F483392
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 849 | 303 | 847 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10314612|Ga0075365_103146122 |
| Length | 290 |
| Sequence | VIIRKGAAEIARIARAGELVAKTIAHVGEHIEPGVTTVELDDVADAFIRANGGVPTSLGYRGYPRAICISVDEVVVHGIPDARIIEEGDLVTIDVGVTLDGAIADSAYTFGVGTVDAEAQRLLDVCQDALAAGIAEARLGNRIGDISHAVQTLVEEAGFSVVKSLVGHGVGRHYHEDPHVPNFGEPGRGPRLSEGMTIAIEPMITMGRPEVVLAEDGWTISSADGSRAAHFEHTVAILPDGPRILTPRVGSRRARASRRPDSGRPRDRKDAGFATVSGPRGGGFSVRGIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 183 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 184 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 196 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 197 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 198 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 199 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 200 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 203 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 204 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 205 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 206 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 207 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 208 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 209 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 210 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 211 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 212 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 213 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 214 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 215 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 216 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 217 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 301 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 303 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.12 |
| Isolates | 0.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.18 |
| Nodule | 0 |
| Rhizoplane | 3.65 |
| Rhizosphere | 94.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1006401 | 3300002074 | Bacteria | 1370 |
| 2 | JGI24738J21930_10004317 | 3300002075 | Unclassified | 3498 |
| 3 | JGI25406J46586_10011827 | 3300003203 | Unclassified | 3809 |
| 4 | JGI25160J50197_1012574 | 3300003354 | Bacteria | 2930 |
| 5 | JGI25407J50210_10002038 | 3300003373 | Bacteria | 4711 |
| 6 | JGI25407J50210_10010081 | 3300003373 | Bacteria | 2401 |
| 7 | Ga0065712_10070868 | 3300005290 | Bacteria | 5642 |
| 8 | Ga0065715_10021290 | 3300005293 | Bacteria | 1883 |
| 9 | Ga0065707_10237328 | 3300005295 | Bacteria | 1155 |
| 10 | Ga0070658_10010785 | 3300005327 | Bacteria | 7325 |
| 11 | Ga0070676_10108046 | 3300005328 | Bacteria | 1728 |
| 12 | Ga0070676_10392510 | 3300005328 | Bacteria | 964 |
| 13 | Ga0070683_100000726 | 3300005329 | Bacteria | 24102 |
| 14 | Ga0070683_100009922 | 3300005329 | Bacteria | 8162 |
| 15 | Ga0070683_100043756 | 3300005329 | Bacteria | 4127 |
| 16 | Ga0070683_100084911 | 3300005329 | Bacteria | 2967 |
| 17 | Ga0070683_100207816 | 3300005329 | Bacteria | 1859 |
| 18 | Ga0070683_100307032 | 3300005329 | Bacteria | 1509 |
| 19 | Ga0070690_100147623 | 3300005330 | Bacteria | 1601 |
| 20 | Ga0070670_100148007 | 3300005331 | Bacteria | 2032 |
| 21 | Ga0070670_100230401 | 3300005331 | Bacteria | 1612 |
| 22 | Ga0068869_100012691 | 3300005334 | Bacteria | 5573 |
| 23 | Ga0068869_100229827 | 3300005334 | Bacteria | 1473 |
| 24 | Ga0068869_100564387 | 3300005334 | Bacteria | 958 |
| 25 | Ga0070666_10190318 | 3300005335 | Bacteria | 1441 |
| 26 | Ga0070680_100390189 | 3300005336 | Bacteria | 1186 |
| 27 | Ga0070680_100464555 | 3300005336 | Bacteria | 1081 |
| 28 | Ga0070682_100031746 | 3300005337 | Bacteria | 3196 |
| 29 | Ga0070682_100127151 | 3300005337 | Bacteria | 1719 |
| 30 | Ga0070682_100401730 | 3300005337 | Bacteria | 1036 |
| 31 | Ga0068868_100028641 | 3300005338 | Bacteria | 4260 |
| 32 | Ga0068868_100363306 | 3300005338 | Bacteria | 1242 |
| 33 | Ga0068868_100423937 | 3300005338 | Bacteria | 1152 |
| 34 | Ga0070660_100017962 | 3300005339 | Bacteria | 5161 |
| 35 | Ga0070660_100048573 | 3300005339 | Bacteria | 3259 |
| 36 | Ga0070660_100105368 | 3300005339 | Bacteria | 2238 |
| 37 | Ga0070660_100329361 | 3300005339 | Bacteria | 1255 |
| 38 | Ga0070691_10003867 | 3300005341 | Bacteria | 6767 |
| 39 | Ga0070691_10034218 | 3300005341 | Bacteria | 2391 |
| 40 | Ga0070691_10037701 | 3300005341 | Bacteria | 2281 |
| 41 | Ga0070661_100010076 | 3300005344 | Bacteria | 6563 |
| 42 | Ga0070661_100053195 | 3300005344 | Bacteria | 2963 |
| 43 | Ga0070692_10019897 | 3300005345 | Bacteria | 3246 |
| 44 | Ga0070692_10064286 | 3300005345 | Bacteria | 1940 |
| 45 | Ga0070668_100070704 | 3300005347 | Bacteria | 2717 |
| 46 | Ga0070668_100093920 | 3300005347 | Bacteria | 2367 |
| 47 | Ga0070668_100113261 | 3300005347 | Bacteria | 2161 |
| 48 | Ga0070669_100001695 | 3300005353 | Bacteria | 15953 |
| 49 | Ga0070669_100650324 | 3300005353 | Bacteria | 887 |
| 50 | Ga0070675_100041134 | 3300005354 | Bacteria | 3775 |
| 51 | Ga0070675_100061051 | 3300005354 | Bacteria | 3112 |
| 52 | Ga0070675_100137200 | 3300005354 | Bacteria | 2088 |
| 53 | Ga0070675_100267156 | 3300005354 | Bacteria | 1500 |
| 54 | Ga0070671_100060488 | 3300005355 | Bacteria | 3154 |
| 55 | Ga0070671_100062030 | 3300005355 | Bacteria | 3113 |
| 56 | Ga0070671_100069069 | 3300005355 | Bacteria | 2946 |
| 57 | Ga0070674_100021069 | 3300005356 | Bacteria | 4179 |
| 58 | Ga0070674_100040505 | 3300005356 | Bacteria | 3152 |
| 59 | Ga0070674_100041590 | 3300005356 | Bacteria | 3116 |
| 60 | Ga0070674_100042929 | 3300005356 | Bacteria | 3074 |
| 61 | Ga0070674_100183521 | 3300005356 | Bacteria | 1604 |
| 62 | Ga0070673_100019981 | 3300005364 | Bacteria | 4821 |
| 63 | Ga0070688_100019230 | 3300005365 | Bacteria | 3955 |
| 64 | Ga0070688_100078573 | 3300005365 | Bacteria | 2129 |
| 65 | Ga0070688_100216061 | 3300005365 | Bacteria | 1349 |
| 66 | Ga0070659_100022749 | 3300005366 | Bacteria | 4788 |
| 67 | Ga0070659_100091822 | 3300005366 | Bacteria | 2434 |
| 68 | Ga0070659_100173710 | 3300005366 | Bacteria | 1766 |
| 69 | Ga0070659_100201856 | 3300005366 | Bacteria | 1637 |
| 70 | Ga0070659_100584563 | 3300005366 | Bacteria | 958 |
| 71 | Ga0070701_10109767 | 3300005438 | Bacteria | 1539 |
| 72 | Ga0070701_10166397 | 3300005438 | Bacteria | 1281 |
| 73 | Ga0070701_10268780 | 3300005438 | Bacteria | 1036 |
| 74 | Ga0070700_100248892 | 3300005441 | Bacteria | 1274 |
| 75 | Ga0070700_100434057 | 3300005441 | Bacteria | 995 |
| 76 | Ga0070694_100208965 | 3300005444 | Bacteria | 1459 |
| 77 | Ga0070663_100027522 | 3300005455 | Bacteria | 3862 |
| 78 | Ga0070663_100063895 | 3300005455 | Bacteria | 2659 |
| 79 | Ga0070663_100200179 | 3300005455 | Bacteria | 1558 |
| 80 | Ga0070678_100058968 | 3300005456 | Bacteria | 2819 |
| 81 | Ga0070678_100097324 | 3300005456 | Bacteria | 2272 |
| 82 | Ga0070678_100110108 | 3300005456 | Bacteria | 2153 |
| 83 | Ga0070678_100269414 | 3300005456 | Bacteria | 1435 |
| 84 | Ga0070662_100017781 | 3300005457 | Bacteria | 4797 |
| 85 | Ga0070662_100040253 | 3300005457 | Bacteria | 3326 |
| 86 | Ga0070662_100117753 | 3300005457 | Bacteria | 2032 |
| 87 | Ga0070662_100149537 | 3300005457 | Bacteria | 1817 |
| 88 | Ga0070681_10300368 | 3300005458 | Bacteria | 1515 |
| 89 | Ga0068867_100049389 | 3300005459 | Bacteria | 3097 |
| 90 | Ga0068867_100246320 | 3300005459 | Bacteria | 1451 |
| 91 | Ga0070707_100096597 | 3300005468 | Bacteria | 2862 |
| 92 | Ga0070707_100373712 | 3300005468 | Bacteria | 1385 |
| 93 | Ga0070698_100001954 | 3300005471 | Bacteria | 22884 |
| 94 | Ga0070699_100121129 | 3300005518 | Bacteria | 2301 |
| 95 | Ga0070699_100495249 | 3300005518 | Unclassified | 1110 |
| 96 | Ga0070679_100099326 | 3300005530 | Bacteria | 2898 |
| 97 | Ga0070679_100436369 | 3300005530 | Bacteria | 1255 |
| 98 | Ga0070684_100083429 | 3300005535 | Bacteria | 2832 |
| 99 | Ga0070684_100101399 | 3300005535 | Bacteria | 2572 |
| 100 | Ga0070684_100114067 | 3300005535 | Bacteria | 2425 |
| 101 | Ga0070684_100402910 | 3300005535 | Bacteria | 1261 |
| 102 | Ga0070684_100476083 | 3300005535 | Bacteria | 1155 |
| 103 | Ga0070684_100570992 | 3300005535 | Bacteria | 1050 |
| 104 | Ga0070697_100199816 | 3300005536 | Bacteria | 1699 |
| 105 | Ga0068853_100092055 | 3300005539 | Bacteria | 2667 |
| 106 | Ga0068853_100414531 | 3300005539 | Bacteria | 1262 |
| 107 | Ga0068853_100480312 | 3300005539 | Bacteria | 1171 |
| 108 | Ga0070672_100035663 | 3300005543 | Bacteria | 3782 |
| 109 | Ga0070672_100077300 | 3300005543 | Bacteria | 2661 |
| 110 | Ga0070672_100155724 | 3300005543 | Bacteria | 1892 |
| 111 | Ga0070686_100082484 | 3300005544 | Bacteria | 2132 |
| 112 | Ga0070696_100082497 | 3300005546 | Bacteria | 2279 |
| 113 | Ga0070693_100095721 | 3300005547 | Bacteria | 1798 |
| 114 | Ga0070665_100140484 | 3300005548 | Bacteria | 2418 |
| 115 | Ga0070704_100051520 | 3300005549 | Bacteria | 2899 |
| 116 | Ga0068855_100158907 | 3300005563 | Bacteria | 2566 |
| 117 | Ga0068855_100691304 | 3300005563 | Unclassified | 1092 |
| 118 | Ga0070664_100004358 | 3300005564 | Bacteria | 11371 |
| 119 | Ga0070664_100010033 | 3300005564 | Bacteria | 7675 |
| 120 | Ga0070664_100413985 | 3300005564 | Bacteria | 1234 |
| 121 | Ga0070664_100653388 | 3300005564 | Bacteria | 977 |
| 122 | Ga0068857_100608269 | 3300005577 | Unclassified | 1033 |
| 123 | Ga0068854_100021594 | 3300005578 | Bacteria | 4370 |
| 124 | Ga0068854_100099990 | 3300005578 | Bacteria | 2173 |
| 125 | Ga0068854_100470447 | 3300005578 | Bacteria | 1053 |
| 126 | Ga0068856_100306283 | 3300005614 | Bacteria | 1607 |
| 127 | Ga0068856_100699949 | 3300005614 | Bacteria | 1034 |
| 128 | Ga0070702_100273883 | 3300005615 | Bacteria | 1155 |
| 129 | Ga0068852_100162678 | 3300005616 | Bacteria | 2085 |
| 130 | Ga0068852_100462886 | 3300005616 | Bacteria | 1257 |
| 131 | Ga0068852_100709780 | 3300005616 | Bacteria | 1016 |
| 132 | Ga0068859_100038389 | 3300005617 | Bacteria | 4805 |
| 133 | Ga0068859_100049834 | 3300005617 | Bacteria | 4206 |
| 134 | Ga0068859_100242972 | 3300005617 | Bacteria | 1890 |
| 135 | Ga0068864_100151738 | 3300005618 | Bacteria | 2099 |
| 136 | Ga0068866_10216495 | 3300005718 | Bacteria | 1153 |
| 137 | Ga0068861_100272968 | 3300005719 | Bacteria | 1453 |
| 138 | Ga0068861_100315511 | 3300005719 | Unclassified | 1360 |
| 139 | Ga0068861_100345788 | 3300005719 | Bacteria | 1303 |
| 140 | Ga0068851_10029573 | 3300005834 | Bacteria | 2713 |
| 141 | Ga0068870_10027826 | 3300005840 | Bacteria | 2832 |
| 142 | Ga0068870_10098639 | 3300005840 | Bacteria | 1646 |
| 143 | Ga0068870_10127219 | 3300005840 | Bacteria | 1475 |
| 144 | Ga0068863_100176216 | 3300005841 | Bacteria | 2052 |
| 145 | Ga0068858_100046786 | 3300005842 | Bacteria | 4010 |
| 146 | Ga0068860_100027971 | 3300005843 | Bacteria | 5429 |
| 147 | Ga0068860_100601624 | 3300005843 | Bacteria | 1105 |
| 148 | Ga0068862_100040658 | 3300005844 | Bacteria | 3953 |
| 149 | Ga0068862_100088910 | 3300005844 | Bacteria | 2688 |
| 150 | Ga0068862_100143650 | 3300005844 | Bacteria | 2119 |
| 151 | Ga0068862_100550823 | 3300005844 | Bacteria | 1101 |
| 152 | Ga0081455_10006029 | 3300005937 | Bacteria | 13133 |
| 153 | Ga0081455_10031276 | 3300005937 | Bacteria | 4819 |
| 154 | Ga0081455_10047065 | 3300005937 | Bacteria | 3738 |
| 155 | Ga0081455_10080350 | 3300005937 | Bacteria | 2673 |
| 156 | Ga0081455_10126583 | 3300005937 | Bacteria | 2004 |
| 157 | Ga0081455_10166555 | 3300005937 | Bacteria | 1683 |
| 158 | Ga0081538_10001905 | 3300005981 | Bacteria | 20952 |
| 159 | Ga0081538_10003017 | 3300005981 | Bacteria | 16026 |
| 160 | Ga0081538_10004338 | 3300005981 | Bacteria | 13097 |
| 161 | Ga0081538_10012849 | 3300005981 | Bacteria | 6681 |
| 162 | Ga0081538_10014859 | 3300005981 | Bacteria | 6067 |
| 163 | Ga0081538_10070824 | 3300005981 | Bacteria | 1922 |
| 164 | Ga0081540_1104800 | 3300005983 | Bacteria | 1209 |
| 165 | Ga0081539_10000433 | 3300005985 | Bacteria | 89118 |
| 166 | Ga0081539_10011818 | 3300005985 | Bacteria | 6832 |
| 167 | Ga0075365_10009452 | 3300006038 | Bacteria | 5606 |
| 168 | Ga0075365_10021528 | 3300006038 | Bacteria | 4024 |
| 169 | Ga0075365_10314612 | 3300006038 | Bacteria | 1102 |
| 170 | Ga0075365_10416730 | 3300006038 | Bacteria | 948 |
| 171 | Ga0075432_10015139 | 3300006058 | Bacteria | 2629 |
| 172 | Ga0097621_100024219 | 3300006237 | Bacteria | 4737 |
| 173 | Ga0097621_100079474 | 3300006237 | Bacteria | 2726 |
| 174 | Ga0068871_100208481 | 3300006358 | Bacteria | 1690 |
| 175 | Ga0068871_100416634 | 3300006358 | Bacteria | 1199 |
| 176 | Ga0075428_100004768 | 3300006844 | Bacteria | 15015 |
| 177 | Ga0075428_100006199 | 3300006844 | Bacteria | 13302 |
| 178 | Ga0075428_100028437 | 3300006844 | Bacteria | 6185 |
| 179 | Ga0075428_100073820 | 3300006844 | Bacteria | 3726 |
| 180 | Ga0075428_100219366 | 3300006844 | Bacteria | 2054 |
| 181 | Ga0075428_100361103 | 3300006844 | Bacteria | 1558 |
| 182 | Ga0075428_100566912 | 3300006844 | Bacteria | 1213 |
| 183 | Ga0075430_100004496 | 3300006846 | Bacteria | 11750 |
| 184 | Ga0075430_100006208 | 3300006846 | Bacteria | 10075 |
| 185 | Ga0075430_100016007 | 3300006846 | Bacteria | 6386 |
| 186 | Ga0075430_100147575 | 3300006846 | Bacteria | 1959 |
| 187 | Ga0075430_100430170 | 3300006846 | Bacteria | 1089 |
| 188 | Ga0075431_100004224 | 3300006847 | Bacteria | 14071 |
| 189 | Ga0075431_100014147 | 3300006847 | Bacteria | 8068 |
| 190 | Ga0075431_100014487 | 3300006847 | Bacteria | 7977 |
| 191 | Ga0075431_100023806 | 3300006847 | Bacteria | 6268 |
| 192 | Ga0075431_100102472 | 3300006847 | Bacteria | 2954 |
| 193 | Ga0075431_100160303 | 3300006847 | Bacteria | 2313 |
| 194 | Ga0075431_100432973 | 3300006847 | Bacteria | 1313 |
| 195 | Ga0075433_10035210 | 3300006852 | Bacteria | 4304 |
| 196 | Ga0075433_10272836 | 3300006852 | Bacteria | 1499 |
| 197 | Ga0075434_100100364 | 3300006871 | Bacteria | 2900 |
| 198 | Ga0075429_100001166 | 3300006880 | Bacteria | 21212 |
| 199 | Ga0075429_100003288 | 3300006880 | Bacteria | 13756 |
| 200 | Ga0075429_100004700 | 3300006880 | Bacteria | 11750 |
| 201 | Ga0075429_100047699 | 3300006880 | Bacteria | 3726 |
| 202 | Ga0075429_100131214 | 3300006880 | Bacteria | 2192 |
| 203 | Ga0075429_100144630 | 3300006880 | Bacteria | 2081 |
| 204 | Ga0075429_100264330 | 3300006880 | Bacteria | 1507 |
| 205 | Ga0075429_100521353 | 3300006880 | Bacteria | 1041 |
| 206 | Ga0068865_100036260 | 3300006881 | Bacteria | 3323 |
| 207 | Ga0068865_100059793 | 3300006881 | Bacteria | 2666 |
| 208 | Ga0068865_100064080 | 3300006881 | Bacteria | 2586 |
| 209 | Ga0068865_100232198 | 3300006881 | Bacteria | 1448 |
| 210 | Ga0075436_100035555 | 3300006914 | Bacteria | 3436 |
| 211 | Ga0097620_100038389 | 3300006931 | Bacteria | 4805 |
| 212 | Ga0097620_100049836 | 3300006931 | Bacteria | 4206 |
| 213 | Ga0097620_100242983 | 3300006931 | Bacteria | 1890 |
| 214 | Ga0105240_10202343 | 3300009093 | Bacteria | 2326 |
| 215 | Ga0105240_10547015 | 3300009093 | Bacteria | 1281 |
| 216 | Ga0111539_10008690 | 3300009094 | Bacteria | 12890 |
| 217 | Ga0111539_10059988 | 3300009094 | Bacteria | 4509 |
| 218 | Ga0111539_10081413 | 3300009094 | Bacteria | 3808 |
| 219 | Ga0111539_10121671 | 3300009094 | Bacteria | 3058 |
| 220 | Ga0111539_10137421 | 3300009094 | Bacteria | 2862 |
| 221 | Ga0111539_10137909 | 3300009094 | Bacteria | 2857 |
| 222 | Ga0111539_10268456 | 3300009094 | Bacteria | 1986 |
| 223 | Ga0111539_10315418 | 3300009094 | Bacteria | 1819 |
| 224 | Ga0111539_10357808 | 3300009094 | Bacteria | 1699 |
| 225 | Ga0111539_10760519 | 3300009094 | Bacteria | 1128 |
| 226 | Ga0105245_10039562 | 3300009098 | Bacteria | 4197 |
| 227 | Ga0105245_10041639 | 3300009098 | Bacteria | 4094 |
| 228 | Ga0105245_10411317 | 3300009098 | Bacteria | 1354 |
| 229 | Ga0105247_10046136 | 3300009101 | Bacteria | 2674 |
| 230 | Ga0114129_10013234 | 3300009147 | Bacteria | 11750 |
| 231 | Ga0114129_10033068 | 3300009147 | Bacteria | 7309 |
| 232 | Ga0114129_10043279 | 3300009147 | Bacteria | 6335 |
| 233 | Ga0114129_10183448 | 3300009147 | Bacteria | 2846 |
| 234 | Ga0114129_10238681 | 3300009147 | Bacteria | 2444 |
| 235 | Ga0114129_10348568 | 3300009147 | Bacteria | 1962 |
| 236 | Ga0114129_10563445 | 3300009147 | Bacteria | 1480 |
| 237 | Ga0105243_10035607 | 3300009148 | Bacteria | 3860 |
| 238 | Ga0105243_10100000 | 3300009148 | Bacteria | 2405 |
| 239 | Ga0105243_10122737 | 3300009148 | Bacteria | 2193 |
| 240 | Ga0105243_10254320 | 3300009148 | Bacteria | 1570 |
| 241 | Ga0105243_10520870 | 3300009148 | Bacteria | 1131 |
| 242 | Ga0105241_10072501 | 3300009174 | Bacteria | 2677 |
| 243 | Ga0105242_10030307 | 3300009176 | Bacteria | 4320 |
| 244 | Ga0105242_10104555 | 3300009176 | Bacteria | 2404 |
| 245 | Ga0105242_10181157 | 3300009176 | Bacteria | 1859 |
| 246 | Ga0105248_10087502 | 3300009177 | Bacteria | 3506 |
| 247 | Ga0105248_10158140 | 3300009177 | Bacteria | 2557 |
| 248 | Ga0105238_10038782 | 3300009551 | Bacteria | 4836 |
| 249 | Ga0105238_10096099 | 3300009551 | Bacteria | 2949 |
| 250 | Ga0105238_10327807 | 3300009551 | Bacteria | 1517 |
| 251 | Ga0105249_10002497 | 3300009553 | Bacteria | 15920 |
| 252 | Ga0105249_10298265 | 3300009553 | Bacteria | 1615 |
| 253 | Ga0105249_10416330 | 3300009553 | Bacteria | 1377 |
| 254 | Ga0105239_10052822 | 3300010375 | Bacteria | 4457 |
| 255 | Ga0105239_10152239 | 3300010375 | Bacteria | 2582 |
| 256 | Ga0105239_10324882 | 3300010375 | Bacteria | 1735 |
| 257 | Ga0105246_10049177 | 3300011119 | Bacteria | 2886 |
| 258 | Ga0105246_10114755 | 3300011119 | Bacteria | 1985 |
| 259 | Ga0105246_10172615 | 3300011119 | Bacteria | 1657 |
| 260 | Ga0105246_10363322 | 3300011119 | Bacteria | 1190 |
| 261 | Ga0157371_10061279 | 3300013102 | Bacteria | 2667 |
| 262 | Ga0157374_10123125 | 3300013296 | Bacteria | 2505 |
| 263 | Ga0157378_10737456 | 3300013297 | Bacteria | 1007 |
| 264 | Ga0163162_10081796 | 3300013306 | Bacteria | 3301 |
| 265 | Ga0163162_10794903 | 3300013306 | Bacteria | 1064 |
| 266 | Ga0157372_10067081 | 3300013307 | Bacteria | 4031 |
| 267 | Ga0157372_10108401 | 3300013307 | Bacteria | 3178 |
| 268 | Ga0157372_10300965 | 3300013307 | Bacteria | 1865 |
| 269 | Ga0157372_10553710 | 3300013307 | Bacteria | 1341 |
| 270 | Ga0157375_10136867 | 3300013308 | Bacteria | 2574 |
| 271 | Ga0157375_10380097 | 3300013308 | Bacteria | 1579 |
| 272 | Ga0157375_10740519 | 3300013308 | Bacteria | 1135 |
| 273 | Ga0163163_10096702 | 3300014325 | Bacteria | 2974 |
| 274 | Ga0163163_10103012 | 3300014325 | Bacteria | 2878 |
| 275 | Ga0163163_10197777 | 3300014325 | Bacteria | 2058 |
| 276 | Ga0163163_10267244 | 3300014325 | Bacteria | 1762 |
| 277 | Ga0163163_10385625 | 3300014325 | Unclassified | 1459 |
| 278 | Ga0157380_10047519 | 3300014326 | Bacteria | 3377 |
| 279 | Ga0157380_10129723 | 3300014326 | Bacteria | 2149 |
| 280 | Ga0157380_10538289 | 3300014326 | Bacteria | 1143 |
| 281 | Ga0157380_10562006 | 3300014326 | Bacteria | 1121 |
| 282 | Ga0157380_10588274 | 3300014326 | Bacteria | 1099 |
| 283 | Ga0182008_10082412 | 3300014497 | Bacteria | 1583 |
| 284 | Ga0157377_10009126 | 3300014745 | Bacteria | 4857 |
| 285 | Ga0157377_10439888 | 3300014745 | Bacteria | 898 |
| 286 | Ga0157379_10163590 | 3300014968 | Bacteria | 2008 |
| 287 | Ga0157379_10276812 | 3300014968 | Bacteria | 1527 |
| 288 | Ga0157379_10448881 | 3300014968 | Bacteria | 1190 |
| 289 | Ga0157376_10045570 | 3300014969 | Bacteria | 3612 |
| 290 | Ga0157376_10071200 | 3300014969 | Bacteria | 2954 |
| 291 | Ga0163161_10081962 | 3300017792 | Bacteria | 2376 |
| 292 | Ga0163161_10131546 | 3300017792 | Bacteria | 1888 |
| 293 | Ga0206353_11223501 | 3300020082 | Bacteria | 1347 |
| 294 | Ga0207426_1059139 | 3300025302 | Bacteria | 1109 |
| 295 | Ga0207682_10187268 | 3300025893 | Bacteria | 947 |
| 296 | Ga0207642_10105205 | 3300025899 | Bacteria | 1425 |
| 297 | Ga0207688_10016881 | 3300025901 | Bacteria | 3965 |
| 298 | Ga0207688_10036391 | 3300025901 | Bacteria | 2728 |
| 299 | Ga0207680_10278277 | 3300025903 | Bacteria | 1162 |
| 300 | Ga0207647_10021889 | 3300025904 | Bacteria | 4256 |
| 301 | Ga0207645_10064369 | 3300025907 | Bacteria | 2343 |
| 302 | Ga0207643_10048389 | 3300025908 | Bacteria | 2408 |
| 303 | Ga0207643_10135575 | 3300025908 | Bacteria | 1467 |
| 304 | Ga0207705_10002123 | 3300025909 | Bacteria | 15388 |
| 305 | Ga0207705_10013197 | 3300025909 | Bacteria | 5964 |
| 306 | Ga0207705_10030861 | 3300025909 | Bacteria | 3825 |
| 307 | Ga0207707_10139507 | 3300025912 | Bacteria | 2120 |
| 308 | Ga0207695_10004617 | 3300025913 | Bacteria | 18682 |
| 309 | Ga0207660_10345055 | 3300025917 | Bacteria | 1192 |
| 310 | Ga0207657_10001138 | 3300025919 | Bacteria | 28229 |
| 311 | Ga0207657_10028407 | 3300025919 | Bacteria | 5103 |
| 312 | Ga0207657_10294684 | 3300025919 | Bacteria | 1286 |
| 313 | Ga0207657_10297142 | 3300025919 | Bacteria | 1280 |
| 314 | Ga0207657_10317004 | 3300025919 | Bacteria | 1233 |
| 315 | Ga0207649_10020612 | 3300025920 | Bacteria | 3782 |
| 316 | Ga0207649_10079656 | 3300025920 | Bacteria | 2117 |
| 317 | Ga0207646_10044515 | 3300025922 | Bacteria | 3985 |
| 318 | Ga0207646_10314340 | 3300025922 | Bacteria | 1415 |
| 319 | Ga0207681_10151818 | 3300025923 | Bacteria | 1737 |
| 320 | Ga0207681_10504880 | 3300025923 | Bacteria | 990 |
| 321 | Ga0207681_10582520 | 3300025923 | Bacteria | 923 |
| 322 | Ga0207694_10010017 | 3300025924 | Bacteria | 7144 |
| 323 | Ga0207650_10006120 | 3300025925 | Bacteria | 8199 |
| 324 | Ga0207650_10424144 | 3300025925 | Bacteria | 1104 |
| 325 | Ga0207659_10193525 | 3300025926 | Bacteria | 1619 |
| 326 | Ga0207659_10306903 | 3300025926 | Bacteria | 1305 |
| 327 | Ga0207659_10375175 | 3300025926 | Bacteria | 1185 |
| 328 | Ga0207659_10559143 | 3300025926 | Bacteria | 973 |
| 329 | Ga0207687_10018414 | 3300025927 | Bacteria | 4610 |
| 330 | Ga0207687_10030837 | 3300025927 | Bacteria | 3618 |
| 331 | Ga0207644_10038542 | 3300025931 | Bacteria | 3368 |
| 332 | Ga0207644_10064475 | 3300025931 | Bacteria | 2662 |
| 333 | Ga0207690_10096274 | 3300025932 | Bacteria | 2104 |
| 334 | Ga0207690_10402741 | 3300025932 | Bacteria | 1091 |
| 335 | Ga0207706_10023631 | 3300025933 | Bacteria | 5520 |
| 336 | Ga0207706_10089715 | 3300025933 | Bacteria | 2703 |
| 337 | Ga0207686_10020647 | 3300025934 | Bacteria | 3766 |
| 338 | Ga0207686_10059068 | 3300025934 | Bacteria | 2421 |
| 339 | Ga0207686_10461754 | 3300025934 | Bacteria | 979 |
| 340 | Ga0207709_10015196 | 3300025935 | Bacteria | 4267 |
| 341 | Ga0207709_10020150 | 3300025935 | Bacteria | 3759 |
| 342 | Ga0207669_10006019 | 3300025937 | Bacteria | 5503 |
| 343 | Ga0207669_10039257 | 3300025937 | Bacteria | 2734 |
| 344 | Ga0207669_10075544 | 3300025937 | Bacteria | 2135 |
| 345 | Ga0207704_10038463 | 3300025938 | Bacteria | 2775 |
| 346 | Ga0207704_10065645 | 3300025938 | Bacteria | 2273 |
| 347 | Ga0207704_10072194 | 3300025938 | Bacteria | 2193 |
| 348 | Ga0207704_10255167 | 3300025938 | Bacteria | 1319 |
| 349 | Ga0207691_10041610 | 3300025940 | Bacteria | 4241 |
| 350 | Ga0207691_10044419 | 3300025940 | Bacteria | 4091 |
| 351 | Ga0207691_10173734 | 3300025940 | Bacteria | 1885 |
| 352 | Ga0207691_10250954 | 3300025940 | Bacteria | 1527 |
| 353 | Ga0207711_10113217 | 3300025941 | Bacteria | 2415 |
| 354 | Ga0207689_10029116 | 3300025942 | Bacteria | 4615 |
| 355 | Ga0207689_10071972 | 3300025942 | Bacteria | 2840 |
| 356 | Ga0207689_10095522 | 3300025942 | Bacteria | 2441 |
| 357 | Ga0207689_10516871 | 3300025942 | Bacteria | 1001 |
| 358 | Ga0207689_10585097 | 3300025942 | Bacteria | 938 |
| 359 | Ga0207661_10427951 | 3300025944 | Bacteria | 1203 |
| 360 | Ga0207661_10529543 | 3300025944 | Unclassified | 1078 |
| 361 | Ga0207679_10002463 | 3300025945 | Bacteria | 11399 |
| 362 | Ga0207679_10413219 | 3300025945 | Bacteria | 1189 |
| 363 | Ga0207679_10510108 | 3300025945 | Bacteria | 1074 |
| 364 | Ga0207667_10025589 | 3300025949 | Bacteria | 6457 |
| 365 | Ga0207667_10074146 | 3300025949 | Bacteria | 3535 |
| 366 | Ga0207667_10149044 | 3300025949 | Bacteria | 2408 |
| 367 | Ga0207651_10147920 | 3300025960 | Bacteria | 1824 |
| 368 | Ga0207712_10248203 | 3300025961 | Bacteria | 1437 |
| 369 | Ga0207712_10296183 | 3300025961 | Bacteria | 1326 |
| 370 | Ga0207712_10384915 | 3300025961 | Bacteria | 1175 |
| 371 | Ga0207668_10095859 | 3300025972 | Bacteria | 2191 |
| 372 | Ga0207668_10358386 | 3300025972 | Bacteria | 1221 |
| 373 | Ga0207640_10003259 | 3300025981 | Bacteria | 8750 |
| 374 | Ga0207640_10028606 | 3300025981 | Bacteria | 3410 |
| 375 | Ga0207658_10089775 | 3300025986 | Bacteria | 2380 |
| 376 | Ga0207658_10098308 | 3300025986 | Bacteria | 2287 |
| 377 | Ga0207639_10079382 | 3300026041 | Bacteria | 2593 |
| 378 | Ga0207639_10171574 | 3300026041 | Bacteria | 1837 |
| 379 | Ga0207639_10484977 | 3300026041 | Bacteria | 1127 |
| 380 | Ga0207678_10001614 | 3300026067 | Bacteria | 20747 |
| 381 | Ga0207708_10021383 | 3300026075 | Bacteria | 4878 |
| 382 | Ga0207708_10096513 | 3300026075 | Bacteria | 2284 |
| 383 | Ga0207708_10236944 | 3300026075 | Bacteria | 1467 |
| 384 | Ga0207702_10981586 | 3300026078 | Bacteria | 838 |
| 385 | Ga0207641_10049012 | 3300026088 | Bacteria | 3568 |
| 386 | Ga0207641_10504156 | 3300026088 | Bacteria | 1176 |
| 387 | Ga0207648_10056939 | 3300026089 | Bacteria | 3411 |
| 388 | Ga0207648_10070364 | 3300026089 | Bacteria | 3050 |
| 389 | Ga0207648_10105618 | 3300026089 | Bacteria | 2471 |
| 390 | Ga0207648_10174394 | 3300026089 | Bacteria | 1901 |
| 391 | Ga0207674_10682938 | 3300026116 | Bacteria | 991 |
| 392 | Ga0207675_100109639 | 3300026118 | Bacteria | 2604 |
| 393 | Ga0207675_100189636 | 3300026118 | Bacteria | 1971 |
| 394 | Ga0207675_100389911 | 3300026118 | Bacteria | 1371 |
| 395 | Ga0207675_100517008 | 3300026118 | Bacteria | 1190 |
| 396 | Ga0207683_10128796 | 3300026121 | Bacteria | 2276 |
| 397 | Ga0207683_10129707 | 3300026121 | Bacteria | 2267 |
| 398 | Ga0207683_10245640 | 3300026121 | Bacteria | 1633 |
| 399 | Ga0207683_10301819 | 3300026121 | Bacteria | 1465 |
| 400 | Ga0207683_10308742 | 3300026121 | Bacteria | 1448 |
| 401 | Ga0207683_10404354 | 3300026121 | Bacteria | 1256 |
| 402 | Ga0207698_10014070 | 3300026142 | Bacteria | 5304 |
| 403 | Ga0209970_1006919 | 3300027614 | Bacteria | 1861 |
| 404 | Ga0207428_10000181 | 3300027907 | Bacteria | 88299 |
| 405 | Ga0207428_10000940 | 3300027907 | Bacteria | 32377 |
| 406 | Ga0207428_10013218 | 3300027907 | Bacteria | 7223 |
| 407 | Ga0207428_10028260 | 3300027907 | Bacteria | 4661 |
| 408 | Ga0207428_10033089 | 3300027907 | Bacteria | 4248 |
| 409 | Ga0268266_10112398 | 3300028379 | Bacteria | 2415 |
| 410 | Ga0268265_10069296 | 3300028380 | Bacteria | 2738 |
| 411 | Ga0268265_10283140 | 3300028380 | Bacteria | 1484 |
| 412 | Ga0268264_10102520 | 3300028381 | Bacteria | 2490 |
| 413 | Ga0265332_10001239 | 3300031238 | Bacteria | 14770 |
| 414 | Ga0265332_10032007 | 3300031238 | Bacteria | 2293 |
| 415 | Ga0307408_100014713 | 3300031548 | Bacteria | 5200 |
| 416 | Ga0307408_100092663 | 3300031548 | Bacteria | 2284 |
| 417 | Ga0307408_100147495 | 3300031548 | Bacteria | 1854 |
| 418 | Ga0307408_100345762 | 3300031548 | Bacteria | 1260 |
| 419 | Ga0265314_10021536 | 3300031711 | Bacteria | 4952 |
| 420 | Ga0307405_10015462 | 3300031731 | Bacteria | 4135 |
| 421 | Ga0307405_10019483 | 3300031731 | Bacteria | 3770 |
| 422 | Ga0307405_10158482 | 3300031731 | Bacteria | 1600 |
| 423 | Ga0307405_10222253 | 3300031731 | Bacteria | 1386 |
| 424 | Ga0307405_10285619 | 3300031731 | Bacteria | 1244 |
| 425 | Ga0307413_10034092 | 3300031824 | Bacteria | 2906 |
| 426 | Ga0307413_10065310 | 3300031824 | Bacteria | 2265 |
| 427 | Ga0307413_10073821 | 3300031824 | Bacteria | 2158 |
| 428 | Ga0307413_10270250 | 3300031824 | Bacteria | 1272 |
| 429 | Ga0307413_10324475 | 3300031824 | Bacteria | 1177 |
| 430 | Ga0307410_10006908 | 3300031852 | Bacteria | 6167 |
| 431 | Ga0307410_10035246 | 3300031852 | Bacteria | 3248 |
| 432 | Ga0307410_10144593 | 3300031852 | Bacteria | 1763 |
| 433 | Ga0307410_10334978 | 3300031852 | Bacteria | 1204 |
| 434 | Ga0307406_10150192 | 3300031901 | Bacteria | 1661 |
| 435 | Ga0307406_10172563 | 3300031901 | Bacteria | 1566 |
| 436 | Ga0307406_10290417 | 3300031901 | Bacteria | 1251 |
| 437 | Ga0307406_10323186 | 3300031901 | Bacteria | 1194 |
| 438 | Ga0307407_10008769 | 3300031903 | Bacteria | 4665 |
| 439 | Ga0307407_10011716 | 3300031903 | Bacteria | 4187 |
| 440 | Ga0307407_10092500 | 3300031903 | Bacteria | 1857 |
| 441 | Ga0307407_10113495 | 3300031903 | Bacteria | 1705 |
| 442 | Ga0307407_10136373 | 3300031903 | Bacteria | 1577 |
| 443 | Ga0307407_10178470 | 3300031903 | Bacteria | 1405 |
| 444 | Ga0307407_10225928 | 3300031903 | Bacteria | 1268 |
| 445 | Ga0307412_10032184 | 3300031911 | Bacteria | 3320 |
| 446 | Ga0307412_10035950 | 3300031911 | Bacteria | 3169 |
| 447 | Ga0307412_10152866 | 3300031911 | Bacteria | 1705 |
| 448 | Ga0307412_10201863 | 3300031911 | Bacteria | 1510 |
| 449 | Ga0307409_100004038 | 3300031995 | Bacteria | 8151 |
| 450 | Ga0307409_100022546 | 3300031995 | Bacteria | 4344 |
| 451 | Ga0307409_100029424 | 3300031995 | Bacteria | 3931 |
| 452 | Ga0307409_100057205 | 3300031995 | Bacteria | 3020 |
| 453 | Ga0307409_100252009 | 3300031995 | Bacteria | 1614 |
| 454 | Ga0307409_100396684 | 3300031995 | Bacteria | 1316 |
| 455 | Ga0307409_100855575 | 3300031995 | Bacteria | 920 |
| 456 | Ga0307416_100011128 | 3300032002 | Bacteria | 5984 |
| 457 | Ga0307416_100031363 | 3300032002 | Bacteria | 4000 |
| 458 | Ga0307416_100116548 | 3300032002 | Bacteria | 2368 |
| 459 | Ga0307416_100124086 | 3300032002 | Bacteria | 2309 |
| 460 | Ga0307416_100159512 | 3300032002 | Bacteria | 2082 |
| 461 | Ga0307416_100348465 | 3300032002 | Bacteria | 1497 |
| 462 | Ga0307416_100358908 | 3300032002 | Bacteria | 1478 |
| 463 | Ga0307416_100656510 | 3300032002 | Bacteria | 1134 |
| 464 | Ga0307414_10018571 | 3300032004 | Bacteria | 4287 |
| 465 | Ga0307414_10206247 | 3300032004 | Bacteria | 1603 |
| 466 | Ga0307414_10293640 | 3300032004 | Bacteria | 1371 |
| 467 | Ga0307414_10351472 | 3300032004 | Bacteria | 1265 |
| 468 | Ga0307411_10010242 | 3300032005 | Bacteria | 4985 |
| 469 | Ga0307411_10037532 | 3300032005 | Bacteria | 3047 |
| 470 | Ga0307415_100002882 | 3300032126 | Bacteria | 8614 |
| 471 | Ga0307415_100007232 | 3300032126 | Bacteria | 6060 |
| 472 | Ga0307415_100010203 | 3300032126 | Bacteria | 5306 |
| 473 | Ga0307415_100030385 | 3300032126 | Bacteria | 3467 |
| 474 | Ga0307415_100032143 | 3300032126 | Bacteria | 3390 |
| 475 | Ga0307415_100222013 | 3300032126 | Bacteria | 1515 |
| 476 | Ga0373959_0030331 | 3300034820 | Unclassified | 1089 |
| 477 | Ga0373938_0045743 | 3300034957 | Bacteria | 986 |
| 478 | Ga0373928_0006299 | 3300035084 | Bacteria | 2282 |
| 479 | Ga0373951_0025306 | 3300035091 | Bacteria | 1378 |
| 480 | Ga0373943_0027797 | 3300035170 | Bacteria | 2661 |
| 481 | Ga0373942_0036068 | 3300035207 | Unclassified | 1330 |
| 482 | Ga0316574_0063247 | 3300035398 | Bacteria | 2327 |
| 483 | Ga0373931_0113159 | 3300035691 | Bacteria | 1542 |
| 484 | Ga0316584_0026232 | 3300036712 | Bacteria | 4282 |
| 485 | Ga0395899_0111746 | 3300037312 | Bacteria | 1964 |
| 486 | Ga0395900_0143240 | 3300037418 | Bacteria | 2446 |
| 487 | Ga0395898_0042694 | 3300037466 | Bacteria | 4472 |
| 488 | Ga0395898_0189316 | 3300037466 | Bacteria | 1966 |
| 489 | Ga0395905_0319552 | 3300037471 | Bacteria | 1442 |
| 490 | Ga0395901_0317491 | 3300038443 | Bacteria | 1612 |
| 491 | Ga0395901_0815525 | 3300038443 | Bacteria | 921 |
| 492 | Ga0439438_010111 | 3300041405 | Bacteria | 3007 |
| 493 | Ga0439453_0007832 | 3300041408 | Bacteria | 1704 |
| 494 | Ga0439461_0005197 | 3300041410 | Bacteria | 2210 |
| 495 | Ga0451833_0895723 | 3300041491 | Bacteria | 2705 |
| 496 | Ga0451853_1858440 | 3300041512 | Bacteria | 1131 |
| 497 | Ga0439443_004916 | 3300042003 | Bacteria | 1767 |
| 498 | Ga0439448_0002950 | 3300042005 | Bacteria | 4669 |
| 499 | Ga0439448_0007317 | 3300042005 | Bacteria | 3196 |
| 500 | Ga0439448_0011384 | 3300042005 | Bacteria | 2651 |
| 501 | Ga0439450_000158 | 3300042008 | Bacteria | 7562 |
| 502 | Ga0439451_009707 | 3300042009 | Bacteria | 1944 |
| 503 | Ga0439451_015542 | 3300042009 | Bacteria | 1535 |
| 504 | Ga0439455_0001859 | 3300042012 | Bacteria | 3688 |
| 505 | Ga0439455_0024108 | 3300042012 | Bacteria | 1470 |
| 506 | Ga0439456_012546 | 3300042013 | Bacteria | 1757 |
| 507 | Ga0439463_015155 | 3300042016 | Bacteria | 1905 |
| 508 | Ga0439463_021445 | 3300042016 | Bacteria | 1613 |
| 509 | Ga0450912_008071 | 3300042116 | Bacteria | 867 |
| 510 | Ga0450914_000145 | 3300042118 | Bacteria | 2457 |
| 511 | Ga0450914_000312 | 3300042118 | Bacteria | 2080 |
| 512 | Ga0450920_007738 | 3300042122 | Bacteria | 1950 |
| 513 | Ga0450902_013431 | 3300042137 | Bacteria | 1319 |
| 514 | Ga0450905_012360 | 3300042142 | Bacteria | 1201 |
| 515 | Ga0439446_0065709 | 3300042156 | Bacteria | 1103 |
| 516 | Ga0439435_0020022 | 3300042436 | Bacteria | 1721 |
| 517 | Ga0439435_0047856 | 3300042436 | Bacteria | 1216 |
| 518 | Ga0439444_0000598 | 3300042437 | Bacteria | 4144 |
| 519 | Ga0439464_0002755 | 3300042439 | Bacteria | 4361 |
| 520 | Ga0439464_0052653 | 3300042439 | Bacteria | 1179 |
| 521 | Ga0439460_0003395 | 3300042461 | Bacteria | 3851 |
| 522 | Ga0439460_0072430 | 3300042461 | Bacteria | 1070 |
| 523 | Ga0450916_006767 | 3300042530 | Bacteria | 1359 |
| 524 | Ga0450916_019153 | 3300042530 | Bacteria | 927 |
| 525 | Ga0451577_0000018 | 3300042876 | Bacteria | 516495 |
| 526 | Ga0451577_0013304 | 3300042876 | Bacteria | 7707 |
| 527 | Ga0439440_0000656 | 3300042993 | Bacteria | 5899 |
| 528 | Ga0439440_0012907 | 3300042993 | Bacteria | 1783 |
| 529 | Ga0439440_0026233 | 3300042993 | Bacteria | 1347 |
| 530 | Ga0439440_0029805 | 3300042993 | Bacteria | 1282 |
| 531 | Ga0439440_0070224 | 3300042993 | Bacteria | 910 |
| 532 | Ga0453683_0010655 | 3300044673 | Bacteria | 6087 |
| 533 | Ga0453683_0127119 | 3300044673 | Bacteria | 1605 |
| 534 | Ga0453684_0000166 | 3300044712 | Bacteria | 294291 |
| 535 | Ga0453684_0215937 | 3300044712 | Bacteria | 2225 |
| 536 | Ga0466959_0109449 | 3300045049 | Bacteria | 1973 |
| 537 | Ga0451576_0076811 | 3300045051 | Bacteria | 3476 |
| 538 | Ga0466967_0120373 | 3300045976 | Bacteria | 2424 |
| 539 | Ga0495603_0009479 | 3300046455 | Bacteria | 5882 |
| 540 | Ga0495605_0146463 | 3300046474 | Bacteria | 1056 |
| 541 | Ga0495637_0155974 | 3300046520 | Bacteria | 859 |
| 542 | Ga0495644_0056701 | 3300046523 | Bacteria | 1472 |
| 543 | Ga0495656_0019032 | 3300046615 | Bacteria | 2645 |
| 544 | Ga0495656_0127864 | 3300046615 | Bacteria | 1206 |
| 545 | Ga0495668_0222359 | 3300046616 | Bacteria | 1034 |
| 546 | Ga0495635_0107545 | 3300046663 | Bacteria | 1905 |
| 547 | Ga0495661_0151986 | 3300046665 | Bacteria | 1250 |
| 548 | Ga0495658_0204978 | 3300046683 | Bacteria | 1230 |
| 549 | Ga0495613_0139481 | 3300046689 | Bacteria | 1733 |
| 550 | Ga0495589_0031760 | 3300046794 | Bacteria | 2658 |
| 551 | Ga0495676_0280356 | 3300047321 | Bacteria | 1129 |
| 552 | Ga0495680_0045513 | 3300047322 | Bacteria | 3464 |
| 553 | Ga0495675_0140580 | 3300047444 | Bacteria | 1497 |
| 554 | Ga0495677_0051812 | 3300047445 | Bacteria | 1512 |
| 555 | Ga0495684_0116625 | 3300047471 | Bacteria | 2013 |
| 556 | Ga0496101_0057739 | 3300048904 | Bacteria | 2808 |
| 557 | Ga0496101_0229900 | 3300048904 | Bacteria | 1441 |
| 558 | Ga0496102_0402721 | 3300048905 | Bacteria | 1286 |
| 559 | Ga0496103_0122877 | 3300048906 | Bacteria | 1655 |
| 560 | Ga0496103_0257920 | 3300048906 | Bacteria | 1122 |
| 561 | Ga0496104_0007555 | 3300048907 | Bacteria | 9614 |
| 562 | Ga0496104_0106807 | 3300048907 | Bacteria | 2683 |
| 563 | Ga0496104_0159220 | 3300048907 | Bacteria | 2166 |
| 564 | Ga0496105_0069692 | 3300048908 | Bacteria | 2906 |
| 565 | Ga0496105_0233566 | 3300048908 | Bacteria | 1494 |
| 566 | Ga0496106_0081380 | 3300048909 | Bacteria | 2488 |
| 567 | Ga0496107_0023742 | 3300048910 | Bacteria | 4334 |
| 568 | Ga0496108_0003558 | 3300048911 | Bacteria | 12496 |
| 569 | Ga0496108_0014247 | 3300048911 | Bacteria | 6488 |
| 570 | Ga0496108_0099031 | 3300048911 | Bacteria | 2484 |
| 571 | Ga0496108_0134961 | 3300048911 | Bacteria | 2122 |
| 572 | Ga0496109_0001514 | 3300048912 | Bacteria | 19323 |
| 573 | Ga0496109_0004877 | 3300048912 | Bacteria | 11204 |
| 574 | Ga0496109_0026271 | 3300048912 | Bacteria | 5191 |
| 575 | Ga0496110_0002017 | 3300048913 | Bacteria | 15118 |
| 576 | Ga0496110_0017812 | 3300048913 | Bacteria | 5945 |
| 577 | Ga0496110_0166123 | 3300048913 | Bacteria | 2001 |
| 578 | Ga0496110_0257401 | 3300048913 | Bacteria | 1589 |
| 579 | Ga0496111_0013343 | 3300048914 | Bacteria | 5588 |
| 580 | Ga0496111_0027483 | 3300048914 | Bacteria | 4025 |
| 581 | Ga0496111_0096517 | 3300048914 | Bacteria | 2169 |
| 582 | Ga0496112_0003519 | 3300048915 | Bacteria | 12986 |
| 583 | Ga0496112_0055411 | 3300048915 | Bacteria | 3898 |
| 584 | Ga0496112_0307749 | 3300048915 | Bacteria | 1530 |
| 585 | Ga0496113_0039042 | 3300048916 | Bacteria | 3493 |
| 586 | Ga0496115_0054304 | 3300048918 | Bacteria | 3217 |
| 587 | Ga0501031_0001922 | 3300049568 | Bacteria | 13097 |
| 588 | Ga0501031_0004586 | 3300049568 | Bacteria | 8959 |
| 589 | Ga0501031_0005873 | 3300049568 | Bacteria | 7999 |
| 590 | Ga0501031_0007546 | 3300049568 | Bacteria | 7084 |
| 591 | Ga0501031_0033548 | 3300049568 | Bacteria | 3349 |
| 592 | Ga0501031_0102679 | 3300049568 | Bacteria | 1866 |
| 593 | Ga0501032_0017685 | 3300049569 | Bacteria | 5004 |
| 594 | Ga0501032_0038857 | 3300049569 | Bacteria | 3239 |
| 595 | Ga0501032_0067085 | 3300049569 | Bacteria | 2397 |
| 596 | Ga0501032_0131475 | 3300049569 | Bacteria | 1651 |
| 597 | Ga0501032_0274223 | 3300049569 | Bacteria | 1092 |
| 598 | Ga0501033_0007757 | 3300049570 | Bacteria | 8317 |
| 599 | Ga0501033_0032916 | 3300049570 | Bacteria | 3892 |
| 600 | Ga0501033_0063188 | 3300049570 | Bacteria | 2725 |
| 601 | Ga0501033_0102821 | 3300049570 | Bacteria | 2084 |
| 602 | Ga0501034_0031799 | 3300049571 | Bacteria | 5360 |
| 603 | Ga0501034_0031978 | 3300049571 | Bacteria | 5345 |
| 604 | Ga0501034_0044352 | 3300049571 | Bacteria | 4498 |
| 605 | Ga0501034_0102501 | 3300049571 | Bacteria | 2855 |
| 606 | Ga0501034_0142596 | 3300049571 | Bacteria | 2374 |
| 607 | Ga0501034_0349449 | 3300049571 | Unclassified | 1407 |
| 608 | Ga0501036_0004359 | 3300049572 | Bacteria | 11418 |
| 609 | Ga0501036_0005127 | 3300049572 | Bacteria | 10584 |
| 610 | Ga0501036_0006733 | 3300049572 | Bacteria | 9341 |
| 611 | Ga0501036_0013364 | 3300049572 | Bacteria | 6820 |
| 612 | Ga0501036_0036626 | 3300049572 | Bacteria | 4152 |
| 613 | Ga0501036_0053873 | 3300049572 | Bacteria | 3405 |
| 614 | Ga0501036_0075975 | 3300049572 | Bacteria | 2841 |
| 615 | Ga0501036_0097244 | 3300049572 | Bacteria | 2489 |
| 616 | Ga0501036_0308793 | 3300049572 | Bacteria | 1322 |
| 617 | Ga0501036_0519720 | 3300049572 | Bacteria | 990 |
| 618 | Ga0501037_0005752 | 3300049573 | Bacteria | 9054 |
| 619 | Ga0501037_0006015 | 3300049573 | Bacteria | 8855 |
| 620 | Ga0501037_0033311 | 3300049573 | Bacteria | 3806 |
| 621 | Ga0501037_0043498 | 3300049573 | Bacteria | 3300 |
| 622 | Ga0501037_0100517 | 3300049573 | Bacteria | 2088 |
| 623 | Ga0501037_0105900 | 3300049573 | Bacteria | 2027 |
| 624 | Ga0501037_0188639 | 3300049573 | Bacteria | 1460 |
| 625 | Ga0501038_0001390 | 3300049574 | Bacteria | 22123 |
| 626 | Ga0501038_0008382 | 3300049574 | Bacteria | 9506 |
| 627 | Ga0501038_0034646 | 3300049574 | Bacteria | 4438 |
| 628 | Ga0501038_0036113 | 3300049574 | Bacteria | 4337 |
| 629 | Ga0501038_0071754 | 3300049574 | Bacteria | 2936 |
| 630 | Ga0501038_0129668 | 3300049574 | Bacteria | 2072 |
| 631 | Ga0501038_0201194 | 3300049574 | Bacteria | 1598 |
| 632 | Ga0501039_0000514 | 3300049575 | Bacteria | 27982 |
| 633 | Ga0501039_0007709 | 3300049575 | Bacteria | 8218 |
| 634 | Ga0501039_0009669 | 3300049575 | Bacteria | 7350 |
| 635 | Ga0501039_0018998 | 3300049575 | Bacteria | 5274 |
| 636 | Ga0501039_0033719 | 3300049575 | Bacteria | 3949 |
| 637 | Ga0501039_0749935 | 3300049575 | Bacteria | 762 |
| 638 | Ga0501040_0001940 | 3300049576 | Bacteria | 13300 |
| 639 | Ga0501040_0002053 | 3300049576 | Bacteria | 12978 |
| 640 | Ga0501040_0002257 | 3300049576 | Bacteria | 12378 |
| 641 | Ga0501040_0003883 | 3300049576 | Bacteria | 9696 |
| 642 | Ga0501040_0055410 | 3300049576 | Bacteria | 2718 |
| 643 | Ga0501041_0001929 | 3300049577 | Bacteria | 11642 |
| 644 | Ga0501041_0002244 | 3300049577 | Bacteria | 10922 |
| 645 | Ga0501041_0005986 | 3300049577 | Bacteria | 7116 |
| 646 | Ga0501041_0033396 | 3300049577 | Bacteria | 3113 |
| 647 | Ga0501041_0038812 | 3300049577 | Bacteria | 2888 |
| 648 | Ga0501041_0269448 | 3300049577 | Bacteria | 1071 |
| 649 | Ga0501042_0000491 | 3300049578 | Bacteria | 20534 |
| 650 | Ga0501042_0002549 | 3300049578 | Bacteria | 11209 |
| 651 | Ga0501042_0005512 | 3300049578 | Bacteria | 8158 |
| 652 | Ga0501042_0025697 | 3300049578 | Bacteria | 4138 |
| 653 | Ga0501042_0030030 | 3300049578 | Bacteria | 3837 |
| 654 | Ga0501042_0032617 | 3300049578 | Bacteria | 3689 |
| 655 | Ga0501042_0113157 | 3300049578 | Bacteria | 1954 |
| 656 | Ga0501042_0258455 | 3300049578 | Bacteria | 1257 |
| 657 | Ga0501043_0001621 | 3300049579 | Bacteria | 19585 |
| 658 | Ga0501043_0007697 | 3300049579 | Bacteria | 8531 |
| 659 | Ga0501043_0012540 | 3300049579 | Bacteria | 6628 |
| 660 | Ga0501043_0076848 | 3300049579 | Bacteria | 2623 |
| 661 | Ga0501046_0002227 | 3300049580 | Bacteria | 18292 |
| 662 | Ga0501046_0005923 | 3300049580 | Bacteria | 10889 |
| 663 | Ga0501046_0008923 | 3300049580 | Bacteria | 8705 |
| 664 | Ga0501046_0033755 | 3300049580 | Bacteria | 4132 |
| 665 | Ga0501046_0059635 | 3300049580 | Bacteria | 2988 |
| 666 | Ga0501046_0093793 | 3300049580 | Bacteria | 2307 |
| 667 | Ga0501047_0002716 | 3300049581 | Bacteria | 16841 |
| 668 | Ga0501047_0063801 | 3300049581 | Bacteria | 3553 |
| 669 | Ga0501047_0210979 | 3300049581 | Bacteria | 1800 |
| 670 | Ga0501047_0260289 | 3300049581 | Bacteria | 1583 |
| 671 | Ga0501048_0005257 | 3300049582 | Bacteria | 9858 |
| 672 | Ga0501048_0015076 | 3300049582 | Bacteria | 5713 |
| 673 | Ga0501048_0015470 | 3300049582 | Bacteria | 5636 |
| 674 | Ga0501048_0020579 | 3300049582 | Bacteria | 4835 |
| 675 | Ga0501048_0028320 | 3300049582 | Bacteria | 4066 |
| 676 | Ga0501048_0056455 | 3300049582 | Bacteria | 2785 |
| 677 | Ga0501067_0013588 | 3300049583 | Bacteria | 4508 |
| 678 | Ga0501067_0021994 | 3300049583 | Bacteria | 3528 |
| 679 | Ga0501067_0043193 | 3300049583 | Bacteria | 2503 |
| 680 | Ga0501067_0134687 | 3300049583 | Bacteria | 1375 |
| 681 | Ga0501067_0172639 | 3300049583 | Bacteria | 1204 |
| 682 | Ga0501068_0002839 | 3300049584 | Bacteria | 9214 |
| 683 | Ga0501068_0008513 | 3300049584 | Bacteria | 5711 |
| 684 | Ga0501068_0037954 | 3300049584 | Bacteria | 2884 |
| 685 | Ga0501069_0001652 | 3300049585 | Bacteria | 11081 |
| 686 | Ga0501069_0008294 | 3300049585 | Bacteria | 5455 |
| 687 | Ga0501069_0013440 | 3300049585 | Bacteria | 4365 |
| 688 | Ga0501069_0016338 | 3300049585 | Bacteria | 3985 |
| 689 | Ga0501069_0147419 | 3300049585 | Bacteria | 1351 |
| 690 | Ga0501070_0081775 | 3300049586 | Bacteria | 2673 |
| 691 | Ga0501070_0575994 | 3300049586 | Bacteria | 899 |
| 692 | Ga0501071_0001083 | 3300049587 | Bacteria | 15121 |
| 693 | Ga0501071_0004817 | 3300049587 | Bacteria | 8596 |
| 694 | Ga0501071_0006237 | 3300049587 | Bacteria | 7736 |
| 695 | Ga0501071_0013395 | 3300049587 | Bacteria | 5587 |
| 696 | Ga0501071_0026294 | 3300049587 | Bacteria | 4084 |
| 697 | Ga0501071_0120360 | 3300049587 | Bacteria | 1946 |
| 698 | Ga0501071_0209544 | 3300049587 | Bacteria | 1465 |
| 699 | Ga0501071_0258831 | 3300049587 | Bacteria | 1314 |
| 700 | Ga0501071_0393464 | 3300049587 | Bacteria | 1058 |
| 701 | Ga0501071_0431586 | 3300049587 | Bacteria | 1007 |
| 702 | Ga0501072_0000404 | 3300049588 | Bacteria | 30870 |
| 703 | Ga0501072_0001268 | 3300049588 | Bacteria | 18858 |
| 704 | Ga0501072_0004161 | 3300049588 | Bacteria | 10950 |
| 705 | Ga0501072_0004858 | 3300049588 | Bacteria | 10228 |
| 706 | Ga0501072_0006223 | 3300049588 | Bacteria | 9089 |
| 707 | Ga0501072_0016036 | 3300049588 | Bacteria | 5745 |
| 708 | Ga0501072_0034100 | 3300049588 | Bacteria | 3989 |
| 709 | Ga0501072_0076749 | 3300049588 | Bacteria | 2644 |
| 710 | Ga0501072_0479462 | 3300049588 | Bacteria | 984 |
| 711 | Ga0501073_0019204 | 3300049589 | Bacteria | 4938 |
| 712 | Ga0501073_0028494 | 3300049589 | Bacteria | 3991 |
| 713 | Ga0501073_0040361 | 3300049589 | Bacteria | 3303 |
| 714 | Ga0501073_0050481 | 3300049589 | Bacteria | 2915 |
| 715 | Ga0501073_0148326 | 3300049589 | Bacteria | 1625 |
| 716 | Ga0501074_0003320 | 3300049590 | Bacteria | 11387 |
| 717 | Ga0501074_0004221 | 3300049590 | Bacteria | 10271 |
| 718 | Ga0501074_0009917 | 3300049590 | Bacteria | 6920 |
| 719 | Ga0501074_0014693 | 3300049590 | Bacteria | 5694 |
| 720 | Ga0501074_0283510 | 3300049590 | Bacteria | 1177 |
| 721 | Ga0501075_0002542 | 3300049591 | Bacteria | 12148 |
| 722 | Ga0501075_0003018 | 3300049591 | Bacteria | 11243 |
| 723 | Ga0501075_0003133 | 3300049591 | Bacteria | 11058 |
| 724 | Ga0501075_0061304 | 3300049591 | Bacteria | 2834 |
| 725 | Ga0501075_0071352 | 3300049591 | Bacteria | 2625 |
| 726 | Ga0501075_0238043 | 3300049591 | Bacteria | 1388 |
| 727 | Ga0501075_0535545 | 3300049591 | Bacteria | 894 |
| 728 | Ga0501076_0000287 | 3300049592 | Bacteria | 31492 |
| 729 | Ga0501076_0011794 | 3300049592 | Bacteria | 6526 |
| 730 | Ga0501076_0029915 | 3300049592 | Bacteria | 4239 |
| 731 | Ga0501076_0034406 | 3300049592 | Bacteria | 3960 |
| 732 | Ga0501076_0075450 | 3300049592 | Bacteria | 2702 |
| 733 | Ga0501076_0092160 | 3300049592 | Bacteria | 2438 |
| 734 | Ga0501076_0172123 | 3300049592 | Bacteria | 1765 |
| 735 | Ga0501076_0200483 | 3300049592 | Bacteria | 1629 |
| 736 | Ga0501076_0460314 | 3300049592 | Bacteria | 1047 |
| 737 | Ga0501077_0001393 | 3300049593 | Bacteria | 14562 |
| 738 | Ga0501077_0002156 | 3300049593 | Bacteria | 11896 |
| 739 | Ga0501077_0002626 | 3300049593 | Bacteria | 10761 |
| 740 | Ga0501077_0006182 | 3300049593 | Bacteria | 7314 |
| 741 | Ga0501077_0013855 | 3300049593 | Bacteria | 5055 |
| 742 | Ga0501077_0036232 | 3300049593 | Bacteria | 3142 |
| 743 | Ga0501079_0000178 | 3300049741 | Bacteria | 36110 |
| 744 | Ga0501079_0004169 | 3300049741 | Bacteria | 10711 |
| 745 | Ga0501079_0008393 | 3300049741 | Bacteria | 7829 |
| 746 | Ga0501079_0020897 | 3300049741 | Bacteria | 5006 |
| 747 | Ga0501079_0036766 | 3300049741 | Bacteria | 3771 |
| 748 | Ga0501079_0069872 | 3300049741 | Bacteria | 2711 |
| 749 | Ga0501079_0321536 | 3300049741 | Bacteria | 1211 |
| 750 | Ga0501080_0014568 | 3300049742 | Bacteria | 7243 |
| 751 | Ga0501080_0020334 | 3300049742 | Bacteria | 6143 |
| 752 | Ga0501080_0058666 | 3300049742 | Bacteria | 3582 |
| 753 | Ga0501080_0173642 | 3300049742 | Bacteria | 1986 |
| 754 | Ga0501080_0478342 | 3300049742 | Bacteria | 1114 |
| 755 | Ga0501080_0650926 | 3300049742 | Bacteria | 932 |
| 756 | Ga0501081_0004860 | 3300049743 | Bacteria | 8637 |
| 757 | Ga0501081_0008530 | 3300049743 | Bacteria | 6659 |
| 758 | Ga0501081_0016532 | 3300049743 | Bacteria | 4877 |
| 759 | Ga0501081_0077170 | 3300049743 | Bacteria | 2327 |
| 760 | Ga0501081_0227823 | 3300049743 | Bacteria | 1357 |
| 761 | Ga0501081_0255217 | 3300049743 | Bacteria | 1280 |
| 762 | Ga0501081_0408817 | 3300049743 | Bacteria | 1005 |
| 763 | Ga0501083_0005072 | 3300049744 | Bacteria | 9327 |
| 764 | Ga0501083_0022032 | 3300049744 | Bacteria | 4423 |
| 765 | Ga0501083_0043806 | 3300049744 | Bacteria | 3031 |
| 766 | Ga0501083_0044173 | 3300049744 | Bacteria | 3017 |
| 767 | Ga0501083_0066575 | 3300049744 | Bacteria | 2398 |
| 768 | Ga0501083_0205868 | 3300049744 | Bacteria | 1283 |
| 769 | Ga0501035_0003302 | 3300049822 | Bacteria | 15457 |
| 770 | Ga0501035_0063380 | 3300049822 | Bacteria | 3288 |
| 771 | Ga0501035_0132062 | 3300049822 | Bacteria | 2176 |
| 772 | Ga0501044_0006082 | 3300049823 | Bacteria | 13321 |
| 773 | Ga0501044_0041360 | 3300049823 | Bacteria | 4797 |
| 774 | Ga0501044_0083905 | 3300049823 | Bacteria | 3220 |
| 775 | Ga0501044_0285897 | 3300049823 | Bacteria | 1582 |
| 776 | Ga0501045_0000769 | 3300049824 | Bacteria | 20594 |
| 777 | Ga0501045_0000836 | 3300049824 | Bacteria | 19929 |
| 778 | Ga0501045_0003983 | 3300049824 | Bacteria | 10167 |
| 779 | Ga0501045_0005468 | 3300049824 | Bacteria | 8794 |
| 780 | Ga0501045_0010860 | 3300049824 | Bacteria | 6381 |
| 781 | Ga0501045_0016096 | 3300049824 | Bacteria | 5306 |
| 782 | nmdc:mga0yw44_18369_c1 | 3300050492 | Bacteria | 3828 |
| 783 | nmdc:mga0yw44_20934_c1 | 3300050492 | Bacteria | 3640 |
| 784 | nmdc:mga0yw44_372434_c1 | 3300050492 | Bacteria | 963 |
| 785 | nmdc:mga0yw44_47549_c1 | 3300050492 | Bacteria | 2583 |
| 786 | nmdc:mga05p37_152362_c1 | 3300050507 | Bacteria | 2827 |
| 787 | nmdc:mga05p37_159715_c1 | 3300050507 | Bacteria | 2753 |
| 788 | nmdc:mga05p37_171_c1 | 3300050507 | Bacteria | 63303 |
| 789 | nmdc:mga05p37_456891_c1 | 3300050507 | Bacteria | 1477 |
| 790 | nmdc:mga05p37_8497_c1 | 3300050507 | Bacteria | 12136 |
| 791 | nmdc:mga09592_183_c1 | 3300050508 | Bacteria | 44709 |
| 792 | nmdc:mga09592_49429_c1 | 3300050508 | Bacteria | 3545 |
| 793 | nmdc:mga09592_51891_c1 | 3300050508 | Bacteria | 3460 |
| 794 | nmdc:mga09592_565_c1 | 3300050508 | Bacteria | 28059 |
| 795 | nmdc:mga09592_7268_c1 | 3300050508 | Bacteria | 9001 |
| 796 | nmdc:mga0qj67_235385_c1 | 3300050509 | Bacteria | 1486 |
| 797 | nmdc:mga0qj67_23635_c1 | 3300050509 | Bacteria | 4730 |
| 798 | nmdc:mga0qj67_9166_c1 | 3300050509 | Bacteria | 7348 |
| 799 | nmdc:mga06r32_110544_c1 | 3300050510 | Bacteria | 2704 |
| 800 | nmdc:mga06r32_130942_c1 | 3300050510 | Bacteria | 2481 |
| 801 | nmdc:mga06r32_181499_c1 | 3300050510 | Bacteria | 2091 |
| 802 | nmdc:mga06r32_342_c1 | 3300050510 | Bacteria | 38838 |
| 803 | nmdc:mga06r32_58859_c1 | 3300050510 | Bacteria | 3694 |
| 804 | nmdc:mga06r32_657283_c1 | 3300050510 | Bacteria | 1016 |
| 805 | nmdc:mga08y16_14638_c1 | 3300050511 | Bacteria | 8248 |
| 806 | nmdc:mga08y16_172581_c1 | 3300050511 | Bacteria | 2246 |
| 807 | nmdc:mga08y16_254941_c1 | 3300050511 | Bacteria | 1813 |
| 808 | nmdc:mga08y16_288862_c1 | 3300050511 | Bacteria | 1691 |
| 809 | nmdc:mga08y16_3559_c1 | 3300050511 | Bacteria | 16171 |
| 810 | nmdc:mga0n895_121093_c1 | 3300050512 | Bacteria | 2638 |
| 811 | nmdc:mga08x19_8292_c1 | 3300050514 | Bacteria | 6181 |
| 812 | nmdc:mga0a205_2010_c1 | 3300050515 | Bacteria | 17745 |
| 813 | nmdc:mga0a205_23037_c1 | 3300050515 | Bacteria | 5906 |
| 814 | nmdc:mga0a205_242536_c1 | 3300050515 | Bacteria | 1683 |
| 815 | nmdc:mga0a205_276528_c1 | 3300050515 | Bacteria | 1555 |
| 816 | nmdc:mga0a205_660214_c1 | 3300050515 | Bacteria | 897 |
| 817 | Ga0495601_0093137 | 3300053077 | Bacteria | 1941 |
| 818 | Ga0495595_0104345 | 3300053084 | Bacteria | 1370 |
| 819 | Ga0501084_0001563 | 3300054114 | Bacteria | 18161 |
| 820 | Ga0501084_0012543 | 3300054114 | Bacteria | 7019 |
| 821 | Ga0501084_0015419 | 3300054114 | Bacteria | 6336 |
| 822 | Ga0501084_0020237 | 3300054114 | Bacteria | 5547 |
| 823 | Ga0501084_0022076 | 3300054114 | Bacteria | 5309 |
| 824 | Ga0501084_0034479 | 3300054114 | Bacteria | 4232 |
| 825 | Ga0501084_0116735 | 3300054114 | Bacteria | 2244 |
| 826 | Ga0501084_0138174 | 3300054114 | Bacteria | 2051 |
| 827 | Ga0501084_0171823 | 3300054114 | Bacteria | 1829 |
| 828 | Ga0501084_0296258 | 3300054114 | Bacteria | 1366 |
| 829 | Ga0501084_0382694 | 3300054114 | Bacteria | 1189 |
| 830 | Ga0501084_0429814 | 3300054114 | Bacteria | 1116 |
| 831 | Ga0501084_0499999 | 3300054114 | Bacteria | 1027 |
| 832 | Ga0501084_0762005 | 3300054114 | Bacteria | 815 |
| 833 | Ga0590071_040604 | 3300059421 | Bacteria | 1119 |
| 834 | Ga0501082_0005568 | 3300060353 | Bacteria | 10936 |
| 835 | Ga0501082_0013019 | 3300060353 | Bacteria | 7150 |
| 836 | Ga0501082_0013362 | 3300060353 | Bacteria | 7060 |
| 837 | Ga0501082_0013533 | 3300060353 | Bacteria | 7009 |
| 838 | Ga0501082_0098592 | 3300060353 | Bacteria | 2527 |
| 839 | Ga0501082_0128605 | 3300060353 | Bacteria | 2197 |
| 840 | Ga0530510_0003175 | 3300061734 | Bacteria | 11294 |
| 841 | Ga0530510_0004362 | 3300061734 | Bacteria | 9792 |
| 842 | Ga0530510_0005917 | 3300061734 | Bacteria | 8476 |
| 843 | Ga0530510_0008315 | 3300061734 | Bacteria | 7237 |
| 844 | Ga0530510_0058065 | 3300061734 | Bacteria | 2797 |
| 845 | Ga0530510_0065548 | 3300061734 | Bacteria | 2632 |
| 846 | Ga0530510_0126308 | 3300061734 | Bacteria | 1880 |
| 847 | Ga0530510_0141159 | 3300061734 | Bacteria | 1775 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005614 | Ga0068856_100699949 | Ga0068856_1006999492 | 213 |
| 2 | 3300025893 | Ga0207682_10187268 | Ga0207682_101872681 | 214 |
| 3 | 3300005336 | Ga0070680_100390189 | Ga0070680_1003901891 | 215 |
| 4 | 3300045976 | Ga0466967_0120373 | Ga0466967_0120373_535_1350 | 215 |
| 5 | 3300047322 | Ga0495680_0045513 | Ga0495680_0045513_1637_2452 | 215 |
| 6 | 3300050507 | nmdc:mga05p37_456891_c1 | nmdc:mga05p37_456891_c1_21_731 | 217 |
| 7 | 3300054114 | Ga0501084_0762005 | Ga0501084_0762005_15_695 | 219 |
| 8 | 3300042122 | Ga0450920_007738 | Ga0450920_007738_1022_1837 | 225 |
| 9 | 3300049744 | Ga0501083_0043806 | Ga0501083_0043806_860_1540 | 226 |
| 10 | 3300050510 | nmdc:mga06r32_657283_c1 | nmdc:mga06r32_657283_c1_308_988 | 226 |
| 11 | 3300044673 | Ga0453683_0127119 | Ga0453683_0127119_497_1192 | 228 |
| 12 | 3300006038 | Ga0075365_10009452 | Ga0075365_100094525 | 229 |
| 13 | 3300044673 | Ga0453683_0010655 | Ga0453683_0010655_1711_2427 | 229 |
| 14 | 3300049568 | Ga0501031_0102679 | Ga0501031_0102679_731_1492 | 231 |
| 15 | 3300049572 | Ga0501036_0097244 | Ga0501036_0097244_374_1135 | 231 |
| 16 | 3300049591 | Ga0501075_0071352 | Ga0501075_0071352_986_1747 | 231 |
| 17 | 3300049575 | Ga0501039_0749935 | Ga0501039_0749935_10_732 | 233 |
| 18 | 3300061734 | Ga0530510_0126308 | Ga0530510_0126308_10_735 | 234 |
| 19 | 3300031731 | Ga0307405_10285619 | Ga0307405_102856192 | 235 |
| 20 | 3300031824 | Ga0307413_10270250 | Ga0307413_102702501 | 235 |
| 21 | 3300031901 | Ga0307406_10290417 | Ga0307406_102904171 | 235 |
| 22 | 3300031903 | Ga0307407_10225928 | Ga0307407_102259282 | 235 |
| 23 | 3300031995 | Ga0307409_100252009 | Ga0307409_1002520091 | 235 |
| 24 | 3300032126 | Ga0307415_100222013 | Ga0307415_1002220132 | 235 |
| 25 | 3300005937 | Ga0081455_10006029 | Ga0081455_1000602924 | 236 |
| 26 | 3300005937 | Ga0081455_10126583 | Ga0081455_101265832 | 236 |
| 27 | 3300006844 | Ga0075428_100073820 | Ga0075428_1000738203 | 236 |
| 28 | 3300006847 | Ga0075431_100160303 | Ga0075431_1001603032 | 236 |
| 29 | 3300006880 | Ga0075429_100047699 | Ga0075429_1000476993 | 236 |
| 30 | 3300027907 | Ga0207428_10033089 | Ga0207428_100330894 | 236 |
| 31 | 3300032002 | Ga0307416_100116548 | Ga0307416_1001165481 | 236 |
| 32 | 3300048914 | Ga0496111_0027483 | Ga0496111_0027483_18_728 | 236 |
| 33 | 3300049570 | Ga0501033_0102821 | Ga0501033_0102821_817_1527 | 236 |
| 34 | 3300049572 | Ga0501036_0053873 | Ga0501036_0053873_2170_2880 | 236 |
| 35 | 3300049574 | Ga0501038_0034646 | Ga0501038_0034646_1889_2599 | 236 |
| 36 | 3300049576 | Ga0501040_0002053 | Ga0501040_0002053_5983_6693 | 236 |
| 37 | 3300049577 | Ga0501041_0033396 | Ga0501041_0033396_265_975 | 236 |
| 38 | 3300049578 | Ga0501042_0030030 | Ga0501042_0030030_1807_2517 | 236 |
| 39 | 3300049580 | Ga0501046_0033755 | Ga0501046_0033755_1823_2533 | 236 |
| 40 | 3300049582 | Ga0501048_0015076 | Ga0501048_0015076_3669_4379 | 236 |
| 41 | 3300049587 | Ga0501071_0026294 | Ga0501071_0026294_1667_2377 | 236 |
| 42 | 3300049588 | Ga0501072_0000404 | Ga0501072_0000404_17524_18234 | 236 |
| 43 | 3300049591 | Ga0501075_0003133 | Ga0501075_0003133_1694_2404 | 236 |
| 44 | 3300049592 | Ga0501076_0034406 | Ga0501076_0034406_1335_2045 | 236 |
| 45 | 3300049741 | Ga0501079_0036766 | Ga0501079_0036766_1859_2569 | 236 |
| 46 | 3300049743 | Ga0501081_0077170 | Ga0501081_0077170_45_755 | 236 |
| 47 | 3300049822 | Ga0501035_0132062 | Ga0501035_0132062_261_971 | 236 |
| 48 | 3300049824 | Ga0501045_0000769 | Ga0501045_0000769_2011_2721 | 236 |
| 49 | 3300054114 | Ga0501084_0138174 | Ga0501084_0138174_139_849 | 236 |
| 50 | 3300060353 | Ga0501082_0005568 | Ga0501082_0005568_9251_9961 | 236 |
| 51 | 3300061734 | Ga0530510_0008315 | Ga0530510_0008315_5156_5866 | 236 |
| 52 | 3300005339 | Ga0070660_100017962 | Ga0070660_1000179621 | 237 |
| 53 | 3300005530 | Ga0070679_100099326 | Ga0070679_1000993261 | 237 |
| 54 | 3300005578 | Ga0068854_100470447 | Ga0068854_1004704472 | 237 |
| 55 | 3300005614 | Ga0068856_100306283 | Ga0068856_1003062832 | 237 |
| 56 | 3300025909 | Ga0207705_10002123 | Ga0207705_1000212311 | 237 |
| 57 | 3300025913 | Ga0207695_10004617 | Ga0207695_1000461725 | 237 |
| 58 | 3300025919 | Ga0207657_10001138 | Ga0207657_1000113814 | 237 |
| 59 | 3300025920 | Ga0207649_10079656 | Ga0207649_100796562 | 237 |
| 60 | 3300025949 | Ga0207667_10025589 | Ga0207667_100255893 | 237 |
| 61 | 3300025981 | Ga0207640_10003259 | Ga0207640_100032599 | 237 |
| 62 | 3300026067 | Ga0207678_10001614 | Ga0207678_1000161414 | 237 |
| 63 | 3300031548 | Ga0307408_100014713 | Ga0307408_1000147132 | 237 |
| 64 | 3300032002 | Ga0307416_100011128 | Ga0307416_1000111283 | 237 |
| 65 | 3300005356 | Ga0070674_100021069 | Ga0070674_1000210696 | 238 |
| 66 | 3300050515 | nmdc:mga0a205_242536_c1 | nmdc:mga0a205_242536_c1_229_954 | 238 |
| 67 | 3300038443 | Ga0395901_0815525 | Ga0395901_0815525_142_894 | 239 |
| 68 | 3300046665 | Ga0495661_0151986 | Ga0495661_0151986_27_785 | 239 |
| 69 | 3300005290 | Ga0065712_10070868 | Ga0065712_100708684 | 240 |
| 70 | 3300005329 | Ga0070683_100000726 | Ga0070683_10000072631 | 240 |
| 71 | 3300005331 | Ga0070670_100230401 | Ga0070670_1002304012 | 240 |
| 72 | 3300005344 | Ga0070661_100010076 | Ga0070661_1000100765 | 240 |
| 73 | 3300005353 | Ga0070669_100001695 | Ga0070669_10000169526 | 240 |
| 74 | 3300005355 | Ga0070671_100069069 | Ga0070671_1000690693 | 240 |
| 75 | 3300005535 | Ga0070684_100083429 | Ga0070684_1000834292 | 240 |
| 76 | 3300005543 | Ga0070672_100035663 | Ga0070672_1000356633 | 240 |
| 77 | 3300005564 | Ga0070664_100004358 | Ga0070664_1000043587 | 240 |
| 78 | 3300005981 | Ga0081538_10001905 | Ga0081538_1000190521 | 240 |
| 79 | 3300006881 | Ga0068865_100232198 | Ga0068865_1002321982 | 240 |
| 80 | 3300025931 | Ga0207644_10064475 | Ga0207644_100644753 | 240 |
| 81 | 3300025938 | Ga0207704_10255167 | Ga0207704_102551672 | 240 |
| 82 | 3300025940 | Ga0207691_10044419 | Ga0207691_100444194 | 240 |
| 83 | 3300025945 | Ga0207679_10002463 | Ga0207679_100024639 | 240 |
| 84 | 3300025961 | Ga0207712_10384915 | Ga0207712_103849152 | 240 |
| 85 | 3300025986 | Ga0207658_10098308 | Ga0207658_100983082 | 240 |
| 86 | 3300026078 | Ga0207702_10981586 | Ga0207702_109815861 | 240 |
| 87 | 3300026121 | Ga0207683_10301819 | Ga0207683_103018191 | 240 |
| 88 | 3300032002 | Ga0307416_100124086 | Ga0307416_1001240861 | 240 |
| 89 | 3300050511 | nmdc:mga08y16_288862_c1 | nmdc:mga08y16_288862_c1_312_1043 | 240 |
| 90 | 3300005356 | Ga0070674_100040505 | Ga0070674_1000405053 | 241 |
| 91 | 3300005719 | Ga0068861_100272968 | Ga0068861_1002729682 | 241 |
| 92 | 3300025942 | Ga0207689_10071972 | Ga0207689_100719724 | 241 |
| 93 | 3300042142 | Ga0450905_012360 | Ga0450905_012360_208_975 | 241 |
| 94 | 3300049583 | Ga0501067_0134687 | Ga0501067_0134687_622_1365 | 241 |
| 95 | 3300049592 | Ga0501076_0460314 | Ga0501076_0460314_10_756 | 241 |
| 96 | 3300050492 | nmdc:mga0yw44_20934_c1 | nmdc:mga0yw44_20934_c1_157_921 | 241 |
| 97 | 3300005981 | Ga0081538_10004338 | Ga0081538_1000433811 | 242 |
| 98 | 3300042118 | Ga0450914_000312 | Ga0450914_000312_884_1678 | 242 |
| 99 | 3300005293 | Ga0065715_10021290 | Ga0065715_100212902 | 243 |
| 100 | iso_pu_bacteria | 2867475112 | 2867479923 | 244 |
| 101 | iso_pu_bacteria | 8053945823 | 8053948567 | 244 |
| 102 | 3300035398 | Ga0316574_0063247 | Ga0316574_0063247_1421_2182 | 245 |
| 103 | 3300036712 | Ga0316584_0026232 | Ga0316584_0026232_1355_2116 | 245 |
| 104 | 3300049571 | Ga0501034_0031978 | Ga0501034_0031978_1306_2064 | 245 |
| 105 | 3300049572 | Ga0501036_0006733 | Ga0501036_0006733_6547_7305 | 245 |
| 106 | 3300049573 | Ga0501037_0033311 | Ga0501037_0033311_1495_2253 | 245 |
| 107 | 3300049574 | Ga0501038_0008382 | Ga0501038_0008382_2763_3521 | 245 |
| 108 | 3300049578 | Ga0501042_0025697 | Ga0501042_0025697_175_933 | 245 |
| 109 | 3300049579 | Ga0501043_0001621 | Ga0501043_0001621_15483_16241 | 245 |
| 110 | 3300049581 | Ga0501047_0063801 | Ga0501047_0063801_832_1590 | 245 |
| 111 | 3300049582 | Ga0501048_0028320 | Ga0501048_0028320_123_881 | 245 |
| 112 | 3300049587 | Ga0501071_0393464 | Ga0501071_0393464_125_940 | 245 |
| 113 | 3300049589 | Ga0501073_0019204 | Ga0501073_0019204_1839_2597 | 245 |
| 114 | 3300049590 | Ga0501074_0004221 | Ga0501074_0004221_6743_7501 | 245 |
| 115 | 3300049823 | Ga0501044_0041360 | Ga0501044_0041360_1571_2329 | 245 |
| 116 | 3300006844 | Ga0075428_100006199 | Ga0075428_10000619914 | 246 |
| 117 | 3300006847 | Ga0075431_100102472 | Ga0075431_1001024723 | 246 |
| 118 | 3300009147 | Ga0114129_10043279 | Ga0114129_100432797 | 246 |
| 119 | 3300050510 | nmdc:mga06r32_110544_c1 | nmdc:mga06r32_110544_c1_1183_1923 | 246 |
| 120 | 3300054114 | Ga0501084_0022076 | Ga0501084_0022076_2491_3255 | 246 |
| 121 | 3300005341 | Ga0070691_10034218 | Ga0070691_100342183 | 247 |
| 122 | 3300006038 | Ga0075365_10416730 | Ga0075365_104167302 | 247 |
| 123 | 3300006844 | Ga0075428_100219366 | Ga0075428_1002193663 | 247 |
| 124 | 3300006844 | Ga0075428_100361103 | Ga0075428_1003611032 | 247 |
| 125 | 3300006846 | Ga0075430_100004496 | Ga0075430_1000044965 | 247 |
| 126 | 3300006846 | Ga0075430_100006208 | Ga0075430_10000620818 | 247 |
| 127 | 3300006847 | Ga0075431_100014147 | Ga0075431_10001414717 | 247 |
| 128 | 3300006847 | Ga0075431_100014487 | Ga0075431_1000144874 | 247 |
| 129 | 3300006880 | Ga0075429_100001166 | Ga0075429_10000116626 | 247 |
| 130 | 3300006880 | Ga0075429_100004700 | Ga0075429_1000047005 | 247 |
| 131 | 3300009094 | Ga0111539_10059988 | Ga0111539_100599883 | 247 |
| 132 | 3300009147 | Ga0114129_10013234 | Ga0114129_1001323416 | 247 |
| 133 | 3300009147 | Ga0114129_10183448 | Ga0114129_101834482 | 247 |
| 134 | 3300027907 | Ga0207428_10028260 | Ga0207428_100282602 | 247 |
| 135 | 3300031238 | Ga0265332_10032007 | Ga0265332_100320072 | 247 |
| 136 | 3300041491 | Ga0451833_0895723 | Ga0451833_0895723_284_1042 | 247 |
| 137 | 3300045051 | Ga0451576_0076811 | Ga0451576_0076811_616_1374 | 247 |
| 138 | 3300048918 | Ga0496115_0054304 | Ga0496115_0054304_1371_2120 | 247 |
| 139 | 3300049743 | Ga0501081_0227823 | Ga0501081_0227823_567_1319 | 247 |
| 140 | 3300050492 | nmdc:mga0yw44_372434_c1 | nmdc:mga0yw44_372434_c1_171_914 | 247 |
| 141 | 3300050507 | nmdc:mga05p37_159715_c1 | nmdc:mga05p37_159715_c1_639_1382 | 247 |
| 142 | 3300050507 | nmdc:mga05p37_171_c1 | nmdc:mga05p37_171_c1_41787_42530 | 247 |
| 143 | 3300050508 | nmdc:mga09592_183_c1 | nmdc:mga09592_183_c1_20430_21173 | 247 |
| 144 | 3300050508 | nmdc:mga09592_565_c1 | nmdc:mga09592_565_c1_19274_20017 | 247 |
| 145 | 3300050509 | nmdc:mga0qj67_235385_c1 | nmdc:mga0qj67_235385_c1_347_1090 | 247 |
| 146 | 3300050509 | nmdc:mga0qj67_23635_c1 | nmdc:mga0qj67_23635_c1_2889_3632 | 247 |
| 147 | 3300050510 | nmdc:mga06r32_130942_c1 | nmdc:mga06r32_130942_c1_1121_1864 | 247 |
| 148 | 3300050510 | nmdc:mga06r32_342_c1 | nmdc:mga06r32_342_c1_32153_32896 | 247 |
| 149 | 3300050510 | nmdc:mga06r32_58859_c1 | nmdc:mga06r32_58859_c1_733_1476 | 247 |
| 150 | 3300003354 | JGI25160J50197_1012574 | JGI25160J50197_10125743 | 248 |
| 151 | 3300005327 | Ga0070658_10010785 | Ga0070658_100107859 | 248 |
| 152 | 3300005339 | Ga0070660_100105368 | Ga0070660_1001053682 | 248 |
| 153 | 3300005366 | Ga0070659_100091822 | Ga0070659_1000918222 | 248 |
| 154 | 3300013307 | Ga0157372_10300965 | Ga0157372_103009652 | 248 |
| 155 | 3300014325 | Ga0163163_10267244 | Ga0163163_102672442 | 248 |
| 156 | 3300025302 | Ga0207426_1059139 | Ga0207426_10591391 | 248 |
| 157 | 3300025909 | Ga0207705_10030861 | Ga0207705_100308612 | 248 |
| 158 | 3300025919 | Ga0207657_10317004 | Ga0207657_103170042 | 248 |
| 159 | 3300025932 | Ga0207690_10402741 | Ga0207690_104027412 | 248 |
| 160 | 3300031238 | Ga0265332_10001239 | Ga0265332_1000123921 | 248 |
| 161 | 3300031711 | Ga0265314_10021536 | Ga0265314_100215362 | 248 |
| 162 | 3300031903 | Ga0307407_10008769 | Ga0307407_100087691 | 248 |
| 163 | 3300042876 | Ga0451577_0000018 | Ga0451577_0000018_278085_278837 | 248 |
| 164 | 3300044712 | Ga0453684_0000166 | Ga0453684_0000166_237663_238415 | 248 |
| 165 | 3300047321 | Ga0495676_0280356 | Ga0495676_0280356_230_976 | 248 |
| 166 | 3300047444 | Ga0495675_0140580 | Ga0495675_0140580_222_989 | 248 |
| 167 | 3300048907 | Ga0496104_0159220 | Ga0496104_0159220_376_1122 | 248 |
| 168 | 3300048911 | Ga0496108_0014247 | Ga0496108_0014247_1175_1921 | 248 |
| 169 | 3300048912 | Ga0496109_0004877 | Ga0496109_0004877_7105_7851 | 248 |
| 170 | 3300048915 | Ga0496112_0003519 | Ga0496112_0003519_7713_8459 | 248 |
| 171 | 3300049571 | Ga0501034_0349449 | Ga0501034_0349449_218_988 | 248 |
| 172 | 3300049577 | Ga0501041_0269448 | Ga0501041_0269448_184_930 | 248 |
| 173 | 3300049591 | Ga0501075_0535545 | Ga0501075_0535545_100_861 | 248 |
| 174 | 3300053077 | Ga0495601_0093137 | Ga0495601_0093137_345_1091 | 248 |
| 175 | 3300005295 | Ga0065707_10237328 | Ga0065707_102373281 | 249 |
| 176 | 3300005329 | Ga0070683_100009922 | Ga0070683_1000099229 | 249 |
| 177 | 3300005334 | Ga0068869_100564387 | Ga0068869_1005643872 | 249 |
| 178 | 3300005341 | Ga0070691_10037701 | Ga0070691_100377012 | 249 |
| 179 | 3300005353 | Ga0070669_100650324 | Ga0070669_1006503241 | 249 |
| 180 | 3300005354 | Ga0070675_100041134 | Ga0070675_1000411342 | 249 |
| 181 | 3300005365 | Ga0070688_100216061 | Ga0070688_1002160612 | 249 |
| 182 | 3300005455 | Ga0070663_100027522 | Ga0070663_1000275221 | 249 |
| 183 | 3300005468 | Ga0070707_100373712 | Ga0070707_1003737122 | 249 |
| 184 | 3300005471 | Ga0070698_100001954 | Ga0070698_10000195434 | 249 |
| 185 | 3300005536 | Ga0070697_100199816 | Ga0070697_1001998162 | 249 |
| 186 | 3300005549 | Ga0070704_100051520 | Ga0070704_1000515202 | 249 |
| 187 | 3300005563 | Ga0068855_100691304 | Ga0068855_1006913042 | 249 |
| 188 | 3300005617 | Ga0068859_100049834 | Ga0068859_1000498343 | 249 |
| 189 | 3300005844 | Ga0068862_100040658 | Ga0068862_1000406583 | 249 |
| 190 | 3300006846 | Ga0075430_100147575 | Ga0075430_1001475752 | 249 |
| 191 | 3300006847 | Ga0075431_100432973 | Ga0075431_1004329732 | 249 |
| 192 | 3300006880 | Ga0075429_100131214 | Ga0075429_1001312142 | 249 |
| 193 | 3300006880 | Ga0075429_100144630 | Ga0075429_1001446302 | 249 |
| 194 | 3300006931 | Ga0097620_100049836 | Ga0097620_1000498363 | 249 |
| 195 | 3300009093 | Ga0105240_10202343 | Ga0105240_102023432 | 249 |
| 196 | 3300009094 | Ga0111539_10121671 | Ga0111539_101216713 | 249 |
| 197 | 3300009094 | Ga0111539_10137909 | Ga0111539_101379093 | 249 |
| 198 | 3300009176 | Ga0105242_10181157 | Ga0105242_101811574 | 249 |
| 199 | 3300009551 | Ga0105238_10038782 | Ga0105238_100387823 | 249 |
| 200 | 3300025922 | Ga0207646_10314340 | Ga0207646_103143402 | 249 |
| 201 | 3300025925 | Ga0207650_10006120 | Ga0207650_100061205 | 249 |
| 202 | 3300025926 | Ga0207659_10193525 | Ga0207659_101935252 | 249 |
| 203 | 3300025926 | Ga0207659_10375175 | Ga0207659_103751751 | 249 |
| 204 | 3300025942 | Ga0207689_10585097 | Ga0207689_105850971 | 249 |
| 205 | 3300025944 | Ga0207661_10529543 | Ga0207661_105295432 | 249 |
| 206 | 3300025949 | Ga0207667_10149044 | Ga0207667_101490443 | 249 |
| 207 | 3300026075 | Ga0207708_10021383 | Ga0207708_100213832 | 249 |
| 208 | 3300026088 | Ga0207641_10504156 | Ga0207641_105041561 | 249 |
| 209 | 3300027614 | Ga0209970_1006919 | Ga0209970_10069193 | 249 |
| 210 | 3300028380 | Ga0268265_10283140 | Ga0268265_102831401 | 249 |
| 211 | 3300031911 | Ga0307412_10201863 | Ga0307412_102018632 | 249 |
| 212 | 3300042156 | Ga0439446_0065709 | Ga0439446_0065709_125_895 | 249 |
| 213 | 3300050508 | nmdc:mga09592_49429_c1 | nmdc:mga09592_49429_c1_2610_3380 | 249 |
| 214 | 3300050511 | nmdc:mga08y16_172581_c1 | nmdc:mga08y16_172581_c1_124_894 | 249 |
| 215 | 3300050515 | nmdc:mga0a205_276528_c1 | nmdc:mga0a205_276528_c1_400_1170 | 249 |
| 216 | 3300054114 | Ga0501084_0382694 | Ga0501084_0382694_215_985 | 249 |
| 217 | 3300006852 | Ga0075433_10272836 | Ga0075433_102728364 | 250 |
| 218 | 3300031548 | Ga0307408_100092663 | Ga0307408_1000926633 | 250 |
| 219 | 3300031731 | Ga0307405_10222253 | Ga0307405_102222532 | 250 |
| 220 | 3300031824 | Ga0307413_10034092 | Ga0307413_100340923 | 250 |
| 221 | 3300031824 | Ga0307413_10073821 | Ga0307413_100738212 | 250 |
| 222 | 3300031852 | Ga0307410_10334978 | Ga0307410_103349781 | 250 |
| 223 | 3300031901 | Ga0307406_10150192 | Ga0307406_101501923 | 250 |
| 224 | 3300031903 | Ga0307407_10113495 | Ga0307407_101134952 | 250 |
| 225 | 3300031911 | Ga0307412_10152866 | Ga0307412_101528662 | 250 |
| 226 | 3300031995 | Ga0307409_100855575 | Ga0307409_1008555752 | 250 |
| 227 | 3300032002 | Ga0307416_100031363 | Ga0307416_1000313636 | 250 |
| 228 | 3300032004 | Ga0307414_10018571 | Ga0307414_100185712 | 250 |
| 229 | 3300032004 | Ga0307414_10293640 | Ga0307414_102936402 | 250 |
| 230 | 3300032005 | Ga0307411_10037532 | Ga0307411_100375323 | 250 |
| 231 | 3300032126 | Ga0307415_100032143 | Ga0307415_1000321433 | 250 |
| 232 | 3300046663 | Ga0495635_0107545 | Ga0495635_0107545_374_1135 | 250 |
| 233 | 3300046683 | Ga0495658_0204978 | Ga0495658_0204978_74_835 | 250 |
| 234 | 3300046689 | Ga0495613_0139481 | Ga0495613_0139481_528_1289 | 250 |
| 235 | 3300049568 | Ga0501031_0001922 | Ga0501031_0001922_8131_8931 | 250 |
| 236 | 3300049570 | Ga0501033_0032916 | Ga0501033_0032916_3006_3806 | 250 |
| 237 | 3300049571 | Ga0501034_0031799 | Ga0501034_0031799_4159_4959 | 250 |
| 238 | 3300049573 | Ga0501037_0005752 | Ga0501037_0005752_8201_9001 | 250 |
| 239 | 3300049575 | Ga0501039_0009669 | Ga0501039_0009669_3974_4774 | 250 |
| 240 | 3300049577 | Ga0501041_0001929 | Ga0501041_0001929_6606_7406 | 250 |
| 241 | 3300049578 | Ga0501042_0032617 | Ga0501042_0032617_86_886 | 250 |
| 242 | 3300049580 | Ga0501046_0008923 | Ga0501046_0008923_1302_2102 | 250 |
| 243 | 3300049582 | Ga0501048_0020579 | Ga0501048_0020579_2577_3377 | 250 |
| 244 | 3300049584 | Ga0501068_0008513 | Ga0501068_0008513_4730_5530 | 250 |
| 245 | 3300049585 | Ga0501069_0001652 | Ga0501069_0001652_425_1225 | 250 |
| 246 | 3300049587 | Ga0501071_0209544 | Ga0501071_0209544_254_1054 | 250 |
| 247 | 3300049588 | Ga0501072_0001268 | Ga0501072_0001268_3499_4299 | 250 |
| 248 | 3300049592 | Ga0501076_0075450 | Ga0501076_0075450_467_1267 | 250 |
| 249 | 3300049592 | Ga0501076_0200483 | Ga0501076_0200483_700_1500 | 250 |
| 250 | 3300049593 | Ga0501077_0036232 | Ga0501077_0036232_2161_2961 | 250 |
| 251 | 3300049741 | Ga0501079_0321536 | Ga0501079_0321536_90_890 | 250 |
| 252 | 3300049742 | Ga0501080_0020334 | Ga0501080_0020334_2653_3453 | 250 |
| 253 | 3300049744 | Ga0501083_0005072 | Ga0501083_0005072_1459_2259 | 250 |
| 254 | 3300049822 | Ga0501035_0003302 | Ga0501035_0003302_9253_10053 | 250 |
| 255 | 3300049823 | Ga0501044_0006082 | Ga0501044_0006082_2826_3626 | 250 |
| 256 | 3300049824 | Ga0501045_0016096 | Ga0501045_0016096_4040_4840 | 250 |
| 257 | 3300053084 | Ga0495595_0104345 | Ga0495595_0104345_337_1098 | 250 |
| 258 | 3300054114 | Ga0501084_0296258 | Ga0501084_0296258_406_1206 | 250 |
| 259 | 3300061734 | Ga0530510_0065548 | Ga0530510_0065548_1333_2133 | 250 |
| 260 | 3300003373 | JGI25407J50210_10002038 | JGI25407J50210_100020383 | 251 |
| 261 | 3300003373 | JGI25407J50210_10010081 | JGI25407J50210_100100813 | 251 |
| 262 | 3300005347 | Ga0070668_100093920 | Ga0070668_1000939201 | 251 |
| 263 | 3300005457 | Ga0070662_100040253 | Ga0070662_1000402532 | 251 |
| 264 | 3300005468 | Ga0070707_100096597 | Ga0070707_1000965972 | 251 |
| 265 | 3300005981 | Ga0081538_10003017 | Ga0081538_100030178 | 251 |
| 266 | 3300005981 | Ga0081538_10012849 | Ga0081538_100128498 | 251 |
| 267 | 3300005981 | Ga0081538_10014859 | Ga0081538_100148597 | 251 |
| 268 | 3300005981 | Ga0081538_10070824 | Ga0081538_100708243 | 251 |
| 269 | 3300005983 | Ga0081540_1104800 | Ga0081540_11048002 | 251 |
| 270 | 3300005985 | Ga0081539_10011818 | Ga0081539_100118182 | 251 |
| 271 | 3300006844 | Ga0075428_100028437 | Ga0075428_1000284373 | 251 |
| 272 | 3300006844 | Ga0075428_100566912 | Ga0075428_1005669122 | 251 |
| 273 | 3300006846 | Ga0075430_100016007 | Ga0075430_1000160079 | 251 |
| 274 | 3300006846 | Ga0075430_100430170 | Ga0075430_1004301701 | 251 |
| 275 | 3300006847 | Ga0075431_100004224 | Ga0075431_10000422411 | 251 |
| 276 | 3300006847 | Ga0075431_100023806 | Ga0075431_1000238068 | 251 |
| 277 | 3300006852 | Ga0075433_10035210 | Ga0075433_100352105 | 251 |
| 278 | 3300006871 | Ga0075434_100100364 | Ga0075434_1001003644 | 251 |
| 279 | 3300006880 | Ga0075429_100003288 | Ga0075429_1000032883 | 251 |
| 280 | 3300006880 | Ga0075429_100521353 | Ga0075429_1005213532 | 251 |
| 281 | 3300009093 | Ga0105240_10547015 | Ga0105240_105470152 | 251 |
| 282 | 3300009094 | Ga0111539_10081413 | Ga0111539_100814134 | 251 |
| 283 | 3300009094 | Ga0111539_10760519 | Ga0111539_107605192 | 251 |
| 284 | 3300009147 | Ga0114129_10033068 | Ga0114129_100330683 | 251 |
| 285 | 3300009147 | Ga0114129_10348568 | Ga0114129_103485682 | 251 |
| 286 | 3300009147 | Ga0114129_10563445 | Ga0114129_105634452 | 251 |
| 287 | 3300009148 | Ga0105243_10520870 | Ga0105243_105208701 | 251 |
| 288 | 3300013306 | Ga0163162_10081796 | Ga0163162_100817962 | 251 |
| 289 | 3300014497 | Ga0182008_10082412 | Ga0182008_100824122 | 251 |
| 290 | 3300017792 | Ga0163161_10131546 | Ga0163161_101315461 | 251 |
| 291 | 3300025922 | Ga0207646_10044515 | Ga0207646_100445153 | 251 |
| 292 | 3300025933 | Ga0207706_10023631 | Ga0207706_100236314 | 251 |
| 293 | 3300025961 | Ga0207712_10296183 | Ga0207712_102961832 | 251 |
| 294 | 3300025972 | Ga0207668_10358386 | Ga0207668_103583862 | 251 |
| 295 | 3300026118 | Ga0207675_100517008 | Ga0207675_1005170082 | 251 |
| 296 | 3300027907 | Ga0207428_10000940 | Ga0207428_100009402 | 251 |
| 297 | 3300031548 | Ga0307408_100147495 | Ga0307408_1001474952 | 251 |
| 298 | 3300031548 | Ga0307408_100345762 | Ga0307408_1003457622 | 251 |
| 299 | 3300031731 | Ga0307405_10019483 | Ga0307405_100194833 | 251 |
| 300 | 3300031731 | Ga0307405_10158482 | Ga0307405_101584822 | 251 |
| 301 | 3300031824 | Ga0307413_10324475 | Ga0307413_103244752 | 251 |
| 302 | 3300031852 | Ga0307410_10006908 | Ga0307410_100069088 | 251 |
| 303 | 3300031852 | Ga0307410_10035246 | Ga0307410_100352462 | 251 |
| 304 | 3300031852 | Ga0307410_10144593 | Ga0307410_101445932 | 251 |
| 305 | 3300031901 | Ga0307406_10172563 | Ga0307406_101725632 | 251 |
| 306 | 3300031901 | Ga0307406_10323186 | Ga0307406_103231862 | 251 |
| 307 | 3300031903 | Ga0307407_10011716 | Ga0307407_100117163 | 251 |
| 308 | 3300031903 | Ga0307407_10136373 | Ga0307407_101363732 | 251 |
| 309 | 3300031903 | Ga0307407_10178470 | Ga0307407_101784702 | 251 |
| 310 | 3300031911 | Ga0307412_10032184 | Ga0307412_100321845 | 251 |
| 311 | 3300031911 | Ga0307412_10035950 | Ga0307412_100359504 | 251 |
| 312 | 3300031995 | Ga0307409_100004038 | Ga0307409_1000040382 | 251 |
| 313 | 3300031995 | Ga0307409_100022546 | Ga0307409_1000225464 | 251 |
| 314 | 3300031995 | Ga0307409_100057205 | Ga0307409_1000572052 | 251 |
| 315 | 3300031995 | Ga0307409_100396684 | Ga0307409_1003966841 | 251 |
| 316 | 3300032002 | Ga0307416_100159512 | Ga0307416_1001595123 | 251 |
| 317 | 3300032002 | Ga0307416_100348465 | Ga0307416_1003484652 | 251 |
| 318 | 3300032002 | Ga0307416_100358908 | Ga0307416_1003589082 | 251 |
| 319 | 3300032002 | Ga0307416_100656510 | Ga0307416_1006565102 | 251 |
| 320 | 3300032004 | Ga0307414_10206247 | Ga0307414_102062472 | 251 |
| 321 | 3300032004 | Ga0307414_10351472 | Ga0307414_103514722 | 251 |
| 322 | 3300032126 | Ga0307415_100002882 | Ga0307415_1000028829 | 251 |
| 323 | 3300032126 | Ga0307415_100007232 | Ga0307415_1000072323 | 251 |
| 324 | 3300032126 | Ga0307415_100010203 | Ga0307415_1000102037 | 251 |
| 325 | 3300037312 | Ga0395899_0111746 | Ga0395899_0111746_215_1009 | 251 |
| 326 | 3300037418 | Ga0395900_0143240 | Ga0395900_0143240_1280_2092 | 251 |
| 327 | 3300037466 | Ga0395898_0042694 | Ga0395898_0042694_774_1586 | 251 |
| 328 | 3300037466 | Ga0395898_0189316 | Ga0395898_0189316_779_1573 | 251 |
| 329 | 3300042003 | Ga0439443_004916 | Ga0439443_004916_914_1708 | 251 |
| 330 | 3300042005 | Ga0439448_0002950 | Ga0439448_0002950_3381_4175 | 251 |
| 331 | 3300042005 | Ga0439448_0007317 | Ga0439448_0007317_1527_2321 | 251 |
| 332 | 3300042008 | Ga0439450_000158 | Ga0439450_000158_4611_5405 | 251 |
| 333 | 3300042009 | Ga0439451_009707 | Ga0439451_009707_540_1334 | 251 |
| 334 | 3300042009 | Ga0439451_015542 | Ga0439451_015542_707_1501 | 251 |
| 335 | 3300042012 | Ga0439455_0001859 | Ga0439455_0001859_2322_3116 | 251 |
| 336 | 3300042012 | Ga0439455_0024108 | Ga0439455_0024108_403_1197 | 251 |
| 337 | 3300042013 | Ga0439456_012546 | Ga0439456_012546_398_1192 | 251 |
| 338 | 3300042016 | Ga0439463_015155 | Ga0439463_015155_174_968 | 251 |
| 339 | 3300042016 | Ga0439463_021445 | Ga0439463_021445_540_1334 | 251 |
| 340 | 3300042116 | Ga0450912_008071 | Ga0450912_008071_35_829 | 251 |
| 341 | 3300042118 | Ga0450914_000145 | Ga0450914_000145_146_940 | 251 |
| 342 | 3300042137 | Ga0450902_013431 | Ga0450902_013431_199_993 | 251 |
| 343 | 3300042436 | Ga0439435_0020022 | Ga0439435_0020022_398_1192 | 251 |
| 344 | 3300042437 | Ga0439444_0000598 | Ga0439444_0000598_801_1595 | 251 |
| 345 | 3300042439 | Ga0439464_0002755 | Ga0439464_0002755_2635_3429 | 251 |
| 346 | 3300042439 | Ga0439464_0052653 | Ga0439464_0052653_142_936 | 251 |
| 347 | 3300042461 | Ga0439460_0003395 | Ga0439460_0003395_793_1587 | 251 |
| 348 | 3300042461 | Ga0439460_0072430 | Ga0439460_0072430_28_819 | 251 |
| 349 | 3300042530 | Ga0450916_006767 | Ga0450916_006767_312_1106 | 251 |
| 350 | 3300042530 | Ga0450916_019153 | Ga0450916_019153_99_893 | 251 |
| 351 | 3300042993 | Ga0439440_0000656 | Ga0439440_0000656_3566_4360 | 251 |
| 352 | 3300042993 | Ga0439440_0012907 | Ga0439440_0012907_444_1238 | 251 |
| 353 | 3300042993 | Ga0439440_0026233 | Ga0439440_0026233_112_906 | 251 |
| 354 | 3300042993 | Ga0439440_0029805 | Ga0439440_0029805_310_1104 | 251 |
| 355 | 3300046520 | Ga0495637_0155974 | Ga0495637_0155974_16_810 | 251 |
| 356 | 3300046523 | Ga0495644_0056701 | Ga0495644_0056701_489_1283 | 251 |
| 357 | 3300046615 | Ga0495656_0127864 | Ga0495656_0127864_174_968 | 251 |
| 358 | 3300046616 | Ga0495668_0222359 | Ga0495668_0222359_168_962 | 251 |
| 359 | 3300047445 | Ga0495677_0051812 | Ga0495677_0051812_442_1236 | 251 |
| 360 | 3300049568 | Ga0501031_0005873 | Ga0501031_0005873_3083_3877 | 251 |
| 361 | 3300049568 | Ga0501031_0007546 | Ga0501031_0007546_5905_6699 | 251 |
| 362 | 3300049569 | Ga0501032_0017685 | Ga0501032_0017685_90_884 | 251 |
| 363 | 3300049570 | Ga0501033_0007757 | Ga0501033_0007757_7295_8089 | 251 |
| 364 | 3300049572 | Ga0501036_0004359 | Ga0501036_0004359_243_1037 | 251 |
| 365 | 3300049572 | Ga0501036_0005127 | Ga0501036_0005127_6080_6874 | 251 |
| 366 | 3300049573 | Ga0501037_0006015 | Ga0501037_0006015_7793_8587 | 251 |
| 367 | 3300049573 | Ga0501037_0100517 | Ga0501037_0100517_1084_1878 | 251 |
| 368 | 3300049574 | Ga0501038_0036113 | Ga0501038_0036113_3322_4116 | 251 |
| 369 | 3300049575 | Ga0501039_0000514 | Ga0501039_0000514_20935_21729 | 251 |
| 370 | 3300049575 | Ga0501039_0033719 | Ga0501039_0033719_2930_3724 | 251 |
| 371 | 3300049576 | Ga0501040_0002257 | Ga0501040_0002257_5299_6093 | 251 |
| 372 | 3300049576 | Ga0501040_0003883 | Ga0501040_0003883_198_992 | 251 |
| 373 | 3300049577 | Ga0501041_0005986 | Ga0501041_0005986_340_1134 | 251 |
| 374 | 3300049578 | Ga0501042_0000491 | Ga0501042_0000491_9363_10157 | 251 |
| 375 | 3300049578 | Ga0501042_0002549 | Ga0501042_0002549_4514_5308 | 251 |
| 376 | 3300049579 | Ga0501043_0012540 | Ga0501043_0012540_726_1520 | 251 |
| 377 | 3300049580 | Ga0501046_0002227 | Ga0501046_0002227_15343_16137 | 251 |
| 378 | 3300049580 | Ga0501046_0005923 | Ga0501046_0005923_5762_6556 | 251 |
| 379 | 3300049582 | Ga0501048_0005257 | Ga0501048_0005257_360_1154 | 251 |
| 380 | 3300049585 | Ga0501069_0147419 | Ga0501069_0147419_385_1179 | 251 |
| 381 | 3300049586 | Ga0501070_0081775 | Ga0501070_0081775_1797_2591 | 251 |
| 382 | 3300049587 | Ga0501071_0006237 | Ga0501071_0006237_4152_4946 | 251 |
| 383 | 3300049587 | Ga0501071_0431586 | Ga0501071_0431586_98_892 | 251 |
| 384 | 3300049588 | Ga0501072_0004161 | Ga0501072_0004161_9959_10753 | 251 |
| 385 | 3300049588 | Ga0501072_0004858 | Ga0501072_0004858_650_1444 | 251 |
| 386 | 3300049590 | Ga0501074_0009917 | Ga0501074_0009917_5944_6738 | 251 |
| 387 | 3300049590 | Ga0501074_0014693 | Ga0501074_0014693_4156_4950 | 251 |
| 388 | 3300049591 | Ga0501075_0002542 | Ga0501075_0002542_10030_10824 | 251 |
| 389 | 3300049591 | Ga0501075_0061304 | Ga0501075_0061304_1021_1815 | 251 |
| 390 | 3300049592 | Ga0501076_0000287 | Ga0501076_0000287_14691_15485 | 251 |
| 391 | 3300049593 | Ga0501077_0002626 | Ga0501077_0002626_4057_4851 | 251 |
| 392 | 3300049593 | Ga0501077_0013855 | Ga0501077_0013855_3978_4772 | 251 |
| 393 | 3300049741 | Ga0501079_0000178 | Ga0501079_0000178_5919_6713 | 251 |
| 394 | 3300049741 | Ga0501079_0004169 | Ga0501079_0004169_4156_4950 | 251 |
| 395 | 3300049743 | Ga0501081_0008530 | Ga0501081_0008530_3422_4216 | 251 |
| 396 | 3300049743 | Ga0501081_0255217 | Ga0501081_0255217_320_1114 | 251 |
| 397 | 3300049744 | Ga0501083_0205868 | Ga0501083_0205868_98_892 | 251 |
| 398 | 3300049822 | Ga0501035_0063380 | Ga0501035_0063380_2269_3063 | 251 |
| 399 | 3300049824 | Ga0501045_0000836 | Ga0501045_0000836_15953_16747 | 251 |
| 400 | 3300049824 | Ga0501045_0005468 | Ga0501045_0005468_4990_5784 | 251 |
| 401 | 3300050507 | nmdc:mga05p37_8497_c1 | nmdc:mga05p37_8497_c1_11330_12124 | 251 |
| 402 | 3300050508 | nmdc:mga09592_7268_c1 | nmdc:mga09592_7268_c1_7345_8139 | 251 |
| 403 | 3300050509 | nmdc:mga0qj67_9166_c1 | nmdc:mga0qj67_9166_c1_366_1160 | 251 |
| 404 | 3300050510 | nmdc:mga06r32_181499_c1 | nmdc:mga06r32_181499_c1_1222_2016 | 251 |
| 405 | 3300050511 | nmdc:mga08y16_3559_c1 | nmdc:mga08y16_3559_c1_14031_14825 | 251 |
| 406 | 3300050512 | nmdc:mga0n895_121093_c1 | nmdc:mga0n895_121093_c1_1668_2462 | 251 |
| 407 | 3300050515 | nmdc:mga0a205_23037_c1 | nmdc:mga0a205_23037_c1_1596_2390 | 251 |
| 408 | 3300054114 | Ga0501084_0001563 | Ga0501084_0001563_6604_7398 | 251 |
| 409 | 3300054114 | Ga0501084_0012543 | Ga0501084_0012543_386_1180 | 251 |
| 410 | 3300059421 | Ga0590071_040604 | Ga0590071_040604_117_911 | 251 |
| 411 | 3300060353 | Ga0501082_0013019 | Ga0501082_0013019_573_1367 | 251 |
| 412 | 3300060353 | Ga0501082_0013533 | Ga0501082_0013533_5990_6784 | 251 |
| 413 | 3300061734 | Ga0530510_0003175 | Ga0530510_0003175_226_1020 | 251 |
| 414 | 3300061734 | Ga0530510_0005917 | Ga0530510_0005917_5202_5996 | 251 |
| 415 | 3300005331 | Ga0070670_100148007 | Ga0070670_1001480072 | 252 |
| 416 | 3300005365 | Ga0070688_100078573 | Ga0070688_1000785733 | 252 |
| 417 | 3300005366 | Ga0070659_100201856 | Ga0070659_1002018562 | 252 |
| 418 | 3300005438 | Ga0070701_10166397 | Ga0070701_101663972 | 252 |
| 419 | 3300005456 | Ga0070678_100269414 | Ga0070678_1002694142 | 252 |
| 420 | 3300005719 | Ga0068861_100345788 | Ga0068861_1003457882 | 252 |
| 421 | 3300005844 | Ga0068862_100088910 | Ga0068862_1000889102 | 252 |
| 422 | 3300006914 | Ga0075436_100035555 | Ga0075436_1000355552 | 252 |
| 423 | 3300009094 | Ga0111539_10357808 | Ga0111539_103578082 | 252 |
| 424 | 3300009177 | Ga0105248_10087502 | Ga0105248_100875027 | 252 |
| 425 | 3300009553 | Ga0105249_10002497 | Ga0105249_1000249722 | 252 |
| 426 | 3300011119 | Ga0105246_10172615 | Ga0105246_101726152 | 252 |
| 427 | 3300013296 | Ga0157374_10123125 | Ga0157374_101231253 | 252 |
| 428 | 3300013297 | Ga0157378_10737456 | Ga0157378_107374561 | 252 |
| 429 | 3300013308 | Ga0157375_10380097 | Ga0157375_103800972 | 252 |
| 430 | 3300013308 | Ga0157375_10740519 | Ga0157375_107405192 | 252 |
| 431 | 3300014325 | Ga0163163_10103012 | Ga0163163_101030126 | 252 |
| 432 | 3300014326 | Ga0157380_10588274 | Ga0157380_105882741 | 252 |
| 433 | 3300014968 | Ga0157379_10163590 | Ga0157379_101635904 | 252 |
| 434 | 3300014968 | Ga0157379_10448881 | Ga0157379_104488811 | 252 |
| 435 | 3300025923 | Ga0207681_10504880 | Ga0207681_105048802 | 252 |
| 436 | 3300025926 | Ga0207659_10559143 | Ga0207659_105591432 | 252 |
| 437 | 3300025927 | Ga0207687_10030837 | Ga0207687_100308371 | 252 |
| 438 | 3300026118 | Ga0207675_100389911 | Ga0207675_1003899112 | 252 |
| 439 | 3300026121 | Ga0207683_10129707 | Ga0207683_101297072 | 252 |
| 440 | 3300028380 | Ga0268265_10069296 | Ga0268265_100692963 | 252 |
| 441 | 3300031731 | Ga0307405_10015462 | Ga0307405_100154622 | 252 |
| 442 | 3300031824 | Ga0307413_10065310 | Ga0307413_100653103 | 252 |
| 443 | 3300031903 | Ga0307407_10092500 | Ga0307407_100925002 | 252 |
| 444 | 3300031995 | Ga0307409_100029424 | Ga0307409_1000294245 | 252 |
| 445 | 3300032005 | Ga0307411_10010242 | Ga0307411_100102427 | 252 |
| 446 | 3300032126 | Ga0307415_100030385 | Ga0307415_1000303854 | 252 |
| 447 | 3300034820 | Ga0373959_0030331 | Ga0373959_0030331_53_817 | 252 |
| 448 | 3300035170 | Ga0373943_0027797 | Ga0373943_0027797_1668_2435 | 252 |
| 449 | 3300041410 | Ga0439461_0005197 | Ga0439461_0005197_978_1745 | 252 |
| 450 | 3300042436 | Ga0439435_0047856 | Ga0439435_0047856_418_1185 | 252 |
| 451 | 3300042993 | Ga0439440_0070224 | Ga0439440_0070224_32_799 | 252 |
| 452 | 3300047471 | Ga0495684_0116625 | Ga0495684_0116625_963_1748 | 252 |
| 453 | 3300048904 | Ga0496101_0057739 | Ga0496101_0057739_597_1382 | 252 |
| 454 | 3300048906 | Ga0496103_0122877 | Ga0496103_0122877_399_1181 | 252 |
| 455 | 3300048907 | Ga0496104_0007555 | Ga0496104_0007555_3699_4466 | 252 |
| 456 | 3300048908 | Ga0496105_0233566 | Ga0496105_0233566_408_1193 | 252 |
| 457 | 3300048909 | Ga0496106_0081380 | Ga0496106_0081380_1541_2326 | 252 |
| 458 | 3300048911 | Ga0496108_0003558 | Ga0496108_0003558_6338_7105 | 252 |
| 459 | 3300048912 | Ga0496109_0001514 | Ga0496109_0001514_16370_17137 | 252 |
| 460 | 3300048913 | Ga0496110_0002017 | Ga0496110_0002017_2686_3453 | 252 |
| 461 | 3300048914 | Ga0496111_0013343 | Ga0496111_0013343_1113_1880 | 252 |
| 462 | 3300048915 | Ga0496112_0055411 | Ga0496112_0055411_2257_3024 | 252 |
| 463 | 3300049572 | Ga0501036_0519720 | Ga0501036_0519720_106_873 | 252 |
| 464 | 3300049583 | Ga0501067_0013588 | Ga0501067_0013588_2933_3715 | 252 |
| 465 | 3300049583 | Ga0501067_0021994 | Ga0501067_0021994_621_1403 | 252 |
| 466 | 3300049583 | Ga0501067_0172639 | Ga0501067_0172639_112_897 | 252 |
| 467 | 3300049585 | Ga0501069_0016338 | Ga0501069_0016338_1232_2014 | 252 |
| 468 | 3300049587 | Ga0501071_0258831 | Ga0501071_0258831_176_958 | 252 |
| 469 | 3300049588 | Ga0501072_0034100 | Ga0501072_0034100_42_824 | 252 |
| 470 | 3300049588 | Ga0501072_0076749 | Ga0501072_0076749_1028_1795 | 252 |
| 471 | 3300050514 | nmdc:mga08x19_8292_c1 | nmdc:mga08x19_8292_c1_3012_3794 | 252 |
| 472 | 3300054114 | Ga0501084_0171823 | Ga0501084_0171823_221_1003 | 252 |
| 473 | 3300060353 | Ga0501082_0098592 | Ga0501082_0098592_1162_1986 | 252 |
| 474 | 3300061734 | Ga0530510_0058065 | Ga0530510_0058065_1672_2454 | 252 |
| 475 | 3300005937 | Ga0081455_10166555 | Ga0081455_101665553 | 253 |
| 476 | 3300009094 | Ga0111539_10268456 | Ga0111539_102684564 | 253 |
| 477 | 3300014326 | Ga0157380_10562006 | Ga0157380_105620062 | 253 |
| 478 | 3300049569 | Ga0501032_0038857 | Ga0501032_0038857_1769_2548 | 253 |
| 479 | 3300049569 | Ga0501032_0131475 | Ga0501032_0131475_694_1473 | 253 |
| 480 | 3300049569 | Ga0501032_0274223 | Ga0501032_0274223_179_958 | 253 |
| 481 | 3300049571 | Ga0501034_0044352 | Ga0501034_0044352_2128_2907 | 253 |
| 482 | 3300049571 | Ga0501034_0102501 | Ga0501034_0102501_1742_2521 | 253 |
| 483 | 3300049571 | Ga0501034_0142596 | Ga0501034_0142596_1500_2279 | 253 |
| 484 | 3300049572 | Ga0501036_0075975 | Ga0501036_0075975_384_1163 | 253 |
| 485 | 3300049572 | Ga0501036_0308793 | Ga0501036_0308793_393_1172 | 253 |
| 486 | 3300049573 | Ga0501037_0188639 | Ga0501037_0188639_432_1211 | 253 |
| 487 | 3300049574 | Ga0501038_0071754 | Ga0501038_0071754_1769_2548 | 253 |
| 488 | 3300049574 | Ga0501038_0201194 | Ga0501038_0201194_179_958 | 253 |
| 489 | 3300049579 | Ga0501043_0076848 | Ga0501043_0076848_425_1204 | 253 |
| 490 | 3300049580 | Ga0501046_0059635 | Ga0501046_0059635_1833_2612 | 253 |
| 491 | 3300049581 | Ga0501047_0002716 | Ga0501047_0002716_14984_15763 | 253 |
| 492 | 3300049581 | Ga0501047_0210979 | Ga0501047_0210979_803_1582 | 253 |
| 493 | 3300049584 | Ga0501068_0037954 | Ga0501068_0037954_1728_2507 | 253 |
| 494 | 3300049585 | Ga0501069_0008294 | Ga0501069_0008294_1742_2521 | 253 |
| 495 | 3300049586 | Ga0501070_0575994 | Ga0501070_0575994_25_804 | 253 |
| 496 | 3300049588 | Ga0501072_0479462 | Ga0501072_0479462_59_838 | 253 |
| 497 | 3300049589 | Ga0501073_0040361 | Ga0501073_0040361_1769_2548 | 253 |
| 498 | 3300049589 | Ga0501073_0148326 | Ga0501073_0148326_413_1192 | 253 |
| 499 | 3300049592 | Ga0501076_0092160 | Ga0501076_0092160_574_1353 | 253 |
| 500 | 3300049742 | Ga0501080_0014568 | Ga0501080_0014568_5587_6366 | 253 |
| 501 | 3300049742 | Ga0501080_0478342 | Ga0501080_0478342_157_936 | 253 |
| 502 | 3300049742 | Ga0501080_0650926 | Ga0501080_0650926_10_789 | 253 |
| 503 | 3300049744 | Ga0501083_0022032 | Ga0501083_0022032_1446_2225 | 253 |
| 504 | 3300049744 | Ga0501083_0066575 | Ga0501083_0066575_771_1550 | 253 |
| 505 | 3300049823 | Ga0501044_0083905 | Ga0501044_0083905_673_1452 | 253 |
| 506 | 3300054114 | Ga0501084_0020237 | Ga0501084_0020237_2864_3643 | 253 |
| 507 | 3300060353 | Ga0501082_0128605 | Ga0501082_0128605_1093_1872 | 253 |
| 508 | 3300041512 | Ga0451853_1858440 | Ga0451853_1858440_54_845 | 254 |
| 509 | 3300026089 | Ga0207648_10105618 | Ga0207648_101056183 | 255 |
| 510 | 3300014969 | Ga0157376_10071200 | Ga0157376_100712004 | 256 |
| 511 | 3300037471 | Ga0395905_0319552 | Ga0395905_0319552_191_970 | 256 |
| 512 | 3300038443 | Ga0395901_0317491 | Ga0395901_0317491_792_1571 | 256 |
| 513 | 3300042005 | Ga0439448_0011384 | Ga0439448_0011384_333_1136 | 256 |
| 514 | 3300049591 | Ga0501075_0238043 | Ga0501075_0238043_205_990 | 256 |
| 515 | 3300049593 | Ga0501077_0002156 | Ga0501077_0002156_858_1649 | 256 |
| 516 | 3300049743 | Ga0501081_0408817 | Ga0501081_0408817_12_797 | 256 |
| 517 | 3300054114 | Ga0501084_0116735 | Ga0501084_0116735_153_938 | 256 |
| 518 | 3300041408 | Ga0439453_0007832 | Ga0439453_0007832_702_1499 | 257 |
| 519 | 3300005356 | Ga0070674_100042929 | Ga0070674_1000429293 | 258 |
| 520 | 3300009094 | Ga0111539_10137421 | Ga0111539_101374213 | 258 |
| 521 | 3300014326 | Ga0157380_10538289 | Ga0157380_105382891 | 258 |
| 522 | 3300025937 | Ga0207669_10075544 | Ga0207669_100755443 | 258 |
| 523 | 3300026089 | Ga0207648_10056939 | Ga0207648_100569394 | 258 |
| 524 | 3300045049 | Ga0466959_0109449 | Ga0466959_0109449_299_1135 | 258 |
| 525 | 3300049568 | Ga0501031_0004586 | Ga0501031_0004586_5537_6340 | 258 |
| 526 | 3300049569 | Ga0501032_0067085 | Ga0501032_0067085_1447_2250 | 258 |
| 527 | 3300049570 | Ga0501033_0063188 | Ga0501033_0063188_891_1694 | 258 |
| 528 | 3300049572 | Ga0501036_0013364 | Ga0501036_0013364_3716_4519 | 258 |
| 529 | 3300049573 | Ga0501037_0043498 | Ga0501037_0043498_1648_2451 | 258 |
| 530 | 3300049574 | Ga0501038_0001390 | Ga0501038_0001390_17272_18075 | 258 |
| 531 | 3300049575 | Ga0501039_0018998 | Ga0501039_0018998_756_1559 | 258 |
| 532 | 3300049576 | Ga0501040_0001940 | Ga0501040_0001940_10426_11229 | 258 |
| 533 | 3300049577 | Ga0501041_0002244 | Ga0501041_0002244_5001_5804 | 258 |
| 534 | 3300049578 | Ga0501042_0005512 | Ga0501042_0005512_5079_5882 | 258 |
| 535 | 3300049579 | Ga0501043_0007697 | Ga0501043_0007697_3664_4467 | 258 |
| 536 | 3300049581 | Ga0501047_0260289 | Ga0501047_0260289_499_1302 | 258 |
| 537 | 3300049582 | Ga0501048_0056455 | Ga0501048_0056455_966_1769 | 258 |
| 538 | 3300049584 | Ga0501068_0002839 | Ga0501068_0002839_1911_2714 | 258 |
| 539 | 3300049585 | Ga0501069_0013440 | Ga0501069_0013440_1912_2715 | 258 |
| 540 | 3300049587 | Ga0501071_0004817 | Ga0501071_0004817_3265_4068 | 258 |
| 541 | 3300049588 | Ga0501072_0006223 | Ga0501072_0006223_4828_5631 | 258 |
| 542 | 3300049589 | Ga0501073_0028494 | Ga0501073_0028494_1649_2452 | 258 |
| 543 | 3300049590 | Ga0501074_0003320 | Ga0501074_0003320_5826_6629 | 258 |
| 544 | 3300049592 | Ga0501076_0029915 | Ga0501076_0029915_2849_3652 | 258 |
| 545 | 3300049593 | Ga0501077_0006182 | Ga0501077_0006182_4814_5617 | 258 |
| 546 | 3300049741 | Ga0501079_0020897 | Ga0501079_0020897_30_833 | 258 |
| 547 | 3300049742 | Ga0501080_0173642 | Ga0501080_0173642_400_1203 | 258 |
| 548 | 3300049743 | Ga0501081_0004860 | Ga0501081_0004860_4820_5623 | 258 |
| 549 | 3300049744 | Ga0501083_0044173 | Ga0501083_0044173_1488_2291 | 258 |
| 550 | 3300049824 | Ga0501045_0003983 | Ga0501045_0003983_6459_7262 | 258 |
| 551 | 3300054114 | Ga0501084_0034479 | Ga0501084_0034479_1999_2802 | 258 |
| 552 | 3300060353 | Ga0501082_0013362 | Ga0501082_0013362_3243_4046 | 258 |
| 553 | 3300061734 | Ga0530510_0004362 | Ga0530510_0004362_5146_5949 | 258 |
| 554 | 3300049578 | Ga0501042_0258455 | Ga0501042_0258455_379_1185 | 259 |
| 555 | 3300049583 | Ga0501067_0043193 | Ga0501067_0043193_1559_2341 | 259 |
| 556 | 3300049587 | Ga0501071_0120360 | Ga0501071_0120360_1075_1881 | 259 |
| 557 | 3300049592 | Ga0501076_0172123 | Ga0501076_0172123_684_1490 | 259 |
| 558 | 3300049741 | Ga0501079_0069872 | Ga0501079_0069872_1753_2535 | 259 |
| 559 | 3300054114 | Ga0501084_0429814 | Ga0501084_0429814_241_1047 | 259 |
| 560 | 3300061734 | Ga0530510_0141159 | Ga0530510_0141159_56_838 | 259 |
| 561 | 3300002074 | JGI24748J21848_1006401 | JGI24748J21848_10064012 | 260 |
| 562 | 3300002075 | JGI24738J21930_10004317 | JGI24738J21930_100043173 | 260 |
| 563 | 3300003203 | JGI25406J46586_10011827 | JGI25406J46586_100118273 | 260 |
| 564 | 3300005328 | Ga0070676_10108046 | Ga0070676_101080462 | 260 |
| 565 | 3300005328 | Ga0070676_10392510 | Ga0070676_103925101 | 260 |
| 566 | 3300005329 | Ga0070683_100043756 | Ga0070683_1000437561 | 260 |
| 567 | 3300005329 | Ga0070683_100084911 | Ga0070683_1000849113 | 260 |
| 568 | 3300005329 | Ga0070683_100207816 | Ga0070683_1002078163 | 260 |
| 569 | 3300005329 | Ga0070683_100307032 | Ga0070683_1003070322 | 260 |
| 570 | 3300005330 | Ga0070690_100147623 | Ga0070690_1001476233 | 260 |
| 571 | 3300005334 | Ga0068869_100012691 | Ga0068869_1000126916 | 260 |
| 572 | 3300005334 | Ga0068869_100229827 | Ga0068869_1002298271 | 260 |
| 573 | 3300005335 | Ga0070666_10190318 | Ga0070666_101903182 | 260 |
| 574 | 3300005336 | Ga0070680_100464555 | Ga0070680_1004645551 | 260 |
| 575 | 3300005337 | Ga0070682_100031746 | Ga0070682_1000317464 | 260 |
| 576 | 3300005337 | Ga0070682_100127151 | Ga0070682_1001271512 | 260 |
| 577 | 3300005337 | Ga0070682_100401730 | Ga0070682_1004017302 | 260 |
| 578 | 3300005338 | Ga0068868_100028641 | Ga0068868_1000286411 | 260 |
| 579 | 3300005338 | Ga0068868_100363306 | Ga0068868_1003633061 | 260 |
| 580 | 3300005338 | Ga0068868_100423937 | Ga0068868_1004239372 | 260 |
| 581 | 3300005339 | Ga0070660_100048573 | Ga0070660_1000485734 | 260 |
| 582 | 3300005339 | Ga0070660_100329361 | Ga0070660_1003293611 | 260 |
| 583 | 3300005341 | Ga0070691_10003867 | Ga0070691_100038676 | 260 |
| 584 | 3300005344 | Ga0070661_100053195 | Ga0070661_1000531953 | 260 |
| 585 | 3300005345 | Ga0070692_10019897 | Ga0070692_100198973 | 260 |
| 586 | 3300005345 | Ga0070692_10064286 | Ga0070692_100642861 | 260 |
| 587 | 3300005347 | Ga0070668_100070704 | Ga0070668_1000707043 | 260 |
| 588 | 3300005347 | Ga0070668_100113261 | Ga0070668_1001132613 | 260 |
| 589 | 3300005354 | Ga0070675_100061051 | Ga0070675_1000610511 | 260 |
| 590 | 3300005354 | Ga0070675_100137200 | Ga0070675_1001372001 | 260 |
| 591 | 3300005354 | Ga0070675_100267156 | Ga0070675_1002671562 | 260 |
| 592 | 3300005355 | Ga0070671_100060488 | Ga0070671_1000604882 | 260 |
| 593 | 3300005355 | Ga0070671_100062030 | Ga0070671_1000620303 | 260 |
| 594 | 3300005356 | Ga0070674_100041590 | Ga0070674_1000415903 | 260 |
| 595 | 3300005356 | Ga0070674_100183521 | Ga0070674_1001835211 | 260 |
| 596 | 3300005364 | Ga0070673_100019981 | Ga0070673_1000199816 | 260 |
| 597 | 3300005365 | Ga0070688_100019230 | Ga0070688_1000192301 | 260 |
| 598 | 3300005366 | Ga0070659_100022749 | Ga0070659_1000227496 | 260 |
| 599 | 3300005366 | Ga0070659_100173710 | Ga0070659_1001737101 | 260 |
| 600 | 3300005366 | Ga0070659_100584563 | Ga0070659_1005845631 | 260 |
| 601 | 3300005438 | Ga0070701_10109767 | Ga0070701_101097672 | 260 |
| 602 | 3300005438 | Ga0070701_10268780 | Ga0070701_102687802 | 260 |
| 603 | 3300005441 | Ga0070700_100248892 | Ga0070700_1002488922 | 260 |
| 604 | 3300005441 | Ga0070700_100434057 | Ga0070700_1004340571 | 260 |
| 605 | 3300005444 | Ga0070694_100208965 | Ga0070694_1002089652 | 260 |
| 606 | 3300005455 | Ga0070663_100063895 | Ga0070663_1000638953 | 260 |
| 607 | 3300005455 | Ga0070663_100200179 | Ga0070663_1002001792 | 260 |
| 608 | 3300005456 | Ga0070678_100058968 | Ga0070678_1000589683 | 260 |
| 609 | 3300005456 | Ga0070678_100097324 | Ga0070678_1000973243 | 260 |
| 610 | 3300005456 | Ga0070678_100110108 | Ga0070678_1001101083 | 260 |
| 611 | 3300005457 | Ga0070662_100017781 | Ga0070662_1000177818 | 260 |
| 612 | 3300005457 | Ga0070662_100117753 | Ga0070662_1001177531 | 260 |
| 613 | 3300005457 | Ga0070662_100149537 | Ga0070662_1001495372 | 260 |
| 614 | 3300005458 | Ga0070681_10300368 | Ga0070681_103003682 | 260 |
| 615 | 3300005459 | Ga0068867_100049389 | Ga0068867_1000493896 | 260 |
| 616 | 3300005459 | Ga0068867_100246320 | Ga0068867_1002463201 | 260 |
| 617 | 3300005518 | Ga0070699_100121129 | Ga0070699_1001211293 | 260 |
| 618 | 3300005518 | Ga0070699_100495249 | Ga0070699_1004952491 | 260 |
| 619 | 3300005530 | Ga0070679_100436369 | Ga0070679_1004363692 | 260 |
| 620 | 3300005535 | Ga0070684_100101399 | Ga0070684_1001013993 | 260 |
| 621 | 3300005535 | Ga0070684_100114067 | Ga0070684_1001140673 | 260 |
| 622 | 3300005535 | Ga0070684_100402910 | Ga0070684_1004029102 | 260 |
| 623 | 3300005535 | Ga0070684_100476083 | Ga0070684_1004760832 | 260 |
| 624 | 3300005535 | Ga0070684_100570992 | Ga0070684_1005709921 | 260 |
| 625 | 3300005539 | Ga0068853_100092055 | Ga0068853_1000920551 | 260 |
| 626 | 3300005539 | Ga0068853_100414531 | Ga0068853_1004145311 | 260 |
| 627 | 3300005539 | Ga0068853_100480312 | Ga0068853_1004803122 | 260 |
| 628 | 3300005543 | Ga0070672_100077300 | Ga0070672_1000773003 | 260 |
| 629 | 3300005543 | Ga0070672_100155724 | Ga0070672_1001557242 | 260 |
| 630 | 3300005544 | Ga0070686_100082484 | Ga0070686_1000824842 | 260 |
| 631 | 3300005546 | Ga0070696_100082497 | Ga0070696_1000824972 | 260 |
| 632 | 3300005547 | Ga0070693_100095721 | Ga0070693_1000957212 | 260 |
| 633 | 3300005548 | Ga0070665_100140484 | Ga0070665_1001404842 | 260 |
| 634 | 3300005563 | Ga0068855_100158907 | Ga0068855_1001589073 | 260 |
| 635 | 3300005564 | Ga0070664_100010033 | Ga0070664_10001003311 | 260 |
| 636 | 3300005564 | Ga0070664_100413985 | Ga0070664_1004139852 | 260 |
| 637 | 3300005564 | Ga0070664_100653388 | Ga0070664_1006533881 | 260 |
| 638 | 3300005577 | Ga0068857_100608269 | Ga0068857_1006082692 | 260 |
| 639 | 3300005578 | Ga0068854_100021594 | Ga0068854_1000215942 | 260 |
| 640 | 3300005578 | Ga0068854_100099990 | Ga0068854_1000999901 | 260 |
| 641 | 3300005615 | Ga0070702_100273883 | Ga0070702_1002738832 | 260 |
| 642 | 3300005616 | Ga0068852_100162678 | Ga0068852_1001626783 | 260 |
| 643 | 3300005616 | Ga0068852_100462886 | Ga0068852_1004628862 | 260 |
| 644 | 3300005616 | Ga0068852_100709780 | Ga0068852_1007097802 | 260 |
| 645 | 3300005617 | Ga0068859_100038389 | Ga0068859_1000383895 | 260 |
| 646 | 3300005617 | Ga0068859_100242972 | Ga0068859_1002429723 | 260 |
| 647 | 3300005618 | Ga0068864_100151738 | Ga0068864_1001517383 | 260 |
| 648 | 3300005718 | Ga0068866_10216495 | Ga0068866_102164951 | 260 |
| 649 | 3300005719 | Ga0068861_100315511 | Ga0068861_1003155111 | 260 |
| 650 | 3300005834 | Ga0068851_10029573 | Ga0068851_100295733 | 260 |
| 651 | 3300005840 | Ga0068870_10027826 | Ga0068870_100278264 | 260 |
| 652 | 3300005840 | Ga0068870_10098639 | Ga0068870_100986392 | 260 |
| 653 | 3300005840 | Ga0068870_10127219 | Ga0068870_101272192 | 260 |
| 654 | 3300005841 | Ga0068863_100176216 | Ga0068863_1001762162 | 260 |
| 655 | 3300005842 | Ga0068858_100046786 | Ga0068858_1000467866 | 260 |
| 656 | 3300005843 | Ga0068860_100027971 | Ga0068860_1000279716 | 260 |
| 657 | 3300005843 | Ga0068860_100601624 | Ga0068860_1006016241 | 260 |
| 658 | 3300005844 | Ga0068862_100143650 | Ga0068862_1001436503 | 260 |
| 659 | 3300005844 | Ga0068862_100550823 | Ga0068862_1005508232 | 260 |
| 660 | 3300005937 | Ga0081455_10031276 | Ga0081455_100312765 | 260 |
| 661 | 3300005937 | Ga0081455_10047065 | Ga0081455_100470656 | 260 |
| 662 | 3300005937 | Ga0081455_10080350 | Ga0081455_100803501 | 260 |
| 663 | 3300005985 | Ga0081539_10000433 | Ga0081539_1000043372 | 260 |
| 664 | 3300006038 | Ga0075365_10021528 | Ga0075365_100215285 | 260 |
| 665 | 3300006038 | Ga0075365_10314612 | Ga0075365_103146122 | 260 |
| 666 | 3300006058 | Ga0075432_10015139 | Ga0075432_100151392 | 260 |
| 667 | 3300006237 | Ga0097621_100024219 | Ga0097621_1000242193 | 260 |
| 668 | 3300006237 | Ga0097621_100079474 | Ga0097621_1000794743 | 260 |
| 669 | 3300006358 | Ga0068871_100208481 | Ga0068871_1002084812 | 260 |
| 670 | 3300006358 | Ga0068871_100416634 | Ga0068871_1004166342 | 260 |
| 671 | 3300006844 | Ga0075428_100004768 | Ga0075428_10000476817 | 260 |
| 672 | 3300006880 | Ga0075429_100264330 | Ga0075429_1002643303 | 260 |
| 673 | 3300006881 | Ga0068865_100036260 | Ga0068865_1000362604 | 260 |
| 674 | 3300006881 | Ga0068865_100059793 | Ga0068865_1000597933 | 260 |
| 675 | 3300006881 | Ga0068865_100064080 | Ga0068865_1000640802 | 260 |
| 676 | 3300006931 | Ga0097620_100038389 | Ga0097620_1000383895 | 260 |
| 677 | 3300006931 | Ga0097620_100242983 | Ga0097620_1002429833 | 260 |
| 678 | 3300009094 | Ga0111539_10008690 | Ga0111539_1000869021 | 260 |
| 679 | 3300009094 | Ga0111539_10315418 | Ga0111539_103154183 | 260 |
| 680 | 3300009098 | Ga0105245_10039562 | Ga0105245_100395626 | 260 |
| 681 | 3300009098 | Ga0105245_10041639 | Ga0105245_100416396 | 260 |
| 682 | 3300009098 | Ga0105245_10411317 | Ga0105245_104113172 | 260 |
| 683 | 3300009101 | Ga0105247_10046136 | Ga0105247_100461364 | 260 |
| 684 | 3300009147 | Ga0114129_10238681 | Ga0114129_102386813 | 260 |
| 685 | 3300009148 | Ga0105243_10035607 | Ga0105243_100356075 | 260 |
| 686 | 3300009148 | Ga0105243_10100000 | Ga0105243_101000003 | 260 |
| 687 | 3300009148 | Ga0105243_10122737 | Ga0105243_101227373 | 260 |
| 688 | 3300009148 | Ga0105243_10254320 | Ga0105243_102543203 | 260 |
| 689 | 3300009174 | Ga0105241_10072501 | Ga0105241_100725012 | 260 |
| 690 | 3300009176 | Ga0105242_10030307 | Ga0105242_100303076 | 260 |
| 691 | 3300009176 | Ga0105242_10104555 | Ga0105242_101045552 | 260 |
| 692 | 3300009177 | Ga0105248_10158140 | Ga0105248_101581401 | 260 |
| 693 | 3300009551 | Ga0105238_10096099 | Ga0105238_100960992 | 260 |
| 694 | 3300009551 | Ga0105238_10327807 | Ga0105238_103278071 | 260 |
| 695 | 3300009553 | Ga0105249_10298265 | Ga0105249_102982653 | 260 |
| 696 | 3300009553 | Ga0105249_10416330 | Ga0105249_104163302 | 260 |
| 697 | 3300010375 | Ga0105239_10052822 | Ga0105239_100528224 | 260 |
| 698 | 3300010375 | Ga0105239_10152239 | Ga0105239_101522393 | 260 |
| 699 | 3300010375 | Ga0105239_10324882 | Ga0105239_103248823 | 260 |
| 700 | 3300011119 | Ga0105246_10049177 | Ga0105246_100491774 | 260 |
| 701 | 3300011119 | Ga0105246_10114755 | Ga0105246_101147552 | 260 |
| 702 | 3300011119 | Ga0105246_10363322 | Ga0105246_103633221 | 260 |
| 703 | 3300013102 | Ga0157371_10061279 | Ga0157371_100612792 | 260 |
| 704 | 3300013306 | Ga0163162_10794903 | Ga0163162_107949032 | 260 |
| 705 | 3300013307 | Ga0157372_10067081 | Ga0157372_100670816 | 260 |
| 706 | 3300013307 | Ga0157372_10108401 | Ga0157372_101084013 | 260 |
| 707 | 3300013307 | Ga0157372_10553710 | Ga0157372_105537101 | 260 |
| 708 | 3300013308 | Ga0157375_10136867 | Ga0157375_101368673 | 260 |
| 709 | 3300014325 | Ga0163163_10096702 | Ga0163163_100967025 | 260 |
| 710 | 3300014325 | Ga0163163_10197777 | Ga0163163_101977773 | 260 |
| 711 | 3300014325 | Ga0163163_10385625 | Ga0163163_103856252 | 260 |
| 712 | 3300014326 | Ga0157380_10047519 | Ga0157380_100475194 | 260 |
| 713 | 3300014326 | Ga0157380_10129723 | Ga0157380_101297233 | 260 |
| 714 | 3300014745 | Ga0157377_10009126 | Ga0157377_100091266 | 260 |
| 715 | 3300014745 | Ga0157377_10439888 | Ga0157377_104398882 | 260 |
| 716 | 3300014968 | Ga0157379_10276812 | Ga0157379_102768122 | 260 |
| 717 | 3300014969 | Ga0157376_10045570 | Ga0157376_100455703 | 260 |
| 718 | 3300017792 | Ga0163161_10081962 | Ga0163161_100819624 | 260 |
| 719 | 3300020082 | Ga0206353_11223501 | Ga0206353_112235012 | 260 |
| 720 | 3300025899 | Ga0207642_10105205 | Ga0207642_101052052 | 260 |
| 721 | 3300025901 | Ga0207688_10016881 | Ga0207688_100168814 | 260 |
| 722 | 3300025901 | Ga0207688_10036391 | Ga0207688_100363915 | 260 |
| 723 | 3300025903 | Ga0207680_10278277 | Ga0207680_102782771 | 260 |
| 724 | 3300025904 | Ga0207647_10021889 | Ga0207647_100218897 | 260 |
| 725 | 3300025907 | Ga0207645_10064369 | Ga0207645_100643694 | 260 |
| 726 | 3300025908 | Ga0207643_10048389 | Ga0207643_100483894 | 260 |
| 727 | 3300025908 | Ga0207643_10135575 | Ga0207643_101355752 | 260 |
| 728 | 3300025909 | Ga0207705_10013197 | Ga0207705_100131974 | 260 |
| 729 | 3300025912 | Ga0207707_10139507 | Ga0207707_101395071 | 260 |
| 730 | 3300025917 | Ga0207660_10345055 | Ga0207660_103450551 | 260 |
| 731 | 3300025919 | Ga0207657_10028407 | Ga0207657_100284071 | 260 |
| 732 | 3300025919 | Ga0207657_10294684 | Ga0207657_102946842 | 260 |
| 733 | 3300025919 | Ga0207657_10297142 | Ga0207657_102971421 | 260 |
| 734 | 3300025920 | Ga0207649_10020612 | Ga0207649_100206124 | 260 |
| 735 | 3300025923 | Ga0207681_10151818 | Ga0207681_101518182 | 260 |
| 736 | 3300025923 | Ga0207681_10582520 | Ga0207681_105825201 | 260 |
| 737 | 3300025924 | Ga0207694_10010017 | Ga0207694_100100174 | 260 |
| 738 | 3300025925 | Ga0207650_10424144 | Ga0207650_104241442 | 260 |
| 739 | 3300025926 | Ga0207659_10306903 | Ga0207659_103069032 | 260 |
| 740 | 3300025927 | Ga0207687_10018414 | Ga0207687_100184147 | 260 |
| 741 | 3300025931 | Ga0207644_10038542 | Ga0207644_100385425 | 260 |
| 742 | 3300025932 | Ga0207690_10096274 | Ga0207690_100962744 | 260 |
| 743 | 3300025933 | Ga0207706_10089715 | Ga0207706_100897153 | 260 |
| 744 | 3300025934 | Ga0207686_10020647 | Ga0207686_100206476 | 260 |
| 745 | 3300025934 | Ga0207686_10059068 | Ga0207686_100590684 | 260 |
| 746 | 3300025934 | Ga0207686_10461754 | Ga0207686_104617541 | 260 |
| 747 | 3300025935 | Ga0207709_10015196 | Ga0207709_100151966 | 260 |
| 748 | 3300025935 | Ga0207709_10020150 | Ga0207709_100201506 | 260 |
| 749 | 3300025937 | Ga0207669_10006019 | Ga0207669_100060199 | 260 |
| 750 | 3300025937 | Ga0207669_10039257 | Ga0207669_100392573 | 260 |
| 751 | 3300025938 | Ga0207704_10038463 | Ga0207704_100384633 | 260 |
| 752 | 3300025938 | Ga0207704_10065645 | Ga0207704_100656452 | 260 |
| 753 | 3300025938 | Ga0207704_10072194 | Ga0207704_100721941 | 260 |
| 754 | 3300025940 | Ga0207691_10041610 | Ga0207691_100416106 | 260 |
| 755 | 3300025940 | Ga0207691_10173734 | Ga0207691_101737342 | 260 |
| 756 | 3300025940 | Ga0207691_10250954 | Ga0207691_102509542 | 260 |
| 757 | 3300025941 | Ga0207711_10113217 | Ga0207711_101132174 | 260 |
| 758 | 3300025942 | Ga0207689_10029116 | Ga0207689_100291164 | 260 |
| 759 | 3300025942 | Ga0207689_10095522 | Ga0207689_100955225 | 260 |
| 760 | 3300025942 | Ga0207689_10516871 | Ga0207689_105168712 | 260 |
| 761 | 3300025944 | Ga0207661_10427951 | Ga0207661_104279511 | 260 |
| 762 | 3300025945 | Ga0207679_10413219 | Ga0207679_104132191 | 260 |
| 763 | 3300025945 | Ga0207679_10510108 | Ga0207679_105101081 | 260 |
| 764 | 3300025949 | Ga0207667_10074146 | Ga0207667_100741463 | 260 |
| 765 | 3300025960 | Ga0207651_10147920 | Ga0207651_101479201 | 260 |
| 766 | 3300025961 | Ga0207712_10248203 | Ga0207712_102482033 | 260 |
| 767 | 3300025972 | Ga0207668_10095859 | Ga0207668_100958593 | 260 |
| 768 | 3300025981 | Ga0207640_10028606 | Ga0207640_100286063 | 260 |
| 769 | 3300025986 | Ga0207658_10089775 | Ga0207658_100897753 | 260 |
| 770 | 3300026041 | Ga0207639_10079382 | Ga0207639_100793823 | 260 |
| 771 | 3300026041 | Ga0207639_10171574 | Ga0207639_101715742 | 260 |
| 772 | 3300026041 | Ga0207639_10484977 | Ga0207639_104849771 | 260 |
| 773 | 3300026075 | Ga0207708_10096513 | Ga0207708_100965133 | 260 |
| 774 | 3300026075 | Ga0207708_10236944 | Ga0207708_102369441 | 260 |
| 775 | 3300026088 | Ga0207641_10049012 | Ga0207641_100490125 | 260 |
| 776 | 3300026089 | Ga0207648_10070364 | Ga0207648_100703641 | 260 |
| 777 | 3300026089 | Ga0207648_10174394 | Ga0207648_101743942 | 260 |
| 778 | 3300026116 | Ga0207674_10682938 | Ga0207674_106829381 | 260 |
| 779 | 3300026118 | Ga0207675_100109639 | Ga0207675_1001096391 | 260 |
| 780 | 3300026118 | Ga0207675_100189636 | Ga0207675_1001896361 | 260 |
| 781 | 3300026121 | Ga0207683_10128796 | Ga0207683_101287961 | 260 |
| 782 | 3300026121 | Ga0207683_10245640 | Ga0207683_102456401 | 260 |
| 783 | 3300026121 | Ga0207683_10308742 | Ga0207683_103087421 | 260 |
| 784 | 3300026121 | Ga0207683_10404354 | Ga0207683_104043542 | 260 |
| 785 | 3300026142 | Ga0207698_10014070 | Ga0207698_100140702 | 260 |
| 786 | 3300027907 | Ga0207428_10000181 | Ga0207428_1000018177 | 260 |
| 787 | 3300027907 | Ga0207428_10013218 | Ga0207428_100132183 | 260 |
| 788 | 3300028379 | Ga0268266_10112398 | Ga0268266_101123981 | 260 |
| 789 | 3300028381 | Ga0268264_10102520 | Ga0268264_101025201 | 260 |
| 790 | 3300034957 | Ga0373938_0045743 | Ga0373938_0045743_155_937 | 260 |
| 791 | 3300035084 | Ga0373928_0006299 | Ga0373928_0006299_121_903 | 260 |
| 792 | 3300035091 | Ga0373951_0025306 | Ga0373951_0025306_272_1054 | 260 |
| 793 | 3300035207 | Ga0373942_0036068 | Ga0373942_0036068_320_1102 | 260 |
| 794 | 3300035691 | Ga0373931_0113159 | Ga0373931_0113159_737_1519 | 260 |
| 795 | 3300041405 | Ga0439438_010111 | Ga0439438_010111_839_1900 | 260 |
| 796 | 3300042876 | Ga0451577_0013304 | Ga0451577_0013304_4105_4947 | 260 |
| 797 | 3300044712 | Ga0453684_0215937 | Ga0453684_0215937_992_1834 | 260 |
| 798 | 3300046455 | Ga0495603_0009479 | Ga0495603_0009479_1642_2445 | 260 |
| 799 | 3300046474 | Ga0495605_0146463 | Ga0495605_0146463_29_832 | 260 |
| 800 | 3300046615 | Ga0495656_0019032 | Ga0495656_0019032_1386_2189 | 260 |
| 801 | 3300046794 | Ga0495589_0031760 | Ga0495589_0031760_1309_2112 | 260 |
| 802 | 3300048904 | Ga0496101_0229900 | Ga0496101_0229900_315_1118 | 260 |
| 803 | 3300048905 | Ga0496102_0402721 | Ga0496102_0402721_173_955 | 260 |
| 804 | 3300048906 | Ga0496103_0257920 | Ga0496103_0257920_202_984 | 260 |
| 805 | 3300048907 | Ga0496104_0106807 | Ga0496104_0106807_622_1425 | 260 |
| 806 | 3300048908 | Ga0496105_0069692 | Ga0496105_0069692_1340_2122 | 260 |
| 807 | 3300048910 | Ga0496107_0023742 | Ga0496107_0023742_993_1775 | 260 |
| 808 | 3300048911 | Ga0496108_0099031 | Ga0496108_0099031_775_1557 | 260 |
| 809 | 3300048911 | Ga0496108_0134961 | Ga0496108_0134961_704_1507 | 260 |
| 810 | 3300048912 | Ga0496109_0026271 | Ga0496109_0026271_863_1645 | 260 |
| 811 | 3300048913 | Ga0496110_0017812 | Ga0496110_0017812_3269_4051 | 260 |
| 812 | 3300048913 | Ga0496110_0166123 | Ga0496110_0166123_312_1109 | 260 |
| 813 | 3300048913 | Ga0496110_0257401 | Ga0496110_0257401_142_942 | 260 |
| 814 | 3300048914 | Ga0496111_0096517 | Ga0496111_0096517_173_955 | 260 |
| 815 | 3300048915 | Ga0496112_0307749 | Ga0496112_0307749_340_1122 | 260 |
| 816 | 3300048916 | Ga0496113_0039042 | Ga0496113_0039042_1936_2718 | 260 |
| 817 | 3300049568 | Ga0501031_0033548 | Ga0501031_0033548_1898_2701 | 260 |
| 818 | 3300049572 | Ga0501036_0036626 | Ga0501036_0036626_1441_2244 | 260 |
| 819 | 3300049573 | Ga0501037_0105900 | Ga0501037_0105900_1174_1977 | 260 |
| 820 | 3300049574 | Ga0501038_0129668 | Ga0501038_0129668_699_1502 | 260 |
| 821 | 3300049575 | Ga0501039_0007709 | Ga0501039_0007709_6035_6838 | 260 |
| 822 | 3300049576 | Ga0501040_0055410 | Ga0501040_0055410_755_1558 | 260 |
| 823 | 3300049577 | Ga0501041_0038812 | Ga0501041_0038812_1378_2181 | 260 |
| 824 | 3300049578 | Ga0501042_0113157 | Ga0501042_0113157_179_982 | 260 |
| 825 | 3300049580 | Ga0501046_0093793 | Ga0501046_0093793_500_1303 | 260 |
| 826 | 3300049582 | Ga0501048_0015470 | Ga0501048_0015470_4184_4987 | 260 |
| 827 | 3300049587 | Ga0501071_0001083 | Ga0501071_0001083_2043_2846 | 260 |
| 828 | 3300049587 | Ga0501071_0013395 | Ga0501071_0013395_2925_3728 | 260 |
| 829 | 3300049588 | Ga0501072_0016036 | Ga0501072_0016036_4721_5524 | 260 |
| 830 | 3300049589 | Ga0501073_0050481 | Ga0501073_0050481_81_884 | 260 |
| 831 | 3300049590 | Ga0501074_0283510 | Ga0501074_0283510_293_1096 | 260 |
| 832 | 3300049591 | Ga0501075_0003018 | Ga0501075_0003018_5325_6128 | 260 |
| 833 | 3300049592 | Ga0501076_0011794 | Ga0501076_0011794_2826_3629 | 260 |
| 834 | 3300049593 | Ga0501077_0001393 | Ga0501077_0001393_1293_2096 | 260 |
| 835 | 3300049741 | Ga0501079_0008393 | Ga0501079_0008393_1430_2233 | 260 |
| 836 | 3300049742 | Ga0501080_0058666 | Ga0501080_0058666_1118_1921 | 260 |
| 837 | 3300049743 | Ga0501081_0016532 | Ga0501081_0016532_2115_2918 | 260 |
| 838 | 3300049823 | Ga0501044_0285897 | Ga0501044_0285897_204_1007 | 260 |
| 839 | 3300049824 | Ga0501045_0010860 | Ga0501045_0010860_4149_4952 | 260 |
| 840 | 3300050492 | nmdc:mga0yw44_18369_c1 | nmdc:mga0yw44_18369_c1_496_1296 | 260 |
| 841 | 3300050492 | nmdc:mga0yw44_47549_c1 | nmdc:mga0yw44_47549_c1_1192_1995 | 260 |
| 842 | 3300050507 | nmdc:mga05p37_152362_c1 | nmdc:mga05p37_152362_c1_1690_2493 | 260 |
| 843 | 3300050508 | nmdc:mga09592_51891_c1 | nmdc:mga09592_51891_c1_902_1705 | 260 |
| 844 | 3300050511 | nmdc:mga08y16_14638_c1 | nmdc:mga08y16_14638_c1_2919_3716 | 260 |
| 845 | 3300050511 | nmdc:mga08y16_254941_c1 | nmdc:mga08y16_254941_c1_174_956 | 260 |
| 846 | 3300050515 | nmdc:mga0a205_2010_c1 | nmdc:mga0a205_2010_c1_184_987 | 260 |
| 847 | 3300050515 | nmdc:mga0a205_660214_c1 | nmdc:mga0a205_660214_c1_92_874 | 260 |
| 848 | 3300054114 | Ga0501084_0015419 | Ga0501084_0015419_1993_2796 | 260 |
| 849 | 3300054114 | Ga0501084_0499999 | Ga0501084_0499999_38_841 | 260 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.9903 | 1 | 248 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9895 | 1 | 247 |
| 3tb5-assembly2.cif.gz_B | crystal structure of the enterococcus faecalis methionine aminopeptidase apo form | 0.986 | 1 | 249 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.986 | 1 | 246 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9816 | 1 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6Z3V9_1_121_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9912 | 15 | 123 | 3.90.230.10 |
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9904 | 1 | 247 | 3.90.230.10 |
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.986 | 1 | 246 | 3.90.230.10 |
| af_P9WK21_10_265_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9829 | 1 | 247 | 3.90.230.10 |
| af_Q4VBS4_53_336_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9828 | 1 | 247 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7PQL7-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9983 | 1 | 247 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A554JTL7-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.996 | 32 | 247 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A3D0E855-F1-model_v4 | deleted | 0.9957 | 1 | 246 |
|
| AF-A0A6N8I3V3-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9956 | 1 | 247 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-C7LQ58-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9954 | 2 | 247 |
GO:0004239
GO:0006508 GO:0046872 GO:0070006 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar