0495680_0079386 3300047322 Bacteria 2481
570 Ga0495683_0000108 3300047323 Bacteria 84498
571 Ga0495679_000944 3300047446 Bacteria 18097
572 Ga0495679_067878 3300047446 Bacteria 1032
573 Ga0495673_0011018 3300047469 Bacteria 4890
574 Ga0495673_0018033 3300047469 Bacteria 3570
575 Ga0495673_0031726 3300047469 Bacteria 2471
576 Ga0495681_0019250 3300047470 Bacteria 3733
577 Ga0495681_0025109 3300047470 Bacteria 3123
578 Ga0495681_0034385 3300047470 Bacteria 2526
579 Ga0495681_0114252 3300047470 Bacteria 1165
580 Ga0495686_0047547 3300047472 Bacteria 2708
581 Ga0495593_0017139 3300047673 Bacteria 4076
582 Ga0496100_0341465 3300048903 Unclassified 1129
583 Ga0496101_0216069 3300048904 Bacteria 1487
584 Ga0496102_0051425 3300048905 Bacteria 3753
585 Ga0496103_0035071 3300048906 Bacteria 3070
586 Ga0496107_0367802 3300048910 Bacteria 1070
587 Ga0496107_0727762 3300048910 Bacteria 729
588 Ga0496108_0322647 3300048911 Bacteria 1346
589 Ga0496113_0237843 3300048916 Bacteria 1453
590 Ga0496114_0007715 3300048917 Bacteria 8512
591 Ga0496114_0065411 3300048917 Bacteria 3046
592 Ga0496115_0084376 3300048918 Bacteria 2590
593 Ga0496115_0229988 3300048918 Unclassified 1529
594 Ga0496116_0054876 3300048919 Bacteria 2621
595 Ga0496116_0069835 3300048919 Bacteria 2232
596 Ga0496117_0001939 3300048920 Bacteria 27596
597 Ga0496117_0032706 3300048920 Bacteria 3948
598 Ga0496117_0061673 3300048920 Bacteria 2575
599 Ga0496117_0067095 3300048920 Bacteria 2429
600 Ga0496117_0115973 3300048920 Bacteria 1656
601 Ga0496117_0192870 3300048920 Bacteria 1158
602 Ga0496118_0000183 3300048921 Bacteria 110206
603 Ga0496118_0006923 3300048921 Bacteria 12264
604 Ga0496118_0007851 3300048921 Bacteria 11189
605 Ga0496118_0061865 3300048921 Bacteria 2768
606 Ga0496118_0079734 3300048921 Bacteria 2308
607 Ga0496118_0121677 3300048921 Bacteria 1699
608 Ga0496118_0151384 3300048921 Bacteria 1451
609 Ga0496118_0173652 3300048921 Bacteria 1312
610 Ga0496119_0000130 3300048922 Bacteria 106433
611 Ga0496119_0027855 3300048922 Bacteria 3871
612 Ga0496119_0081607 3300048922 Bacteria 1861
613 Ga0496119_0106743 3300048922 Bacteria 1562
614 Ga0496119_0204940 3300048922 Bacteria 1018
615 Ga0496120_0005328 3300048923 Bacteria 10302
616 Ga0496120_0029447 3300048923 Bacteria 3351
617 Ga0496120_0073795 3300048923 Bacteria 1865
618 Ga0496120_0088019 3300048923 Bacteria 1665
619 Ga0496121_0012278 3300048924 Bacteria 9376
620 Ga0496121_0031139 3300048924 Bacteria 4882
621 Ga0496121_0053409 3300048924 Bacteria 3385
622 Ga0496121_0055119 3300048924 Bacteria 3315
623 Ga0496121_0061803 3300048924 Bacteria 3071
624 Ga0496121_0082346 3300048924 Bacteria 2544
625 Ga0496121_0108155 3300048924 Bacteria 2127
626 Ga0496121_0131317 3300048924 Bacteria 1874
627 Ga0496121_0221315 3300048924 Bacteria 1333
628 Ga0496122_0003935 3300048925 Bacteria 18981
629 Ga0496122_0018800 3300048925 Bacteria 6355
630 Ga0496122_0086182 3300048925 Bacteria 2163
631 Ga0496122_0089975 3300048925 Bacteria 2096
632 Ga0496122_0119626 3300048925 Bacteria 1702
633 Ga0496122_0124505 3300048925 Bacteria 1653
634 Ga0496122_0178592 3300048925 Bacteria 1269
635 Ga0496123_0002092 3300048926 Bacteria 25681
636 Ga0496123_0058032 3300048926 Bacteria 2514
637 Ga0496123_0061878 3300048926 Bacteria 2402
638 Ga0496123_0073574 3300048926 Bacteria 2119
639 Ga0496123_0085420 3300048926 Bacteria 1898
640 Ga0496123_0092142 3300048926 Bacteria 1794
641 Ga0496124_0000004 3300048927 Bacteria 976131
642 Ga0496124_0000658 3300048927 Bacteria 56989
643 Ga0496124_0040787 3300048927 Bacteria 4012
644 Ga0496124_0042651 3300048927 Bacteria 3905
645 Ga0496124_0058616 3300048927 Bacteria 3237
646 Ga0496124_0073900 3300048927 Bacteria 2819
647 Ga0496124_0091823 3300048927 Bacteria 2473
648 Ga0496124_0141188 3300048927 Bacteria 1900
649 Ga0496124_0280236 3300048927 Bacteria 1216
650 Ga0496124_0331306 3300048927 Bacteria 1085
651 Ga0496124_0447722 3300048927 Bacteria 881
652 Ga0496125_0008568 3300048928 Bacteria 10681
653 Ga0496125_0033943 3300048928 Bacteria 4506
654 Ga0496125_0036932 3300048928 Bacteria 4255
655 Ga0496125_0051851 3300048928 Bacteria 3379
656 Ga0496125_0075077 3300048928 Bacteria 2618
657 Ga0496125_0087719 3300048928 Bacteria 2349
658 Ga0496125_0149824 3300048928 Bacteria 1604
659 Ga0496125_0344078 3300048928 Bacteria 893
660 Ga0496126_0072160 3300048929 Bacteria 3071
661 Ga0496126_0101104 3300048929 Bacteria 2522
662 Ga0496126_0185396 3300048929 Bacteria 1765
663 Ga0496126_0193110 3300048929 Bacteria 1723
664 Ga0496126_0222319 3300048929 Bacteria 1585
665 Ga0495678_000081 3300049459 Bacteria 118700
666 Ga0495682_0000120 3300049460 Bacteria 68718
667 Ga0495682_0025725 3300049460 Bacteria 2189
668 Ga0501031_0003171 3300049568 Bacteria 10552
669 Ga0501031_0021912 3300049568 Bacteria 4163
670 Ga0501031_0028905 3300049568 Bacteria 3614
671 Ga0501032_0086669 3300049569 Bacteria 2081
672 Ga0501032_0217537 3300049569 Bacteria 1244
673 Ga0501032_0244603 3300049569 Bacteria 1165
674 Ga0501033_0000683 3300049570 Bacteria 31408
675 Ga0501033_0001210 3300049570 Bacteria 23194
676 Ga0501033_0004171 3300049570 Bacteria 11633
677 Ga0501033_0037101 3300049570 Bacteria 3649
678 Ga0501033_0102546 3300049570 Bacteria 2087
679 Ga0501033_0129147 3300049570 Bacteria 1831
680 Ga0501033_0153969 3300049570 Bacteria 1657
681 Ga0501033_0381657 3300049570 Bacteria 984
682 Ga0501034_0000325 3300049571 Bacteria 83662
683 Ga0501034_0031276 3300049571 Bacteria 5406
684 Ga0501034_0071383 3300049571 Bacteria 3482
685 Ga0501034_0290428 3300049571 Bacteria 1573
686 Ga0501034_0314562 3300049571 Bacteria 1500
687 Ga0501034_0441955 3300049571 Bacteria 1219
688 Ga0501034_0621404 3300049571 Bacteria 984
689 Ga0501034_0777371 3300049571 Bacteria 851
690 Ga0501036_0027681 3300049572 Bacteria 4791
691 Ga0501036_0076796 3300049572 Bacteria 2826
692 Ga0501036_0277301 3300049572 Bacteria 1403
693 Ga0501037_0006686 3300049573 Bacteria 8432
694 Ga0501037_0030003 3300049573 Bacteria 4017
695 Ga0501037_0045277 3300049573 Bacteria 3230
696 Ga0501037_0247053 3300049573 Bacteria 1249
697 Ga0501037_0280683 3300049573 Bacteria 1160
698 Ga0501038_0032416 3300049574 Bacteria 4610
699 Ga0501038_0060072 3300049574 Bacteria 3254
700 Ga0501038_0063225 3300049574 Bacteria 3160
701 Ga0501038_0112856 3300049574 Bacteria 2250
702 Ga0501043_0021707 3300049579 Bacteria 5033
703 Ga0501043_0055597 3300049579 Bacteria 3109
704 Ga0501043_0055862 3300049579 Bacteria 3101
705 Ga0501043_0131236 3300049579 Bacteria 1963
706 Ga0501043_0179101 3300049579 Bacteria 1652
707 Ga0501043_0404042 3300049579 Bacteria 1032
708 Ga0501046_0040047 3300049580 Bacteria 3747
709 Ga0501046_0062908 3300049580 Bacteria 2899
710 Ga0501046_0148899 3300049580 Bacteria 1766
711 Ga0501046_0262877 3300049580 Bacteria 1267
712 Ga0501047_0043531 3300049581 Bacteria 4337
713 Ga0501047_0045001 3300049581 Bacteria 4266
714 Ga0501047_0050180 3300049581 Bacteria 4029
715 Ga0501047_0088139 3300049581 Bacteria 2980
716 Ga0501047_0155707 3300049581 Bacteria 2159
717 Ga0501047_0312368 3300049581 Bacteria 1412
718 Ga0501047_0599375 3300049581 Bacteria 923
719 Ga0501070_0015349 3300049586 Bacteria 6445
720 Ga0501070_0144596 3300049586 Bacteria 1963
721 Ga0501070_0356438 3300049586 Bacteria 1187
722 Ga0501073_0270312 3300049589 Bacteria 1173
723 Ga0501073_0512599 3300049589 Bacteria 829
724 Ga0501074_0709059 3300049590 Bacteria 710
725 Ga0501077_0088828 3300049593 Bacteria 1959
726 Ga0501235_020753 3300049669 Bacteria 1459
727 Ga0501250_013566 3300049680 Bacteria 979
728 Ga0501080_0007824 3300049742 Bacteria 9669
729 Ga0501080_0192536 3300049742 Bacteria 1874
730 Ga0501035_0005012 3300049822 Bacteria 12540
731 Ga0501035_0008708 3300049822 Bacteria 9449
732 Ga0501035_0013853 3300049822 Bacteria 7443
733 Ga0501035_0016440 3300049822 Bacteria 6825
734 Ga0501035_0044579 3300049822 Bacteria 3993
735 Ga0501035_0049900 3300049822 Bacteria 3751
736 Ga0501035_0050686 3300049822 Bacteria 3719
737 Ga0501035_0140616 3300049822 Bacteria 2099
738 Ga0501035_0412737 3300049822 Bacteria 1122
739 Ga0501035_0530788 3300049822 Bacteria 966
740 Ga0501044_0000162 3300049823 Bacteria 82725
741 Ga0501044_0001700 3300049823 Bacteria 25816
742 Ga0501044_0005271 3300049823 Bacteria 14380
743 Ga0501044_0009521 3300049823 Bacteria 10577
744 Ga0501044_0042804 3300049823 Bacteria 4708
745 Ga0501044_0090225 3300049823 Bacteria 3092
746 Ga0501044_0090995 3300049823 Bacteria 3077
747 Ga0501044_0108156 3300049823 Bacteria 2791
748 Ga0501044_0160875 3300049823 Bacteria 2222
749 Ga0501044_0266207 3300049823 Bacteria 1651
750 Ga0501044_0415913 3300049823 Bacteria 1255
751 Ga0501044_0562410 3300049823 Bacteria 1036
752 Ga0501044_0640692 3300049823 Bacteria 952
753 Ga0501045_0384267 3300049824 Bacteria 1045
754 Ga0501045_0389256 3300049824 Bacteria 1038
755 nmdc:mga00v17_1308_c1 3300050491 Bacteria 13041
756 nmdc:mga00v17_180342_c1 3300050491 Bacteria 1363
757 nmdc:mga07m45_71143_c1 3300050496 Bacteria 1979
758 nmdc:mga08y16_148230_c1 3300050511 Unclassified 2439
759 nmdc:mga08y16_330237_c1 3300050511 Unclassified 1569
760 Ga0500595_018129 3300053119 Bacteria 2581
761 Ga0500618_002180 3300053125 Bacteria 7680
762 Ga0500618_007900 3300053125 Bacteria 3004
763 Ga0500659_0066937 3300053135 Bacteria 1909

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046518 Ga0495631_0291972 Ga0495631_0291972_104_655 183
2 3300049573 Ga0501037_0045277 Ga0501037_0045277_24_614 195
3 3300049590 Ga0501074_0709059 Ga0501074_0709059_102_692 196
4 3300009036 Ga0105244_10084971 Ga0105244_100849712 199
5 3300009148 Ga0105243_10035319 Ga0105243_100353193 199
6 3300025728 Ga0207655_1056983 Ga0207655_10569832 199
7 3300025935 Ga0207709_10027997 Ga0207709_100279973 199
8 3300048920 Ga0496117_0061673 Ga0496117_0061673_1104_1892 199
9 3300049586 Ga0501070_0144596 Ga0501070_0144596_663_1316 203
10 3300031507 Ga0307509_10014264 Ga0307509_100142647 205
11 3300046471 Ga0495650_0021106 Ga0495650_0021106_2224_2856 205
12 3300046500 Ga0495596_0073563 Ga0495596_0073563_369_1001 205
13 3300046515 Ga0495620_0000450 Ga0495620_0000450_16837_17577 206
14 3300046519 Ga0495632_0000578 Ga0495632_0000578_24689_25429 206
15 3300046522 Ga0495643_0001366 Ga0495643_0001366_16896_17636 206
16 3300046524 Ga0495648_0021576 Ga0495648_0021576_1867_2607 206
17 3300046460 Ga0495638_0098960 Ga0495638_0098960_112_777 207
18 3300046460 Ga0495638_0175430 Ga0495638_0175430_265_945 207
19 3300049460 Ga0495682_0025725 Ga0495682_0025725_1066_1731 207
20 3300048922 Ga0496119_0106743 Ga0496119_0106743_472_1212 208
21 3300048924 Ga0496121_0131317 Ga0496121_0131317_746_1486 208
22 3300048927 Ga0496124_0141188 Ga0496124_0141188_298_1038 208
23 3300006058 Ga0075432_10034834 Ga0075432_100348342 209
24 3300014326 Ga0157380_10177604 Ga0157380_101776041 210
25 3300014745 Ga0157377_10564228 Ga0157377_105642281 210
26 3300025926 Ga0207659_10746209 Ga0207659_107462091 210
27 3300025938 Ga0207704_10524697 Ga0207704_105246971 210
28 3300049460 Ga0495682_0000120 Ga0495682_0000120_18210_18875 210
29 3300050511 nmdc:mga08y16_148230_c1 nmdc:mga08y16_148230_c1_173_814 210
30 3300005355 Ga0070671_100083924 Ga0070671_1000839242 212
31 3300013297 Ga0157378_10046334 Ga0157378_100463342 212
32 3300025931 Ga0207644_10125044 Ga0207644_101250443 212
33 3300046512 Ga0495610_0018248 Ga0495610_0018248_1055_1711 212
34 3300046515 Ga0495620_0016959 Ga0495620_0016959_1883_2539 212
35 3300046519 Ga0495632_0155789 Ga0495632_0155789_254_910 212
36 iso_pu_bacteria 2554235231 2555246414 212
37 iso_pu_bacteria 2912963787 2912967561 212
38 iso_pu_bacteria 2919155634 2919157406 212
39 iso_pu_bacteria 2939651529 2939653071 212
40 iso_pu_bacteria 3007252601 3007253106 212
41 iso_pu_bacteria 3007803356 3007804344 212
42 iso_pu_bacteria 8052494512 8052496064 212
43 3300005577 Ga0068857_100104147 Ga0068857_1001041472 213
44 3300009094 Ga0111539_10061200 Ga0111539_100612001 213
45 3300014325 Ga0163163_10753547 Ga0163163_107535471 213
46 3300014326 Ga0157380_10410763 Ga0157380_104107631 213
47 3300025926 Ga0207659_10732366 Ga0207659_107323661 213
48 3300047470 Ga0495681_0019250 Ga0495681_0019250_1944_2600 213
49 3300050511 nmdc:mga08y16_330237_c1 nmdc:mga08y16_330237_c1_430_1080 213
50 iso_pu_bacteria 2511231026 2511387357 213
51 iso_pu_bacteria 2857542790 2857545720 213
52 iso_pu_bacteria 2860339153 2860340776 213
53 iso_pu_bacteria 2931396565 2931403329 213
54 3300006237 Ga0097621_100147890 Ga0097621_1001478902 214
55 iso_pu_bacteria 2551306416 2553006242 214
56 iso_pu_bacteria 2554235132 2554814540 214
57 iso_pu_bacteria 2571042365 2572253433 214
58 iso_pu_bacteria 2597489888 2597863013 214
59 iso_pu_bacteria 2599185167 2599401593 214
60 iso_pu_bacteria 2599185179 2599451866 214
61 iso_pu_bacteria 2599185189 2599509634 214
62 iso_pu_bacteria 2599185190 2599514837 214
63 iso_pu_bacteria 2599185191 2599520935 214
64 iso_pu_bacteria 2599185288 2599882182 214
65 iso_pu_bacteria 2599185290 2599894366 214
66 iso_pu_bacteria 2599185303 2599951574 214
67 iso_pu_bacteria 2600254954 2600444462 214
68 iso_pu_bacteria 2600255296 2601694278 214
69 iso_pu_bacteria 2600255389 2602011547 214
70 iso_pu_bacteria 2606217733 2608381924 214
71 iso_pu_bacteria 2643221633 2644187442 214
72 iso_pu_bacteria 2643221713 2644623528 214
73 iso_pu_bacteria 2675903420 2677896850 214
74 iso_pu_bacteria 2721755607 2723247830 214
75 iso_pu_bacteria 2738541271 2738689047 214
76 iso_pu_bacteria 2738541294 2738810835 214
77 iso_pu_bacteria 2738541309 2738898195 214
78 iso_pu_bacteria 2738543016 2739264434 214
79 iso_pu_bacteria 2765235838 2765570979 214
80 iso_pu_bacteria 2808606385 2808979451 214
81 iso_pu_bacteria 2808606386 2808984849 214
82 iso_pu_bacteria 2808606388 2808995375 214
83 iso_pu_bacteria 2808606415 2809128255 214
84 iso_pu_bacteria 2808606419 2809147876 214
85 iso_pu_bacteria 2834028612 2834029661 214
86 iso_pu_bacteria 2839094727 2839099329 214
87 iso_pu_bacteria 2842826826 2842831976 214
88 iso_pu_bacteria 2842837860 2842841560 214
89 iso_pu_bacteria 2852612431 2852618458 214
90 iso_pu_bacteria 2852618963 2852620713 214
91 iso_pu_bacteria 2852667396 2852673406 214
92 iso_pu_bacteria 2855730933 2855734704 214
93 iso_pu_bacteria 2855767633 2855770488 214
94 iso_pu_bacteria 2881927736 2881931578 214
95 iso_pu_bacteria 2894414249 2894415291 214
96 iso_pu_bacteria 2894510363 2894513732 214
97 iso_pu_bacteria 2895395659 2895399032 214
98 iso_pu_bacteria 2895498888 2895499225 214
99 iso_pu_bacteria 2895511927 2895512246 214
100 iso_pu_bacteria 2895522137 2895522257 214
101 iso_pu_bacteria 2895525241 2895527300 214
102 iso_pu_bacteria 2904439833 2904443358 214
103 iso_pu_bacteria 2904530477 2904533069 214
104 iso_pu_bacteria 2904584206 2904585622 214
105 iso_pu_bacteria 2904589729 2904593971 214
106 iso_pu_bacteria 2904601388 2904603876 214
107 iso_pu_bacteria 2908446538 2908448575 214
108 iso_pu_bacteria 2919046199 2919047583 214
109 iso_pu_bacteria 2919079590 2919081886 214
110 iso_pu_bacteria 2919513703 2919516565 214
111 iso_pu_bacteria 2919675420 2919678548 214
112 iso_pu_bacteria 2923510766 2923513492 214
113 iso_pu_bacteria 2931390751 2931392728 214
114 iso_pu_bacteria 2945928738 2945928936 214
115 iso_pu_bacteria 2945961074 2945962267 214
116 iso_pu_bacteria 2946006987 2946011161 214
117 iso_pu_bacteria 2990196909 2990199053 214
118 iso_pu_bacteria 640427133 640488485 214
119 iso_pu_bacteria 651053060 651176521 214
120 iso_pu_bacteria 8034962539 8034964939 214
121 iso_pu_bacteria 8054285046 8054288176 214
122 iso_pu_bacteria 8054347763 8054352092 214
123 iso_pu_bacteria 8054503363 8054505231 214
124 iso_pu_bacteria 8055817908 8055819774 214
125 iso_pu_bacteria 8056131705 8056133558 214
126 iso_pu_bacteria 8056161164 8056164981 214
127 3300005330 Ga0070690_100150586 Ga0070690_1001505862 215
128 3300005331 Ga0070670_100019616 Ga0070670_1000196165 215
129 3300005334 Ga0068869_100115454 Ga0068869_1001154543 215
130 3300005335 Ga0070666_10471987 Ga0070666_104719872 215
131 3300005340 Ga0070689_100424543 Ga0070689_1004245432 215
132 3300005354 Ga0070675_100000292 Ga0070675_10000029210 215
133 3300005354 Ga0070675_100022809 Ga0070675_1000228092 215
134 3300005355 Ga0070671_100010060 Ga0070671_1000100602 215
135 3300005364 Ga0070673_100001571 Ga0070673_10000157110 215
136 3300005365 Ga0070688_100007205 Ga0070688_1000072056 215
137 3300005365 Ga0070688_100010533 Ga0070688_1000105335 215
138 3300005457 Ga0070662_100079179 Ga0070662_1000791793 215
139 3300005466 Ga0070685_10018927 Ga0070685_100189273 215
140 3300005543 Ga0070672_100002632 Ga0070672_1000026325 215
141 3300005548 Ga0070665_100355473 Ga0070665_1003554732 215
142 3300005564 Ga0070664_100054591 Ga0070664_1000545914 215
143 3300005617 Ga0068859_100006693 Ga0068859_1000066934 215
144 3300005617 Ga0068859_100051096 Ga0068859_1000510964 215
145 3300005843 Ga0068860_100005405 Ga0068860_1000054057 215
146 3300005844 Ga0068862_100057164 Ga0068862_1000571644 215
147 3300006237 Ga0097621_100008706 Ga0097621_1000087064 215
148 3300006358 Ga0068871_100006865 Ga0068871_1000068655 215
149 3300006931 Ga0097620_100006693 Ga0097620_1000066934 215
150 3300006931 Ga0097620_100051097 Ga0097620_1000510974 215
151 3300007788 Ga0099795_10000002 Ga0099795_1000000226 215
152 3300009094 Ga0111539_10205844 Ga0111539_102058443 215
153 3300009177 Ga0105248_10000530 Ga0105248_1000053024 215
154 3300010159 Ga0099796_10000017 Ga0099796_1000001724 215
155 3300013296 Ga0157374_10323168 Ga0157374_103231682 215
156 3300013306 Ga0163162_10002174 Ga0163162_1000217417 215
157 3300013308 Ga0157375_10000876 Ga0157375_100008761 215
158 3300014325 Ga0163163_10014069 Ga0163163_100140694 215
159 3300014968 Ga0157379_10000084 Ga0157379_1000008450 215
160 3300017792 Ga0163161_10089807 Ga0163161_100898073 215
161 3300025918 Ga0207662_10230881 Ga0207662_102308812 215
162 3300025926 Ga0207659_10002211 Ga0207659_100022118 215
163 3300025926 Ga0207659_10003140 Ga0207659_100031403 215
164 3300025926 Ga0207659_10012864 Ga0207659_100128647 215
165 3300025931 Ga0207644_10239101 Ga0207644_102391012 215
166 3300025940 Ga0207691_10031440 Ga0207691_100314402 215
167 3300025945 Ga0207679_10011336 Ga0207679_100113363 215
168 3300026035 Ga0207703_10012102 Ga0207703_100121025 215
169 3300027512 Ga0209179_1000024 Ga0209179_100002419 215
170 3300028381 Ga0268264_10029942 Ga0268264_100299423 215
171 3300031250 Ga0265331_10102939 Ga0265331_101029392 215
172 3300045049 Ga0466959_0001261 Ga0466959_0001261_5888_6541 215
173 3300047318 Ga0495636_0105227 Ga0495636_0105227_207_872 215
174 3300048921 Ga0496118_0000183 Ga0496118_0000183_22709_23362 215
175 3300049581 Ga0501047_0155707 Ga0501047_0155707_1125_1781 215
176 3300049589 Ga0501073_0270312 Ga0501073_0270312_227_943 215
177 3300049742 Ga0501080_0007824 Ga0501080_0007824_6647_7363 215
178 3300050491 nmdc:mga00v17_180342_c1 nmdc:mga00v17_180342_c1_315_965 215
179 3300053119 Ga0500595_018129 Ga0500595_018129_199_864 215
180 3300005289 Ga0065704_10125447 Ga0065704_101254472 216
181 3300006058 Ga0075432_10091504 Ga0075432_100915042 216
182 3300009011 Ga0105251_10208169 Ga0105251_102081692 216
183 3300009036 Ga0105244_10018125 Ga0105244_100181252 216
184 3300009036 Ga0105244_10023700 Ga0105244_100237002 216
185 3300009036 Ga0105244_10074517 Ga0105244_100745172 216
186 3300009092 Ga0105250_10044287 Ga0105250_100442872 216
187 3300009092 Ga0105250_10161435 Ga0105250_101614352 216
188 3300009148 Ga0105243_10068799 Ga0105243_100687992 216
189 3300013102 Ga0157371_10081826 Ga0157371_100818262 216
190 3300025292 Ga0209676_1002024 Ga0209676_100202411 216
191 3300025711 Ga0207696_1000019 Ga0207696_1000019120 216
192 3300025711 Ga0207696_1008253 Ga0207696_10082533 216
193 3300025728 Ga0207655_1000614 Ga0207655_100061411 216
194 3300025735 Ga0207713_1009283 Ga0207713_10092833 216
195 3300025735 Ga0207713_1019125 Ga0207713_10191252 216
196 3300025935 Ga0207709_10051919 Ga0207709_100519193 216
197 3300027296 Ga0209389_1000037 Ga0209389_100003722 216
198 3300031247 Ga0265340_10190618 Ga0265340_101906182 216
199 3300036401 Ga0373937_0092457 Ga0373937_0092457_2013_2678 216
200 3300036401 Ga0373937_0529841 Ga0373937_0529841_228_884 216
201 3300042013 Ga0439456_002488 Ga0439456_002488_1962_2612 216
202 3300042137 Ga0450902_000311 Ga0450902_000311_4740_5450 216
203 3300042137 Ga0450902_017535 Ga0450902_017535_304_954 216
204 3300042142 Ga0450905_002952 Ga0450905_002952_1010_1660 216
205 3300042439 Ga0439464_0035796 Ga0439464_0035796_587_1237 216
206 3300042533 Ga0450901_000303 Ga0450901_000303_869_1579 216
207 3300046515 Ga0495620_0040801 Ga0495620_0040801_1012_1662 216
208 3300046524 Ga0495648_0066234 Ga0495648_0066234_442_1095 216
209 3300048917 Ga0496114_0065411 Ga0496114_0065411_505_1155 216
210 3300048920 Ga0496117_0001939 Ga0496117_0001939_493_1233 216
211 3300048921 Ga0496118_0006923 Ga0496118_0006923_9892_10632 216
212 3300048921 Ga0496118_0007851 Ga0496118_0007851_10149_10799 216
213 3300048922 Ga0496119_0000130 Ga0496119_0000130_35158_35808 216
214 3300048923 Ga0496120_0005328 Ga0496120_0005328_7700_8350 216
215 3300048924 Ga0496121_0055119 Ga0496121_0055119_864_1514 216
216 3300048924 Ga0496121_0108155 Ga0496121_0108155_1006_1656 216
217 3300048925 Ga0496122_0003935 Ga0496122_0003935_8062_8712 216
218 3300048925 Ga0496122_0089975 Ga0496122_0089975_1053_1703 216
219 3300048926 Ga0496123_0002092 Ga0496123_0002092_17319_17969 216
220 3300048926 Ga0496123_0058032 Ga0496123_0058032_1039_1689 216
221 3300048927 Ga0496124_0040787 Ga0496124_0040787_1929_2579 216
222 3300048927 Ga0496124_0073900 Ga0496124_0073900_1542_2192 216
223 3300048927 Ga0496124_0447722 Ga0496124_0447722_30_818 216
224 3300048928 Ga0496125_0008568 Ga0496125_0008568_7481_8221 216
225 3300048928 Ga0496125_0075077 Ga0496125_0075077_909_1559 216
226 3300048929 Ga0496126_0101104 Ga0496126_0101104_138_878 216
227 3300048929 Ga0496126_0185396 Ga0496126_0185396_302_952 216
228 3300049571 Ga0501034_0000325 Ga0501034_0000325_6226_6876 216
229 3300049580 Ga0501046_0148899 Ga0501046_0148899_996_1646 216
230 3300049823 Ga0501044_0640692 Ga0501044_0640692_36_686 216
231 3300053135 Ga0500659_0066937 Ga0500659_0066937_914_1564 216
232 3300003323 rootH1_10045656 rootH1_100456562 217
233 3300005539 Ga0068853_100079556 Ga0068853_1000795562 217
234 3300006946 Ga0079104_1004393 Ga0079104_10043935 217
235 3300009011 Ga0105251_10003076 Ga0105251_1000307610 217
236 3300009092 Ga0105250_10001554 Ga0105250_1000155410 217
237 3300013102 Ga0157371_10049940 Ga0157371_100499402 217
238 3300013104 Ga0157370_10230410 Ga0157370_102304102 217
239 3300025711 Ga0207696_1000191 Ga0207696_100019114 217
240 3300025735 Ga0207713_1000166 Ga0207713_100016612 217
241 3300027111 Ga0209281_1003625 Ga0209281_10036252 217
242 3300030731 Ga0316177_1063096 Ga0316177_10630962 217
243 3300037418 Ga0395900_0310412 Ga0395900_0310412_64_720 217
244 3300038443 Ga0395901_0231505 Ga0395901_0231505_871_1527 217
245 3300041404 Ga0439436_0041862 Ga0439436_0041862_161_817 217
246 3300041486 Ga0451807_0125265 Ga0451807_0125265_152_808 217
247 3300041512 Ga0451853_2200120 Ga0451853_2200120_522_1178 217
248 3300042007 Ga0439449_0050398 Ga0439449_0050398_76_729 217
249 3300042876 Ga0451577_0699290 Ga0451577_0699290_130_789 217
250 3300046474 Ga0495605_0045745 Ga0495605_0045745_350_1003 217
251 3300046517 Ga0495630_0046527 Ga0495630_0046527_1624_2277 217
252 3300046536 Ga0495587_0038456 Ga0495587_0038456_1233_1886 217
253 3300046642 Ga0495634_0033626 Ga0495634_0033626_1886_2539 217
254 3300046663 Ga0495635_0044746 Ga0495635_0044746_1808_2461 217
255 3300046679 Ga0495623_0111725 Ga0495623_0111725_956_1609 217
256 3300047317 Ga0495604_0073965 Ga0495604_0073965_941_1594 217
257 3300047319 Ga0495674_0139503 Ga0495674_0139503_1366_2019 217
258 3300047322 Ga0495680_0079386 Ga0495680_0079386_1182_1835 217
259 3300047469 Ga0495673_0018033 Ga0495673_0018033_1986_2639 217
260 3300047673 Ga0495593_0017139 Ga0495593_0017139_1375_2028 217
261 3300048905 Ga0496102_0051425 Ga0496102_0051425_1290_1943 217
262 3300048906 Ga0496103_0035071 Ga0496103_0035071_1738_2391 217
263 3300048918 Ga0496115_0084376 Ga0496115_0084376_1731_2384 217
264 3300048919 Ga0496116_0069835 Ga0496116_0069835_1019_1672 217
265 3300048921 Ga0496118_0061865 Ga0496118_0061865_716_1369 217
266 3300048924 Ga0496121_0082346 Ga0496121_0082346_1817_2470 217
267 3300048927 Ga0496124_0000004 Ga0496124_0000004_178031_178690 217
268 3300049568 Ga0501031_0003171 Ga0501031_0003171_6199_6855 217
269 3300049570 Ga0501033_0001210 Ga0501033_0001210_21385_22038 217
270 3300049570 Ga0501033_0004171 Ga0501033_0004171_9934_10590 217
271 3300049570 Ga0501033_0381657 Ga0501033_0381657_253_909 217
272 3300049571 Ga0501034_0031276 Ga0501034_0031276_1044_1700 217
273 3300049571 Ga0501034_0777371 Ga0501034_0777371_161_814 217
274 3300049573 Ga0501037_0030003 Ga0501037_0030003_1139_1795 217
275 3300049574 Ga0501038_0063225 Ga0501038_0063225_1408_2064 217
276 3300049579 Ga0501043_0055597 Ga0501043_0055597_1297_1953 217
277 3300049580 Ga0501046_0040047 Ga0501046_0040047_1409_2065 217
278 3300049581 Ga0501047_0088139 Ga0501047_0088139_1281_1937 217
279 3300049822 Ga0501035_0412737 Ga0501035_0412737_231_893 217
280 3300049823 Ga0501044_0090225 Ga0501044_0090225_1029_1685 217
281 3300050496 nmdc:mga07m45_71143_c1 nmdc:mga07m45_71143_c1_462_1121 217
282 3300002737 JGI25162J39368_1006336 JGI25162J39368_10063362 218
283 3300002772 JGI25164J39214_1000421 JGI25164J39214_10004214 218
284 3300003214 JGI25165J46597_1015099 JGI25165J46597_10150992 218
285 3300003320 rootH2_10073649 rootH2_100736492 218
286 3300003751 Ga0055538_1000141 Ga0055538_100014137 218
287 3300003752 Ga0055539_1000134 Ga0055539_100013441 218
288 3300003752 Ga0055539_1000192 Ga0055539_100019237 218
289 3300003756 Ga0055533_1000138 Ga0055533_100013841 218
290 3300003756 Ga0055533_1000192 Ga0055533_100019237 218
291 3300003758 Ga0055532_1000142 Ga0055532_100014241 218
292 3300003759 Ga0055525_1000183 Ga0055525_100018341 218
293 3300003759 Ga0055525_1000260 Ga0055525_100026013 218
294 3300003761 Ga0055535_1009015 Ga0055535_10090152 218
295 3300003763 Ga0055529_1001465 Ga0055529_10014654 218
296 3300003781 Ga0055536_1006580 Ga0055536_10065803 218
297 3300003794 Ga0055531_10013344 Ga0055531_100133442 218
298 3300003841 Ga0055541_1000089 Ga0055541_100008941 218
299 3300003841 Ga0055541_1000127 Ga0055541_100012737 218
300 3300005288 Ga0065714_10004793 Ga0065714_100047932 218
301 3300005288 Ga0065714_10010006 Ga0065714_100100062 218
302 3300005289 Ga0065704_10117506 Ga0065704_101175061 218
303 3300005289 Ga0065704_10297990 Ga0065704_102979901 218
304 3300005293 Ga0065715_10191057 Ga0065715_101910572 218
305 3300005327 Ga0070658_10106431 Ga0070658_101064312 218
306 3300005327 Ga0070658_11123616 Ga0070658_111236161 218
307 3300005331 Ga0070670_100063254 Ga0070670_1000632543 218
308 3300005331 Ga0070670_100080503 Ga0070670_1000805033 218
309 3300005336 Ga0070680_100213575 Ga0070680_1002135752 218
310 3300005336 Ga0070680_100290896 Ga0070680_1002908962 218
311 3300005339 Ga0070660_100062431 Ga0070660_1000624312 218
312 3300005339 Ga0070660_100078446 Ga0070660_1000784461 218
313 3300005339 Ga0070660_100160873 Ga0070660_1001608732 218
314 3300005341 Ga0070691_10038752 Ga0070691_100387522 218
315 3300005344 Ga0070661_100000029 Ga0070661_1000000293 218
316 3300005353 Ga0070669_100000316 Ga0070669_10000031635 218
317 3300005353 Ga0070669_100284249 Ga0070669_1002842491 218
318 3300005355 Ga0070671_100193137 Ga0070671_1001931372 218
319 3300005356 Ga0070674_100243978 Ga0070674_1002439782 218
320 3300005364 Ga0070673_100198282 Ga0070673_1001982822 218
321 3300005366 Ga0070659_100021330 Ga0070659_1000213303 218
322 3300005366 Ga0070659_100058659 Ga0070659_1000586592 218
323 3300005366 Ga0070659_100102032 Ga0070659_1001020322 218
324 3300005366 Ga0070659_100991625 Ga0070659_1009916251 218
325 3300005434 Ga0070709_10737823 Ga0070709_107378231 218
326 3300005435 Ga0070714_100000439 Ga0070714_1000004393 218
327 3300005437 Ga0070710_10174017 Ga0070710_101740172 218
328 3300005444 Ga0070694_100130410 Ga0070694_1001304103 218
329 3300005455 Ga0070663_100504945 Ga0070663_1005049451 218
330 3300005457 Ga0070662_100001079 Ga0070662_10000107914 218
331 3300005458 Ga0070681_10000122 Ga0070681_1000012248 218
332 3300005458 Ga0070681_10150461 Ga0070681_101504612 218
333 3300005458 Ga0070681_10181002 Ga0070681_101810023 218
334 3300005459 Ga0068867_100056297 Ga0068867_1000562972 218
335 3300005530 Ga0070679_100046779 Ga0070679_1000467795 218
336 3300005530 Ga0070679_100125107 Ga0070679_1001251073 218
337 3300005530 Ga0070679_100203184 Ga0070679_1002031842 218
338 3300005530 Ga0070679_100500581 Ga0070679_1005005812 218
339 3300005539 Ga0068853_100033679 Ga0068853_1000336792 218
340 3300005539 Ga0068853_100034758 Ga0068853_1000347583 218
341 3300005543 Ga0070672_100005875 Ga0070672_1000058756 218
342 3300005543 Ga0070672_100029504 Ga0070672_1000295042 218
343 3300005546 Ga0070696_100015274 Ga0070696_1000152742 218
344 3300005547 Ga0070693_100041808 Ga0070693_1000418084 218
345 3300005563 Ga0068855_100000651 Ga0068855_10000065130 218
346 3300005563 Ga0068855_100036971 Ga0068855_1000369717 218
347 3300005563 Ga0068855_100076888 Ga0068855_1000768882 218
348 3300005563 Ga0068855_100127016 Ga0068855_1001270163 218
349 3300005577 Ga0068857_100102455 Ga0068857_1001024552 218
350 3300005578 Ga0068854_100021927 Ga0068854_1000219273 218
351 3300005578 Ga0068854_100244340 Ga0068854_1002443402 218
352 3300005834 Ga0068851_10000050 Ga0068851_1000005017 218
353 3300006051 Ga0075364_10001303 Ga0075364_100013036 218
354 3300006051 Ga0075364_10126192 Ga0075364_101261922 218
355 3300009011 Ga0105251_10003160 Ga0105251_1000316012 218
356 3300009011 Ga0105251_10011010 Ga0105251_100110103 218
357 3300009011 Ga0105251_10011378 Ga0105251_100113783 218
358 3300009011 Ga0105251_10016935 Ga0105251_100169353 218
359 3300009011 Ga0105251_10019280 Ga0105251_100192802 218
360 3300009011 Ga0105251_10055081 Ga0105251_100550812 218
361 3300009036 Ga0105244_10027086 Ga0105244_100270863 218
362 3300009092 Ga0105250_10000319 Ga0105250_100003194 218
363 3300009093 Ga0105240_10037357 Ga0105240_100373573 218
364 3300009176 Ga0105242_10289139 Ga0105242_102891392 218
365 3300009177 Ga0105248_10110797 Ga0105248_101107973 218
366 3300009545 Ga0105237_10004758 Ga0105237_1000475811 218
367 3300009551 Ga0105238_10000006 Ga0105238_10000006257 218
368 3300009551 Ga0105238_10108385 Ga0105238_101083852 218
369 3300009551 Ga0105238_10177113 Ga0105238_101771132 218
370 3300010375 Ga0105239_10037141 Ga0105239_100371413 218
371 3300012488 Ga0157343_1001722 Ga0157343_10017221 218
372 3300013100 Ga0157373_10007084 Ga0157373_100070846 218
373 3300013100 Ga0157373_10051241 Ga0157373_100512412 218
374 3300013100 Ga0157373_10062624 Ga0157373_100626243 218
375 3300013100 Ga0157373_10147481 Ga0157373_101474812 218
376 3300013100 Ga0157373_10154374 Ga0157373_101543742 218
377 3300013100 Ga0157373_10345309 Ga0157373_103453091 218
378 3300013102 Ga0157371_10001274 Ga0157371_1000127423 218
379 3300013102 Ga0157371_10045728 Ga0157371_100457282 218
380 3300013104 Ga0157370_10021678 Ga0157370_100216785 218
381 3300013104 Ga0157370_10172186 Ga0157370_101721862 218
382 3300013104 Ga0157370_10271459 Ga0157370_102714592 218
383 3300013105 Ga0157369_10009316 Ga0157369_1000931610 218
384 3300013105 Ga0157369_10070491 Ga0157369_100704914 218
385 3300013105 Ga0157369_10094848 Ga0157369_100948482 218
386 3300013105 Ga0157369_10180466 Ga0157369_101804663 218
387 3300013296 Ga0157374_10068556 Ga0157374_100685561 218
388 3300013306 Ga0163162_10084203 Ga0163162_100842032 218
389 3300013307 Ga0157372_10035376 Ga0157372_100353766 218
390 3300013307 Ga0157372_10254085 Ga0157372_102540852 218
391 3300013307 Ga0157372_10477907 Ga0157372_104779072 218
392 3300013307 Ga0157372_10719518 Ga0157372_107195181 218
393 3300013308 Ga0157375_10013741 Ga0157375_100137414 218
394 3300013308 Ga0157375_10318207 Ga0157375_103182072 218
395 3300013308 Ga0157375_10348151 Ga0157375_103481512 218
396 3300014497 Ga0182008_10020662 Ga0182008_100206623 218
397 3300014497 Ga0182008_10026957 Ga0182008_100269571 218
398 3300014497 Ga0182008_10032622 Ga0182008_100326222 218
399 3300014497 Ga0182008_10033434 Ga0182008_100334343 218
400 3300014969 Ga0157376_10026920 Ga0157376_100269205 218
401 3300015261 Ga0182006_1001091 Ga0182006_100109117 218
402 3300015262 Ga0182007_10024101 Ga0182007_100241012 218
403 3300015262 Ga0182007_10028919 Ga0182007_100289192 218
404 3300015262 Ga0182007_10066083 Ga0182007_100660832 218
405 3300015685 Ga0183369_1003 Ga0183369_100353 218
406 3300017792 Ga0163161_10073587 Ga0163161_100735872 218
407 3300017792 Ga0163161_10139001 Ga0163161_101390012 218
408 3300020081 Ga0206354_10029098 Ga0206354_100290981 218
409 3300021361 Ga0213872_10002881 Ga0213872_100028813 218
410 3300025224 Ga0209784_100009 Ga0209784_100009551 218
411 3300025224 Ga0209784_100040 Ga0209784_100040188 218
412 3300025225 Ga0209566_100007 Ga0209566_100007551 218
413 3300025225 Ga0209566_100051 Ga0209566_100051188 218
414 3300025226 Ga0209674_100018 Ga0209674_100018551 218
415 3300025226 Ga0209674_100072 Ga0209674_100072188 218
416 3300025229 Ga0209147_100067 Ga0209147_100067188 218
417 3300025230 Ga0209563_100020 Ga0209563_100020551 218
418 3300025230 Ga0209563_100073 Ga0209563_100073188 218
419 3300025231 Ga0207427_100049 Ga0207427_100049197 218
420 3300025233 Ga0209437_100083 Ga0209437_10008344 218
421 3300025242 Ga0209258_100585 Ga0209258_1005853 218
422 3300025246 Ga0209646_1000575 Ga0209646_100057512 218
423 3300025253 Ga0209677_100010 Ga0209677_100010551 218
424 3300025253 Ga0209677_100121 Ga0209677_10012141 218
425 3300025261 Ga0209233_1000075 Ga0209233_1000075279 218
426 3300025291 Ga0209675_1008687 Ga0209675_10086872 218
427 3300025292 Ga0209676_1000891 Ga0209676_100089124 218
428 3300025294 Ga0209025_1016319 Ga0209025_10163193 218
429 3300025294 Ga0209025_1133987 Ga0209025_11339871 218
430 3300025298 Ga0209050_1022212 Ga0209050_10222122 218
431 3300025304 Ga0209257_1000180 Ga0209257_10001809 218
432 3300025321 Ga0207656_10000235 Ga0207656_100002353 218
433 3300025711 Ga0207696_1000171 Ga0207696_100017166 218
434 3300025728 Ga0207655_1000035 Ga0207655_100003540 218
435 3300025735 Ga0207713_1000173 Ga0207713_100017310 218
436 3300025735 Ga0207713_1002517 Ga0207713_100251710 218
437 3300025735 Ga0207713_1007526 Ga0207713_10075263 218
438 3300025735 Ga0207713_1009510 Ga0207713_10095103 218
439 3300025735 Ga0207713_1021048 Ga0207713_10210483 218
440 3300025735 Ga0207713_1043939 Ga0207713_10439392 218
441 3300025898 Ga0207692_10141484 Ga0207692_101414842 218
442 3300025909 Ga0207705_10123947 Ga0207705_101239471 218
443 3300025909 Ga0207705_10128389 Ga0207705_101283892 218
444 3300025912 Ga0207707_10000310 Ga0207707_1000031043 218
445 3300025912 Ga0207707_10033751 Ga0207707_100337514 218
446 3300025912 Ga0207707_10235982 Ga0207707_102359822 218
447 3300025912 Ga0207707_10597336 Ga0207707_105973362 218
448 3300025913 Ga0207695_10003954 Ga0207695_1000395415 218
449 3300025914 Ga0207671_10002838 Ga0207671_100028383 218
450 3300025917 Ga0207660_10113778 Ga0207660_101137782 218
451 3300025917 Ga0207660_10312036 Ga0207660_103120362 218
452 3300025919 Ga0207657_10024061 Ga0207657_100240615 218
453 3300025919 Ga0207657_10029629 Ga0207657_100296294 218
454 3300025919 Ga0207657_10051681 Ga0207657_100516814 218
455 3300025921 Ga0207652_10017245 Ga0207652_100172456 218
456 3300025921 Ga0207652_10407264 Ga0207652_104072641 218
457 3300025923 Ga0207681_10000491 Ga0207681_100004915 218
458 3300025924 Ga0207694_10000110 Ga0207694_1000011028 218
459 3300025924 Ga0207694_10196036 Ga0207694_101960362 218
460 3300025925 Ga0207650_10000174 Ga0207650_1000017461 218
461 3300025925 Ga0207650_10033727 Ga0207650_100337273 218
462 3300025926 Ga0207659_10309181 Ga0207659_103091812 218
463 3300025929 Ga0207664_10003938 Ga0207664_100039384 218
464 3300025932 Ga0207690_10002939 Ga0207690_100029394 218
465 3300025932 Ga0207690_10024721 Ga0207690_100247214 218
466 3300025933 Ga0207706_10002445 Ga0207706_100024452 218
467 3300025937 Ga0207669_10183917 Ga0207669_101839172 218
468 3300025940 Ga0207691_10017313 Ga0207691_100173135 218
469 3300025940 Ga0207691_10031677 Ga0207691_100316773 218
470 3300025941 Ga0207711_10151337 Ga0207711_101513372 218
471 3300025945 Ga0207679_10149977 Ga0207679_101499772 218
472 3300025949 Ga0207667_10000120 Ga0207667_1000012012 218
473 3300025949 Ga0207667_10049964 Ga0207667_100499645 218
474 3300025949 Ga0207667_10114060 Ga0207667_101140603 218
475 3300025972 Ga0207668_10085836 Ga0207668_100858362 218
476 3300026041 Ga0207639_10003873 Ga0207639_100038739 218
477 3300026041 Ga0207639_10012151 Ga0207639_100121513 218
478 3300026067 Ga0207678_10578362 Ga0207678_105783621 218
479 3300026089 Ga0207648_10038161 Ga0207648_100381612 218
480 3300026095 Ga0207676_10234177 Ga0207676_102341771 218
481 3300026116 Ga0207674_10031883 Ga0207674_100318833 218
482 3300026116 Ga0207674_10063737 Ga0207674_100637376 218
483 3300026142 Ga0207698_10349682 Ga0207698_103496821 218
484 3300027424 Ga0209984_1006779 Ga0209984_10067792 218
485 3300027552 Ga0209982_1001893 Ga0209982_10018932 218
486 3300027665 Ga0209983_1001409 Ga0209983_10014096 218
487 3300027665 Ga0209983_1017829 Ga0209983_10178292 218
488 3300027682 Ga0209971_1000854 Ga0209971_10008546 218
489 3300027876 Ga0209974_10003051 Ga0209974_100030513 218
490 3300027876 Ga0209974_10092894 Ga0209974_100928942 218
491 3300028379 Ga0268266_10353131 Ga0268266_103531312 218
492 3300028794 Ga0307515_10211654 Ga0307515_102116541 218
493 3300030745 Ga0316182_1080836 Ga0316182_10808362 218
494 3300031239 Ga0265328_10005946 Ga0265328_100059465 218
495 3300031250 Ga0265331_10000138 Ga0265331_1000013816 218
496 3300031250 Ga0265331_10028049 Ga0265331_100280492 218
497 3300031251 Ga0265327_10000299 Ga0265327_1000029978 218
498 3300031251 Ga0265327_10011689 Ga0265327_100116896 218
499 3300031456 Ga0307513_10011784 Ga0307513_100117842 218
500 3300031456 Ga0307513_10130008 Ga0307513_101300082 218
501 3300031548 Ga0307408_100519480 Ga0307408_1005194802 218
502 3300031665 Ga0316575_10002178 Ga0316575_100021784 218
503 3300031665 Ga0316575_10053165 Ga0316575_100531652 218
504 3300031665 Ga0316575_10115968 Ga0316575_101159682 218
505 3300031665 Ga0316575_10217424 Ga0316575_102174241 218
506 3300031691 Ga0316579_10006228 Ga0316579_100062283 218
507 3300031691 Ga0316579_10080796 Ga0316579_100807962 218
508 3300031691 Ga0316579_10101258 Ga0316579_101012582 218
509 3300031691 Ga0316579_10113393 Ga0316579_101133932 218
510 3300031691 Ga0316579_10162846 Ga0316579_101628461 218
511 3300031691 Ga0316579_10268748 Ga0316579_102687481 218
512 3300031691 Ga0316579_10284286 Ga0316579_102842861 218
513 3300031727 Ga0316576_10002007 Ga0316576_100020077 218
514 3300031727 Ga0316576_10033272 Ga0316576_100332723 218
515 3300031727 Ga0316576_10054937 Ga0316576_100549372 218
516 3300031727 Ga0316576_10055448 Ga0316576_100554483 218
517 3300031727 Ga0316576_10057837 Ga0316576_100578373 218
518 3300031727 Ga0316576_10109338 Ga0316576_101093382 218
519 3300031727 Ga0316576_10133579 Ga0316576_101335792 218
520 3300031727 Ga0316576_10183899 Ga0316576_101838992 218
521 3300031728 Ga0316578_10000355 Ga0316578_1000035514 218
522 3300031728 Ga0316578_10000750 Ga0316578_100007509 218
523 3300031728 Ga0316578_10003780 Ga0316578_100037806 218
524 3300031728 Ga0316578_10034817 Ga0316578_100348172 218
525 3300031728 Ga0316578_10035569 Ga0316578_100355691 218
526 3300031728 Ga0316578_10053223 Ga0316578_100532234 218
527 3300031728 Ga0316578_10067463 Ga0316578_100674632 218
528 3300031728 Ga0316578_10100615 Ga0316578_101006153 218
529 3300031731 Ga0307405_10056530 Ga0307405_100565303 218
530 3300031731 Ga0307405_10283396 Ga0307405_102833961 218
531 3300031733 Ga0316577_10019867 Ga0316577_100198672 218
532 3300031733 Ga0316577_10046641 Ga0316577_100466411 218
533 3300031733 Ga0316577_10062082 Ga0316577_100620822 218
534 3300031733 Ga0316577_10116922 Ga0316577_101169223 218
535 3300031824 Ga0307413_10000289 Ga0307413_100002895 218
536 3300031824 Ga0307413_10442498 Ga0307413_104424982 218
537 3300031911 Ga0307412_10245541 Ga0307412_102455411 218
538 3300031911 Ga0307412_10270504 Ga0307412_102705042 218
539 3300031995 Ga0307409_100946664 Ga0307409_1009466642 218
540 3300032004 Ga0307414_10003488 Ga0307414_100034882 218
541 3300032004 Ga0307414_10020803 Ga0307414_100208035 218
542 3300032004 Ga0307414_10234978 Ga0307414_102349782 218
543 3300032004 Ga0307414_10442546 Ga0307414_104425462 218
544 3300032004 Ga0307414_10784114 Ga0307414_107841141 218
545 3300032004 Ga0307414_11021017 Ga0307414_110210171 218
546 3300032005 Ga0307411_10793140 Ga0307411_107931401 218
547 3300032126 Ga0307415_100530263 Ga0307415_1005302632 218
548 3300032133 Ga0316583_10005875 Ga0316583_100058754 218
549 3300032133 Ga0316583_10023784 Ga0316583_100237842 218
550 3300032133 Ga0316583_10066017 Ga0316583_100660172 218
551 3300032133 Ga0316583_10132983 Ga0316583_101329832 218
552 3300032133 Ga0316583_10145219 Ga0316583_101452191 218
553 3300032137 Ga0316585_10012810 Ga0316585_100128101 218
554 3300032137 Ga0316585_10016266 Ga0316585_100162662 218
555 3300032137 Ga0316585_10053025 Ga0316585_100530252 218
556 3300032137 Ga0316585_10096263 Ga0316585_100962632 218
557 3300032139 Ga0316580_10002337 Ga0316580_100023371 218
558 3300032139 Ga0316580_10016466 Ga0316580_100164663 218
559 3300032139 Ga0316580_10017836 Ga0316580_100178362 218
560 3300032139 Ga0316580_10122293 Ga0316580_101222931 218
561 3300032168 Ga0316593_10000460 Ga0316593_100004602 218
562 3300032168 Ga0316593_10016799 Ga0316593_100167993 218
563 3300032168 Ga0316593_10019164 Ga0316593_100191641 218
564 3300032168 Ga0316593_10021839 Ga0316593_100218392 218
565 3300033524 Ga0316592_1003346 Ga0316592_10033463 218
566 3300033541 Ga0316596_1004284 Ga0316596_10042843 218
567 3300033541 Ga0316596_1013151 Ga0316596_10131512 218
568 3300035398 Ga0316574_0004485 Ga0316574_0004485_5427_6146 218
569 3300035398 Ga0316574_0020422 Ga0316574_0020422_2352_3008 218
570 3300035398 Ga0316574_0041419 Ga0316574_0041419_1097_1762 218
571 3300035398 Ga0316574_0055978 Ga0316574_0055978_799_1470 218
572 3300035398 Ga0316574_0130892 Ga0316574_0130892_921_1589 218
573 3300035398 Ga0316574_0136143 Ga0316574_0136143_175_831 218
574 3300035398 Ga0316574_0160823 Ga0316574_0160823_468_1223 218
575 3300035398 Ga0316574_0230902 Ga0316574_0230902_189_848 218
576 3300036647 Ga0316582_0004837 Ga0316582_0004837_262_918 218
577 3300036647 Ga0316582_0007864 Ga0316582_0007864_1727_2482 218
578 3300036647 Ga0316582_0017707 Ga0316582_0017707_192_848 218
579 3300036647 Ga0316582_0025344 Ga0316582_0025344_1297_1956 218
580 3300036647 Ga0316582_0028543 Ga0316582_0028543_2099_2818 218
581 3300036647 Ga0316582_0049248 Ga0316582_0049248_1772_2443 218
582 3300036647 Ga0316582_0084178 Ga0316582_0084178_316_972 218
583 3300036647 Ga0316582_0404374 Ga0316582_0404374_79_741 218
584 3300036712 Ga0316584_0003319 Ga0316584_0003319_4556_5284 218
585 3300036712 Ga0316584_0004559 Ga0316584_0004559_4778_5449 218
586 3300036712 Ga0316584_0008175 Ga0316584_0008175_5765_6421 218
587 3300036712 Ga0316584_0010547 Ga0316584_0010547_1238_1894 218
588 3300036712 Ga0316584_0010728 Ga0316584_0010728_4739_5410 218
589 3300036712 Ga0316584_0078102 Ga0316584_0078102_842_1498 218
590 3300036712 Ga0316584_0133226 Ga0316584_0133226_913_1632 218
591 3300036712 Ga0316584_0155307 Ga0316584_0155307_406_1062 218
592 3300036712 Ga0316584_0217487 Ga0316584_0217487_668_1324 218
593 3300036712 Ga0316584_0223445 Ga0316584_0223445_431_1096 218
594 3300036712 Ga0316584_0311626 Ga0316584_0311626_27_782 218
595 3300036712 Ga0316584_0644380 Ga0316584_0644380_59_715 218
596 3300037312 Ga0395899_0008193 Ga0395899_0008193_634_1293 218
597 3300037312 Ga0395899_0088087 Ga0395899_0088087_842_1501 218
598 3300037312 Ga0395899_0123826 Ga0395899_0123826_1122_1778 218
599 3300037418 Ga0395900_0000396 Ga0395900_0000396_61953_62615 218
600 3300037418 Ga0395900_0009362 Ga0395900_0009362_8988_9647 218
601 3300037418 Ga0395900_0017708 Ga0395900_0017708_1514_2173 218
602 3300037418 Ga0395900_0060291 Ga0395900_0060291_2170_2826 218
603 3300037418 Ga0395900_0529338 Ga0395900_0529338_51_710 218
604 3300037466 Ga0395898_0007612 Ga0395898_0007612_2346_3005 218
605 3300037466 Ga0395898_0066793 Ga0395898_0066793_563_1222 218
606 3300037466 Ga0395898_0173676 Ga0395898_0173676_948_1604 218
607 3300037471 Ga0395905_0104207 Ga0395905_0104207_189_845 218
608 3300038443 Ga0395901_0084987 Ga0395901_0084987_2408_3067 218
609 3300038443 Ga0395901_0108002 Ga0395901_0108002_1715_2374 218
610 3300038443 Ga0395901_0186164 Ga0395901_0186164_1263_1922 218
611 3300038443 Ga0395901_0432806 Ga0395901_0432806_109_765 218
612 3300039447 Ga0436361_0054021 Ga0436361_0054021_6647_7306 218
613 3300041404 Ga0439436_0021020 Ga0439436_0021020_1227_1886 218
614 3300041404 Ga0439436_0028016 Ga0439436_0028016_155_841 218
615 3300041413 Ga0439465_0019807 Ga0439465_0019807_1109_1768 218
616 3300041451 Ga0451791_0899248 Ga0451791_0899248_31_738 218
617 3300041452 Ga0451793_0779673 Ga0451793_0779673_104_811 218
618 3300041460 Ga0451802_1216571 Ga0451802_1216571_847_1503 218
619 3300041463 Ga0451804_0273946 Ga0451804_0273946_130_786 218
620 3300041486 Ga0451807_0309351 Ga0451807_0309351_404_1060 218
621 3300041509 Ga0451843_0937299 Ga0451843_0937299_1204_1860 218
622 3300042006 Ga0439432_002171 Ga0439432_002171_5315_5971 218
623 3300042006 Ga0439432_019482 Ga0439432_019482_990_1646 218
624 3300042007 Ga0439449_0002465 Ga0439449_0002465_3741_4397 218
625 3300042007 Ga0439449_0079319 Ga0439449_0079319_116_772 218
626 3300042016 Ga0439463_043094 Ga0439463_043094_383_1039 218
627 3300042115 Ga0450911_013117 Ga0450911_013117_26_682 218
628 3300042115 Ga0450911_025422 Ga0450911_025422_26_682 218
629 3300042134 Ga0450898_004210 Ga0450898_004210_460_1116 218
630 3300042876 Ga0451577_0008692 Ga0451577_0008692_1537_2193 218
631 3300042876 Ga0451577_0076360 Ga0451577_0076360_2252_2908 218
632 3300042876 Ga0451577_0077718 Ga0451577_0077718_491_1150 218
633 3300042876 Ga0451577_0114257 Ga0451577_0114257_725_1384 218
634 3300042876 Ga0451577_0170983 Ga0451577_0170983_143_802 218
635 3300042876 Ga0451577_0248917 Ga0451577_0248917_402_1061 218
636 3300042876 Ga0451577_0429540 Ga0451577_0429540_220_906 218
637 3300044673 Ga0453683_0022770 Ga0453683_0022770_1828_2484 218
638 3300044712 Ga0453684_0023479 Ga0453684_0023479_5525_6181 218
639 3300044712 Ga0453684_0548431 Ga0453684_0548431_397_1053 218
640 3300044712 Ga0453684_0559808 Ga0453684_0559808_99_755 218
641 3300045051 Ga0451576_0015411 Ga0451576_0015411_3683_4342 218
642 3300045051 Ga0451576_0128369 Ga0451576_0128369_1610_2269 218
643 3300045051 Ga0451576_0716079 Ga0451576_0716079_108_764 218
644 3300046453 Ga0495627_000152 Ga0495627_000152_9083_9739 218
645 3300046453 Ga0495627_007838 Ga0495627_007838_150_815 218
646 3300046453 Ga0495627_007952 Ga0495627_007952_1072_1728 218
647 3300046458 Ga0495591_000827 Ga0495591_000827_11808_12464 218
648 3300046458 Ga0495591_010352 Ga0495591_010352_1953_2609 218
649 3300046458 Ga0495591_013962 Ga0495591_013962_1564_2220 218
650 3300046458 Ga0495591_022796 Ga0495591_022796_371_1027 218
651 3300046460 Ga0495638_0020231 Ga0495638_0020231_2990_3646 218
652 3300046460 Ga0495638_0069505 Ga0495638_0069505_1074_1730 218
653 3300046471 Ga0495650_0025875 Ga0495650_0025875_1524_2189 218
654 3300046474 Ga0495605_0000088 Ga0495605_0000088_40210_40875 218
655 3300046474 Ga0495605_0051487 Ga0495605_0051487_265_921 218
656 3300046474 Ga0495605_0067067 Ga0495605_0067067_944_1600 218
657 3300046491 Ga0495584_0050990 Ga0495584_0050990_821_1477 218
658 3300046492 Ga0495585_0046471 Ga0495585_0046471_1062_1718 218
659 3300046499 Ga0495594_0112091 Ga0495594_0112091_782_1447 218
660 3300046501 Ga0495607_0033814 Ga0495607_0033814_506_1162 218
661 3300046501 Ga0495607_0054139 Ga0495607_0054139_319_975 218
662 3300046506 Ga0495583_0000135 Ga0495583_0000135_45011_45676 218
663 3300046506 Ga0495583_0017540 Ga0495583_0017540_2586_3242 218
664 3300046507 Ga0495606_0027400 Ga0495606_0027400_2373_3029 218
665 3300046507 Ga0495606_0071235 Ga0495606_0071235_944_1600 218
666 3300046512 Ga0495610_0015133 Ga0495610_0015133_3472_4137 218
667 3300046512 Ga0495610_0026675 Ga0495610_0026675_1663_2319 218
668 3300046512 Ga0495610_0066035 Ga0495610_0066035_35_691 218
669 3300046512 Ga0495610_0181756 Ga0495610_0181756_76_732 218
670 3300046512 Ga0495610_0188260 Ga0495610_0188260_149_805 218
671 3300046513 Ga0495616_0220097 Ga0495616_0220097_74_739 218
672 3300046515 Ga0495620_0000034 Ga0495620_0000034_77180_77845 218
673 3300046515 Ga0495620_0019389 Ga0495620_0019389_2285_2941 218
674 3300046518 Ga0495631_0030875 Ga0495631_0030875_524_1189 218
675 3300046518 Ga0495631_0052270 Ga0495631_0052270_259_915 218
676 3300046519 Ga0495632_0023328 Ga0495632_0023328_977_1633 218
677 3300046520 Ga0495637_0011562 Ga0495637_0011562_1766_2422 218
678 3300046520 Ga0495637_0030568 Ga0495637_0030568_333_989 218
679 3300046520 Ga0495637_0113627 Ga0495637_0113627_320_976 218
680 3300046522 Ga0495643_0073894 Ga0495643_0073894_410_1066 218
681 3300046524 Ga0495648_0024375 Ga0495648_0024375_1929_2594 218
682 3300046525 Ga0495663_0031671 Ga0495663_0031671_135_791 218
683 3300046525 Ga0495663_0073029 Ga0495663_0073029_63_737 218
684 3300046530 Ga0495654_0011169 Ga0495654_0011169_1921_2586 218
685 3300046530 Ga0495654_0012081 Ga0495654_0012081_761_1417 218
686 3300046530 Ga0495654_0015779 Ga0495654_0015779_707_1363 218
687 3300046530 Ga0495654_0045449 Ga0495654_0045449_336_992 218
688 3300046530 Ga0495654_0119478 Ga0495654_0119478_93_782 218
689 3300046530 Ga0495654_0178096 Ga0495654_0178096_63_719 218
690 3300046538 Ga0495609_0000247 Ga0495609_0000247_5503_6168 218
691 3300046538 Ga0495609_0026730 Ga0495609_0026730_404_1060 218
692 3300046538 Ga0495609_0047382 Ga0495609_0047382_259_948 218
693 3300046542 Ga0495597_0000050 Ga0495597_0000050_1929_2585 218
694 3300046542 Ga0495597_0019436 Ga0495597_0019436_532_1197 218
695 3300046558 Ga0495633_0000468 Ga0495633_0000468_40055_40720 218
696 3300046558 Ga0495633_0043664 Ga0495633_0043664_376_1044 218
697 3300046615 Ga0495656_0002924 Ga0495656_0002924_641_1297 218
698 3300046615 Ga0495656_0006875 Ga0495656_0006875_1668_2342 218
699 3300046615 Ga0495656_0016521 Ga0495656_0016521_66_740 218
700 3300046615 Ga0495656_0108296 Ga0495656_0108296_260_916 218
701 3300046648 Ga0495611_0032571 Ga0495611_0032571_1107_1772 218
702 3300046660 Ga0495625_0145309 Ga0495625_0145309_95_751 218
703 3300046665 Ga0495661_0000078 Ga0495661_0000078_40108_40773 218
704 3300046665 Ga0495661_0075057 Ga0495661_0075057_177_833 218
705 3300046691 Ga0495670_0038487 Ga0495670_0038487_490_1179 218
706 3300046691 Ga0495670_0078535 Ga0495670_0078535_670_1344 218
707 3300046691 Ga0495670_0172881 Ga0495670_0172881_317_973 218
708 3300046692 Ga0495671_0072757 Ga0495671_0072757_683_1348 218
709 3300046694 Ga0495649_0065648 Ga0495649_0065648_189_878 218
710 3300046694 Ga0495649_0172365 Ga0495649_0172365_413_1069 218
711 3300046794 Ga0495589_0031553 Ga0495589_0031553_530_1195 218
712 3300046810 Ga0495660_0011997 Ga0495660_0011997_1834_2490 218
713 3300046810 Ga0495660_0027659 Ga0495660_0027659_534_1199 218
714 3300047318 Ga0495636_0000568 Ga0495636_0000568_9839_10495 218
715 3300047318 Ga0495636_0055237 Ga0495636_0055237_763_1455 218
716 3300047318 Ga0495636_0063315 Ga0495636_0063315_446_1120 218
717 3300047323 Ga0495683_0000108 Ga0495683_0000108_78291_78956 218
718 3300047446 Ga0495679_000944 Ga0495679_000944_8705_9370 218
719 3300047446 Ga0495679_067878 Ga0495679_067878_327_983 218
720 3300047469 Ga0495673_0011018 Ga0495673_0011018_2344_3000 218
721 3300047469 Ga0495673_0031726 Ga0495673_0031726_683_1348 218
722 3300047470 Ga0495681_0025109 Ga0495681_0025109_487_1152 218
723 3300047470 Ga0495681_0034385 Ga0495681_0034385_745_1401 218
724 3300047470 Ga0495681_0114252 Ga0495681_0114252_122_778 218
725 3300047472 Ga0495686_0047547 Ga0495686_0047547_1316_1972 218
726 3300048903 Ga0496100_0341465 Ga0496100_0341465_153_818 218
727 3300048904 Ga0496101_0216069 Ga0496101_0216069_50_724 218
728 3300048910 Ga0496107_0367802 Ga0496107_0367802_28_702 218
729 3300048910 Ga0496107_0727762 Ga0496107_0727762_48_704 218
730 3300048911 Ga0496108_0322647 Ga0496108_0322647_598_1272 218
731 3300048916 Ga0496113_0237843 Ga0496113_0237843_63_737 218
732 3300048917 Ga0496114_0007715 Ga0496114_0007715_1542_2207 218
733 3300048918 Ga0496115_0229988 Ga0496115_0229988_135_800 218
734 3300048919 Ga0496116_0054876 Ga0496116_0054876_130_789 218
735 3300048920 Ga0496117_0032706 Ga0496117_0032706_2280_2936 218
736 3300048920 Ga0496117_0067095 Ga0496117_0067095_1298_1954 218
737 3300048920 Ga0496117_0115973 Ga0496117_0115973_797_1453 218
738 3300048920 Ga0496117_0192870 Ga0496117_0192870_471_1127 218
739 3300048921 Ga0496118_0079734 Ga0496118_0079734_657_1313 218
740 3300048921 Ga0496118_0121677 Ga0496118_0121677_55_711 218
741 3300048921 Ga0496118_0151384 Ga0496118_0151384_592_1248 218
742 3300048921 Ga0496118_0173652 Ga0496118_0173652_533_1189 218
743 3300048922 Ga0496119_0027855 Ga0496119_0027855_1380_2036 218
744 3300048922 Ga0496119_0081607 Ga0496119_0081607_1019_1675 218
745 3300048922 Ga0496119_0204940 Ga0496119_0204940_227_883 218
746 3300048923 Ga0496120_0029447 Ga0496120_0029447_1012_1668 218
747 3300048923 Ga0496120_0073795 Ga0496120_0073795_189_845 218
748 3300048923 Ga0496120_0088019 Ga0496120_0088019_29_685 218
749 3300048924 Ga0496121_0012278 Ga0496121_0012278_3279_3938 218
750 3300048924 Ga0496121_0031139 Ga0496121_0031139_146_805 218
751 3300048924 Ga0496121_0053409 Ga0496121_0053409_139_795 218
752 3300048924 Ga0496121_0061803 Ga0496121_0061803_2275_2931 218
753 3300048924 Ga0496121_0221315 Ga0496121_0221315_569_1228 218
754 3300048925 Ga0496122_0018800 Ga0496122_0018800_3754_4419 218
755 3300048925 Ga0496122_0086182 Ga0496122_0086182_679_1335 218
756 3300048925 Ga0496122_0119626 Ga0496122_0119626_23_679 218
757 3300048925 Ga0496122_0124505 Ga0496122_0124505_923_1579 218
758 3300048925 Ga0496122_0178592 Ga0496122_0178592_465_1121 218
759 3300048926 Ga0496123_0061878 Ga0496123_0061878_1060_1716 218
760 3300048926 Ga0496123_0073574 Ga0496123_0073574_1017_1673 218
761 3300048926 Ga0496123_0085420 Ga0496123_0085420_1213_1878 218
762 3300048926 Ga0496123_0092142 Ga0496123_0092142_1004_1660 218
763 3300048927 Ga0496124_0000658 Ga0496124_0000658_29009_29665 218
764 3300048927 Ga0496124_0042651 Ga0496124_0042651_1009_1665 218
765 3300048927 Ga0496124_0058616 Ga0496124_0058616_267_923 218
766 3300048927 Ga0496124_0091823 Ga0496124_0091823_796_1452 218
767 3300048927 Ga0496124_0280236 Ga0496124_0280236_337_1011 218
768 3300048927 Ga0496124_0331306 Ga0496124_0331306_52_708 218
769 3300048928 Ga0496125_0033943 Ga0496125_0033943_2278_2934 218
770 3300048928 Ga0496125_0036932 Ga0496125_0036932_2272_2928 218
771 3300048928 Ga0496125_0051851 Ga0496125_0051851_2620_3276 218
772 3300048928 Ga0496125_0087719 Ga0496125_0087719_1016_1672 218
773 3300048928 Ga0496125_0149824 Ga0496125_0149824_466_1125 218
774 3300048928 Ga0496125_0344078 Ga0496125_0344078_104_760 218
775 3300048929 Ga0496126_0072160 Ga0496126_0072160_92_748 218
776 3300048929 Ga0496126_0193110 Ga0496126_0193110_707_1363 218
777 3300048929 Ga0496126_0222319 Ga0496126_0222319_838_1494 218
778 3300049459 Ga0495678_000081 Ga0495678_000081_39929_40594 218
779 3300049568 Ga0501031_0021912 Ga0501031_0021912_30_782 218
780 3300049568 Ga0501031_0028905 Ga0501031_0028905_1990_2646 218
781 3300049569 Ga0501032_0086669 Ga0501032_0086669_471_1130 218
782 3300049569 Ga0501032_0217537 Ga0501032_0217537_148_807 218
783 3300049569 Ga0501032_0244603 Ga0501032_0244603_132_827 218
784 3300049570 Ga0501033_0000683 Ga0501033_0000683_8224_8886 218
785 3300049570 Ga0501033_0037101 Ga0501033_0037101_1954_2613 218
786 3300049570 Ga0501033_0102546 Ga0501033_0102546_273_932 218
787 3300049570 Ga0501033_0129147 Ga0501033_0129147_1103_1759 218
788 3300049570 Ga0501033_0153969 Ga0501033_0153969_402_1058 218
789 3300049571 Ga0501034_0071383 Ga0501034_0071383_1374_2087 218
790 3300049571 Ga0501034_0290428 Ga0501034_0290428_122_904 218
791 3300049571 Ga0501034_0314562 Ga0501034_0314562_606_1268 218
792 3300049571 Ga0501034_0441955 Ga0501034_0441955_545_1204 218
793 3300049571 Ga0501034_0621404 Ga0501034_0621404_145_801 218
794 3300049572 Ga0501036_0027681 Ga0501036_0027681_682_1365 218
795 3300049572 Ga0501036_0076796 Ga0501036_0076796_1830_2567 218
796 3300049572 Ga0501036_0277301 Ga0501036_0277301_684_1343 218
797 3300049573 Ga0501037_0006686 Ga0501037_0006686_6372_7055 218
798 3300049573 Ga0501037_0247053 Ga0501037_0247053_272_931 218
799 3300049573 Ga0501037_0280683 Ga0501037_0280683_469_1125 218
800 3300049574 Ga0501038_0032416 Ga0501038_0032416_3249_3911 218
801 3300049574 Ga0501038_0060072 Ga0501038_0060072_2420_3076 218
802 3300049574 Ga0501038_0112856 Ga0501038_0112856_908_1567 218
803 3300049579 Ga0501043_0021707 Ga0501043_0021707_3319_4002 218
804 3300049579 Ga0501043_0055862 Ga0501043_0055862_2360_3019 218
805 3300049579 Ga0501043_0131236 Ga0501043_0131236_588_1244 218
806 3300049579 Ga0501043_0179101 Ga0501043_0179101_21_758 218
807 3300049579 Ga0501043_0404042 Ga0501043_0404042_246_905 218
808 3300049580 Ga0501046_0062908 Ga0501046_0062908_2056_2715 218
809 3300049580 Ga0501046_0262877 Ga0501046_0262877_346_1002 218
810 3300049581 Ga0501047_0043531 Ga0501047_0043531_2749_3405 218
811 3300049581 Ga0501047_0045001 Ga0501047_0045001_2058_2717 218
812 3300049581 Ga0501047_0050180 Ga0501047_0050180_2339_3076 218
813 3300049581 Ga0501047_0312368 Ga0501047_0312368_56_715 218
814 3300049581 Ga0501047_0599375 Ga0501047_0599375_14_673 218
815 3300049586 Ga0501070_0015349 Ga0501070_0015349_1120_1803 218
816 3300049586 Ga0501070_0356438 Ga0501070_0356438_120_800 218
817 3300049589 Ga0501073_0512599 Ga0501073_0512599_41_697 218
818 3300049593 Ga0501077_0088828 Ga0501077_0088828_299_958 218
819 3300049669 Ga0501235_020753 Ga0501235_020753_669_1325 218
820 3300049680 Ga0501250_013566 Ga0501250_013566_108_764 218
821 3300049742 Ga0501080_0192536 Ga0501080_0192536_524_1180 218
822 3300049822 Ga0501035_0005012 Ga0501035_0005012_5939_6598 218
823 3300049822 Ga0501035_0008708 Ga0501035_0008708_5873_6556 218
824 3300049822 Ga0501035_0013853 Ga0501035_0013853_6434_7096 218
825 3300049822 Ga0501035_0016440 Ga0501035_0016440_5156_5815 218
826 3300049822 Ga0501035_0044579 Ga0501035_0044579_1339_1998 218
827 3300049822 Ga0501035_0049900 Ga0501035_0049900_2219_2881 218
828 3300049822 Ga0501035_0050686 Ga0501035_0050686_2749_3405 218
829 3300049822 Ga0501035_0140616 Ga0501035_0140616_642_1304 218
830 3300049822 Ga0501035_0530788 Ga0501035_0530788_117_779 218
831 3300049823 Ga0501044_0000162 Ga0501044_0000162_61479_62141 218
832 3300049823 Ga0501044_0001700 Ga0501044_0001700_22719_23432 218
833 3300049823 Ga0501044_0005271 Ga0501044_0005271_10168_10827 218
834 3300049823 Ga0501044_0009521 Ga0501044_0009521_4222_4905 218
835 3300049823 Ga0501044_0042804 Ga0501044_0042804_476_1132 218
836 3300049823 Ga0501044_0090995 Ga0501044_0090995_837_1496 218
837 3300049823 Ga0501044_0108156 Ga0501044_0108156_17_676 218
838 3300049823 Ga0501044_0160875 Ga0501044_0160875_91_828 218
839 3300049823 Ga0501044_0266207 Ga0501044_0266207_201_896 218
840 3300049823 Ga0501044_0415913 Ga0501044_0415913_543_1199 218
841 3300049823 Ga0501044_0562410 Ga0501044_0562410_118_774 218
842 3300049824 Ga0501045_0384267 Ga0501045_0384267_219_956 218
843 3300049824 Ga0501045_0389256 Ga0501045_0389256_31_693 218
844 3300050491 nmdc:mga00v17_1308_c1 nmdc:mga00v17_1308_c1_493_1149 218
845 3300053125 Ga0500618_002180 Ga0500618_002180_5377_6051 218
846 3300053125 Ga0500618_007900 Ga0500618_007900_279_944 218
847 iso_pu_bacteria 2643221695 2644528777 218
848 iso_pu_bacteria 2687453130 2687581758 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05724

TPMT

Thiopurine S-methyltransferase (TPMT)

47

261

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gb4-assembly1.cif.gz_A crystal structure of thiopurine methyltransferase (18204406) from mus musculus at 1.35 a resolution 0.9033 1 218
2gb4-assembly1.cif.gz_A crystal structure of thiopurine methyltransferase (18204406) from mus musculus at 1.35 a resolution 0.8993 1 218
2h11-assembly2.cif.gz_B amino-terminal truncated thiopurine s-methyltransferase complexed with s-adenosyl-l-homocysteine 0.8912 1 218
2h11-assembly2.cif.gz_B amino-terminal truncated thiopurine s-methyltransferase complexed with s-adenosyl-l-homocysteine 0.8873 1 218
5dnk-assembly1.cif.gz_B the structure of pkmt1 from rickettsia prowazekii in complex with adohcy 0.7812 38 160
ID Description Score Start End Superfamily
2bzgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8733 1 218 3.40.50.150
2bzgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8695 1 218 3.40.50.150
af_B7E650_31_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8107 3 218 3.40.50.150
af_P9WKL5_23_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7968 21 189 3.40.50.150
af_Q54U59_216_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7867 38 153 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2H1PRK0-F1-model_v4 deleted 0.9966 142 218
AF-H8FEH1-F1-model_v4 deleted 0.9921 145 218
AF-W4SHG1-F1-model_v4 Thiopurine S-methyltransferase 0.9903 91 218 GO:0005737
GO:0008119
GO:0032259
AF-A0A0P8ZSH7-F1-model_v4 Thiopurine S-methyltransferase (EC 2.1.1.67) 0.9895 42 218 GO:0005737
GO:0008119
GO:0010038
GO:0032259
AF-A0A2Z7A7M6-F1-model_v4 thiopurine S-methyltransferase (EC 2.1.1.67) 0.9887 3 218 GO:0005737
GO:0008119
GO:0010038
GO:0016491
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.45 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map