F483392

General Info

Members Datasets Scaffolds Average Seq Length
849 303 847 259

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10314612|Ga0075365_103146122
Length 290
Sequence VIIRKGAAEIARIARAGELVAKTIAHVGEHIEPGVTTVELDDVADAFIRANGGVPTSLGYRGYPRAICISVDEVVVHGIPDARIIEEGDLVTIDVGVTLDGAIADSAYTFGVGTVDAEAQRLLDVCQDALAAGIAEARLGNRIGDISHAVQTLVEEAGFSVVKSLVGHGVGRHYHEDPHVPNFGEPGRGPRLSEGMTIAIEPMITMGRPEVVLAEDGWTISSADGSRAAHFEHTVAILPDGPRILTPRVGSRRARASRRPDSGRPRDRKDAGFATVSGPRGGGFSVRGIS

Samples

Sample ID Description Type Environment
1 2867475112 Streptomyces sp. TM32 Isolate Unclassified
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
196 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
197 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
198 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
203 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
206 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
207 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
208 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
209 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
210 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
211 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
212 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
213 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
214 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
303 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.12
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 3.65
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1006401 3300002074 Bacteria 1370
2 JGI24738J21930_10004317 3300002075 Unclassified 3498
3 JGI25406J46586_10011827 3300003203 Unclassified 3809
4 JGI25160J50197_1012574 3300003354 Bacteria 2930
5 JGI25407J50210_10002038 3300003373 Bacteria 4711
6 JGI25407J50210_10010081 3300003373 Bacteria 2401
7 Ga0065712_10070868 3300005290 Bacteria 5642
8 Ga0065715_10021290 3300005293 Bacteria 1883
9 Ga0065707_10237328 3300005295 Bacteria 1155
10 Ga0070658_10010785 3300005327 Bacteria 7325
11 Ga0070676_10108046 3300005328 Bacteria 1728
12 Ga0070676_10392510 3300005328 Bacteria 964
13 Ga0070683_100000726 3300005329 Bacteria 24102
14 Ga0070683_100009922 3300005329 Bacteria 8162
15 Ga0070683_100043756 3300005329 Bacteria 4127
16 Ga0070683_100084911 3300005329 Bacteria 2967
17 Ga0070683_100207816 3300005329 Bacteria 1859
18 Ga0070683_100307032 3300005329 Bacteria 1509
19 Ga0070690_100147623 3300005330 Bacteria 1601
20 Ga0070670_100148007 3300005331 Bacteria 2032
21 Ga0070670_100230401 3300005331 Bacteria 1612
22 Ga0068869_100012691 3300005334 Bacteria 5573
23 Ga0068869_100229827 3300005334 Bacteria 1473
24 Ga0068869_100564387 3300005334 Bacteria 958
25 Ga0070666_10190318 3300005335 Bacteria 1441
26 Ga0070680_100390189 3300005336 Bacteria 1186
27 Ga0070680_100464555 3300005336 Bacteria 1081
28 Ga0070682_100031746 3300005337 Bacteria 3196
29 Ga0070682_100127151 3300005337 Bacteria 1719
30 Ga0070682_100401730 3300005337 Bacteria 1036
31 Ga0068868_100028641 3300005338 Bacteria 4260
32 Ga0068868_100363306 3300005338 Bacteria 1242
33 Ga0068868_100423937 3300005338 Bacteria 1152
34 Ga0070660_100017962 3300005339 Bacteria 5161
35 Ga0070660_100048573 3300005339 Bacteria 3259
36 Ga0070660_100105368 3300005339 Bacteria 2238
37 Ga0070660_100329361 3300005339 Bacteria 1255
38 Ga0070691_10003867 3300005341 Bacteria 6767
39 Ga0070691_10034218 3300005341 Bacteria 2391
40 Ga0070691_10037701 3300005341 Bacteria 2281
41 Ga0070661_100010076 3300005344 Bacteria 6563
42 Ga0070661_100053195 3300005344 Bacteria 2963
43 Ga0070692_10019897 3300005345 Bacteria 3246
44 Ga0070692_10064286 3300005345 Bacteria 1940
45 Ga0070668_100070704 3300005347 Bacteria 2717
46 Ga0070668_100093920 3300005347 Bacteria 2367
47 Ga0070668_100113261 3300005347 Bacteria 2161
48 Ga0070669_100001695 3300005353 Bacteria 15953
49 Ga0070669_100650324 3300005353 Bacteria 887
50 Ga0070675_100041134 3300005354 Bacteria 3775
51 Ga0070675_100061051 3300005354 Bacteria 3112
52 Ga0070675_100137200 3300005354 Bacteria 2088
53 Ga0070675_100267156 3300005354 Bacteria 1500
54 Ga0070671_100060488 3300005355 Bacteria 3154
55 Ga0070671_100062030 3300005355 Bacteria 3113
56 Ga0070671_100069069 3300005355 Bacteria 2946
57 Ga0070674_100021069 3300005356 Bacteria 4179
58 Ga0070674_100040505 3300005356 Bacteria 3152
59 Ga0070674_100041590 3300005356 Bacteria 3116
60 Ga0070674_100042929 3300005356 Bacteria 3074
61 Ga0070674_100183521 3300005356 Bacteria 1604
62 Ga0070673_100019981 3300005364 Bacteria 4821
63 Ga0070688_100019230 3300005365 Bacteria 3955
64 Ga0070688_100078573 3300005365 Bacteria 2129
65 Ga0070688_100216061 3300005365 Bacteria 1349
66 Ga0070659_100022749 3300005366 Bacteria 4788
67 Ga0070659_100091822 3300005366 Bacteria 2434
68 Ga0070659_100173710 3300005366 Bacteria 1766
69 Ga0070659_100201856 3300005366 Bacteria 1637
70 Ga0070659_100584563 3300005366 Bacteria 958
71 Ga0070701_10109767 3300005438 Bacteria 1539
72 Ga0070701_10166397 3300005438 Bacteria 1281
73 Ga0070701_10268780 3300005438 Bacteria 1036
74 Ga0070700_100248892 3300005441 Bacteria 1274
75 Ga0070700_100434057 3300005441 Bacteria 995
76 Ga0070694_100208965 3300005444 Bacteria 1459
77 Ga0070663_100027522 3300005455 Bacteria 3862
78 Ga0070663_100063895 3300005455 Bacteria 2659
79 Ga0070663_100200179 3300005455 Bacteria 1558
80 Ga0070678_100058968 3300005456 Bacteria 2819
81 Ga0070678_100097324 3300005456 Bacteria 2272
82 Ga0070678_100110108 3300005456 Bacteria 2153
83 Ga0070678_100269414 3300005456 Bacteria 1435
84 Ga0070662_100017781 3300005457 Bacteria 4797
85 Ga0070662_100040253 3300005457 Bacteria 3326
86 Ga0070662_100117753 3300005457 Bacteria 2032
87 Ga0070662_100149537 3300005457 Bacteria 1817
88 Ga0070681_10300368 3300005458 Bacteria 1515
89 Ga0068867_100049389 3300005459 Bacteria 3097
90 Ga0068867_100246320 3300005459 Bacteria 1451
91 Ga0070707_100096597 3300005468 Bacteria 2862
92 Ga0070707_100373712 3300005468 Bacteria 1385
93 Ga0070698_100001954 3300005471 Bacteria 22884
94 Ga0070699_100121129 3300005518 Bacteria 2301
95 Ga0070699_100495249 3300005518 Unclassified 1110
96 Ga0070679_100099326 3300005530 Bacteria 2898
97 Ga0070679_100436369 3300005530 Bacteria 1255
98 Ga0070684_100083429 3300005535 Bacteria 2832
99 Ga0070684_100101399 3300005535 Bacteria 2572
100 Ga0070684_100114067 3300005535 Bacteria 2425
101 Ga0070684_100402910 3300005535 Bacteria 1261
102 Ga0070684_100476083 3300005535 Bacteria 1155
103 Ga0070684_100570992 3300005535 Bacteria 1050
104 Ga0070697_100199816 3300005536 Bacteria 1699
105 Ga0068853_100092055 3300005539 Bacteria 2667
106 Ga0068853_100414531 3300005539 Bacteria 1262
107 Ga0068853_100480312 3300005539 Bacteria 1171
108 Ga0070672_100035663 3300005543 Bacteria 3782
109 Ga0070672_100077300 3300005543 Bacteria 2661
110 Ga0070672_100155724 3300005543 Bacteria 1892
111 Ga0070686_100082484 3300005544 Bacteria 2132
112 Ga0070696_100082497 3300005546 Bacteria 2279
113 Ga0070693_100095721 3300005547 Bacteria 1798
114 Ga0070665_100140484 3300005548 Bacteria 2418
115 Ga0070704_100051520 3300005549 Bacteria 2899
116 Ga0068855_100158907 3300005563 Bacteria 2566
117 Ga0068855_100691304 3300005563 Unclassified 1092
118 Ga0070664_100004358 3300005564 Bacteria 11371
119 Ga0070664_100010033 3300005564 Bacteria 7675
120 Ga0070664_100413985 3300005564 Bacteria 1234
121 Ga0070664_100653388 3300005564 Bacteria 977
122 Ga0068857_100608269 3300005577 Unclassified 1033
123 Ga0068854_100021594 3300005578 Bacteria 4370
124 Ga0068854_100099990 3300005578 Bacteria 2173
125 Ga0068854_100470447 3300005578 Bacteria 1053
126 Ga0068856_100306283 3300005614 Bacteria 1607
127 Ga0068856_100699949 3300005614 Bacteria 1034
128 Ga0070702_100273883 3300005615 Bacteria 1155
129 Ga0068852_100162678 3300005616 Bacteria 2085
130 Ga0068852_100462886 3300005616 Bacteria 1257
131 Ga0068852_100709780 3300005616 Bacteria 1016
132 Ga0068859_100038389 3300005617 Bacteria 4805
133 Ga0068859_100049834 3300005617 Bacteria 4206
134 Ga0068859_100242972 3300005617 Bacteria 1890
135 Ga0068864_100151738 3300005618 Bacteria 2099
136 Ga0068866_10216495 3300005718 Bacteria 1153
137 Ga0068861_100272968 3300005719 Bacteria 1453
138 Ga0068861_100315511 3300005719 Unclassified 1360
139 Ga0068861_100345788 3300005719 Bacteria 1303
140 Ga0068851_10029573 3300005834 Bacteria 2713
141 Ga0068870_10027826 3300005840 Bacteria 2832
142 Ga0068870_10098639 3300005840 Bacteria 1646
143 Ga0068870_10127219 3300005840 Bacteria 1475
144 Ga0068863_100176216 3300005841 Bacteria 2052
145 Ga0068858_100046786 3300005842 Bacteria 4010
146 Ga0068860_100027971 3300005843 Bacteria 5429
147 Ga0068860_100601624 3300005843 Bacteria 1105
148 Ga0068862_100040658 3300005844 Bacteria 3953
149 Ga0068862_100088910 3300005844 Bacteria 2688
150 Ga0068862_100143650 3300005844 Bacteria 2119
151 Ga0068862_100550823 3300005844 Bacteria 1101
152 Ga0081455_10006029 3300005937 Bacteria 13133
153 Ga0081455_10031276 3300005937 Bacteria 4819
154 Ga0081455_10047065 3300005937 Bacteria 3738
155 Ga0081455_10080350 3300005937 Bacteria 2673
156 Ga0081455_10126583 3300005937 Bacteria 2004
157 Ga0081455_10166555 3300005937 Bacteria 1683
158 Ga0081538_10001905 3300005981 Bacteria 20952
159 Ga0081538_10003017 3300005981 Bacteria 16026
160 Ga0081538_10004338 3300005981 Bacteria 13097
161 Ga0081538_10012849 3300005981 Bacteria 6681
162 Ga0081538_10014859 3300005981 Bacteria 6067
163 Ga0081538_10070824 3300005981 Bacteria 1922
164 Ga0081540_1104800 3300005983 Bacteria 1209
165 Ga0081539_10000433 3300005985 Bacteria 89118
166 Ga0081539_10011818 3300005985 Bacteria 6832
167 Ga0075365_10009452 3300006038 Bacteria 5606
168 Ga0075365_10021528 3300006038 Bacteria 4024
169 Ga0075365_10314612 3300006038 Bacteria 1102
170 Ga0075365_10416730 3300006038 Bacteria 948
171 Ga0075432_10015139 3300006058 Bacteria 2629
172 Ga0097621_100024219 3300006237 Bacteria 4737
173 Ga0097621_100079474 3300006237 Bacteria 2726
174 Ga0068871_100208481 3300006358 Bacteria 1690
175 Ga0068871_100416634 3300006358 Bacteria 1199
176 Ga0075428_100004768 3300006844 Bacteria 15015
177 Ga0075428_100006199 3300006844 Bacteria 13302
178 Ga0075428_100028437 3300006844 Bacteria 6185
179 Ga0075428_100073820 3300006844 Bacteria 3726
180 Ga0075428_100219366 3300006844 Bacteria 2054
181 Ga0075428_100361103 3300006844 Bacteria 1558
182 Ga0075428_100566912 3300006844 Bacteria 1213
183 Ga0075430_100004496 3300006846 Bacteria 11750
184 Ga0075430_100006208 3300006846 Bacteria 10075
185 Ga0075430_100016007 3300006846 Bacteria 6386
186 Ga0075430_100147575 3300006846 Bacteria 1959
187 Ga0075430_100430170 3300006846 Bacteria 1089
188 Ga0075431_100004224 3300006847 Bacteria 14071
189 Ga0075431_100014147 3300006847 Bacteria 8068
190 Ga0075431_100014487 3300006847 Bacteria 7977
191 Ga0075431_100023806 3300006847 Bacteria 6268
192 Ga0075431_100102472 3300006847 Bacteria 2954
193 Ga0075431_100160303 3300006847 Bacteria 2313
194 Ga0075431_100432973 3300006847 Bacteria 1313
195 Ga0075433_10035210 3300006852 Bacteria 4304
196 Ga0075433_10272836 3300006852 Bacteria 1499
197 Ga0075434_100100364 3300006871 Bacteria 2900
198 Ga0075429_100001166 3300006880 Bacteria 21212
199 Ga0075429_100003288 3300006880 Bacteria 13756
200 Ga0075429_100004700 3300006880 Bacteria 11750
201 Ga0075429_100047699 3300006880 Bacteria 3726
202 Ga0075429_100131214 3300006880 Bacteria 2192
203 Ga0075429_100144630 3300006880 Bacteria 2081
204 Ga0075429_100264330 3300006880 Bacteria 1507
205 Ga0075429_100521353 3300006880 Bacteria 1041
206 Ga0068865_100036260 3300006881 Bacteria 3323
207 Ga0068865_100059793 3300006881 Bacteria 2666
208 Ga0068865_100064080 3300006881 Bacteria 2586
209 Ga0068865_100232198 3300006881 Bacteria 1448
210 Ga0075436_100035555 3300006914 Bacteria 3436
211 Ga0097620_100038389 3300006931 Bacteria 4805
212 Ga0097620_100049836 3300006931 Bacteria 4206
213 Ga0097620_100242983 3300006931 Bacteria 1890
214 Ga0105240_10202343 3300009093 Bacteria 2326
215 Ga0105240_10547015 3300009093 Bacteria 1281
216 Ga0111539_10008690 3300009094 Bacteria 12890
217 Ga0111539_10059988 3300009094 Bacteria 4509
218 Ga0111539_10081413 3300009094 Bacteria 3808
219 Ga0111539_10121671 3300009094 Bacteria 3058
220 Ga0111539_10137421 3300009094 Bacteria 2862
221 Ga0111539_10137909 3300009094 Bacteria 2857
222 Ga0111539_10268456 3300009094 Bacteria 1986
223 Ga0111539_10315418 3300009094 Bacteria 1819
224 Ga0111539_10357808 3300009094 Bacteria 1699
225 Ga0111539_10760519 3300009094 Bacteria 1128
226 Ga0105245_10039562 3300009098 Bacteria 4197
227 Ga0105245_10041639 3300009098 Bacteria 4094
228 Ga0105245_10411317 3300009098 Bacteria 1354
229 Ga0105247_10046136 3300009101 Bacteria 2674
230 Ga0114129_10013234 3300009147 Bacteria 11750
231 Ga0114129_10033068 3300009147 Bacteria 7309
232 Ga0114129_10043279 3300009147 Bacteria 6335
233 Ga0114129_10183448 3300009147 Bacteria 2846
234 Ga0114129_10238681 3300009147 Bacteria 2444
235 Ga0114129_10348568 3300009147 Bacteria 1962
236 Ga0114129_10563445 3300009147 Bacteria 1480
237 Ga0105243_10035607 3300009148 Bacteria 3860
238 Ga0105243_10100000 3300009148 Bacteria 2405
239 Ga0105243_10122737 3300009148 Bacteria 2193
240 Ga0105243_10254320 3300009148 Bacteria 1570
241 Ga0105243_10520870 3300009148 Bacteria 1131
242 Ga0105241_10072501 3300009174 Bacteria 2677
243 Ga0105242_10030307 3300009176 Bacteria 4320
244 Ga0105242_10104555 3300009176 Bacteria 2404
245 Ga0105242_10181157 3300009176 Bacteria 1859
246 Ga0105248_10087502 3300009177 Bacteria 3506
247 Ga0105248_10158140 3300009177 Bacteria 2557
248 Ga0105238_10038782 3300009551 Bacteria 4836
249 Ga0105238_10096099 3300009551 Bacteria 2949
250 Ga0105238_10327807 3300009551 Bacteria 1517
251 Ga0105249_10002497 3300009553 Bacteria 15920
252 Ga0105249_10298265 3300009553 Bacteria 1615
253 Ga0105249_10416330 3300009553 Bacteria 1377
254 Ga0105239_10052822 3300010375 Bacteria 4457
255 Ga0105239_10152239 3300010375 Bacteria 2582
256 Ga0105239_10324882 3300010375 Bacteria 1735
257 Ga0105246_10049177 3300011119 Bacteria 2886
258 Ga0105246_10114755 3300011119 Bacteria 1985
259 Ga0105246_10172615 3300011119 Bacteria 1657
260 Ga0105246_10363322 3300011119 Bacteria 1190
261 Ga0157371_10061279 3300013102 Bacteria 2667
262 Ga0157374_10123125 3300013296 Bacteria 2505
263 Ga0157378_10737456 3300013297 Bacteria 1007
264 Ga0163162_10081796 3300013306 Bacteria 3301
265 Ga0163162_10794903 3300013306 Bacteria 1064
266 Ga0157372_10067081 3300013307 Bacteria 4031
267 Ga0157372_10108401 3300013307 Bacteria 3178
268 Ga0157372_10300965 3300013307 Bacteria 1865
269 Ga0157372_10553710 3300013307 Bacteria 1341
270 Ga0157375_10136867 3300013308 Bacteria 2574
271 Ga0157375_10380097 3300013308 Bacteria 1579
272 Ga0157375_10740519 3300013308 Bacteria 1135
273 Ga0163163_10096702 3300014325 Bacteria 2974
274 Ga0163163_10103012 3300014325 Bacteria 2878
275 Ga0163163_10197777 3300014325 Bacteria 2058
276 Ga0163163_10267244 3300014325 Bacteria 1762
277 Ga0163163_10385625 3300014325 Unclassified 1459
278 Ga0157380_10047519 3300014326 Bacteria 3377
279 Ga0157380_10129723 3300014326 Bacteria 2149
280 Ga0157380_10538289 3300014326 Bacteria 1143
281 Ga0157380_10562006 3300014326 Bacteria 1121
282 Ga0157380_10588274 3300014326 Bacteria 1099
283 Ga0182008_10082412 3300014497 Bacteria 1583
284 Ga0157377_10009126 3300014745 Bacteria 4857
285 Ga0157377_10439888 3300014745 Bacteria 898
286 Ga0157379_10163590 3300014968 Bacteria 2008
287 Ga0157379_10276812 3300014968 Bacteria 1527
288 Ga0157379_10448881 3300014968 Bacteria 1190
289 Ga0157376_10045570 3300014969 Bacteria 3612
290 Ga0157376_10071200 3300014969 Bacteria 2954
291 Ga0163161_10081962 3300017792 Bacteria 2376
292 Ga0163161_10131546 3300017792 Bacteria 1888
293 Ga0206353_11223501 3300020082 Bacteria 1347
294 Ga0207426_1059139 3300025302 Bacteria 1109
295 Ga0207682_10187268 3300025893 Bacteria 947
296 Ga0207642_10105205 3300025899 Bacteria 1425
297 Ga0207688_10016881 3300025901 Bacteria 3965
298 Ga0207688_10036391 3300025901 Bacteria 2728
299 Ga0207680_10278277 3300025903 Bacteria 1162
300 Ga0207647_10021889 3300025904 Bacteria 4256
301 Ga0207645_10064369 3300025907 Bacteria 2343
302 Ga0207643_10048389 3300025908 Bacteria 2408
303 Ga0207643_10135575 3300025908 Bacteria 1467
304 Ga0207705_10002123 3300025909 Bacteria 15388
305 Ga0207705_10013197 3300025909 Bacteria 5964
306 Ga0207705_10030861 3300025909 Bacteria 3825
307 Ga0207707_10139507 3300025912 Bacteria 2120
308 Ga0207695_10004617 3300025913 Bacteria 18682
309 Ga0207660_10345055 3300025917 Bacteria 1192
310 Ga0207657_10001138 3300025919 Bacteria 28229
311 Ga0207657_10028407 3300025919 Bacteria 5103
312 Ga0207657_10294684 3300025919 Bacteria 1286
313 Ga0207657_10297142 3300025919 Bacteria 1280
314 Ga0207657_10317004 3300025919 Bacteria 1233
315 Ga0207649_10020612 3300025920 Bacteria 3782
316 Ga0207649_10079656 3300025920 Bacteria 2117
317 Ga0207646_10044515 3300025922 Bacteria 3985
318 Ga0207646_10314340 3300025922 Bacteria 1415
319 Ga0207681_10151818 3300025923 Bacteria 1737
320 Ga0207681_10504880 3300025923 Bacteria 990
321 Ga0207681_10582520 3300025923 Bacteria 923
322 Ga0207694_10010017 3300025924 Bacteria 7144
323 Ga0207650_10006120 3300025925 Bacteria 8199
324 Ga0207650_10424144 3300025925 Bacteria 1104
325 Ga0207659_10193525 3300025926 Bacteria 1619
326 Ga0207659_10306903 3300025926 Bacteria 1305
327 Ga0207659_10375175 3300025926 Bacteria 1185
328 Ga0207659_10559143 3300025926 Bacteria 973
329 Ga0207687_10018414 3300025927 Bacteria 4610
330 Ga0207687_10030837 3300025927 Bacteria 3618
331 Ga0207644_10038542 3300025931 Bacteria 3368
332 Ga0207644_10064475 3300025931 Bacteria 2662
333 Ga0207690_10096274 3300025932 Bacteria 2104
334 Ga0207690_10402741 3300025932 Bacteria 1091
335 Ga0207706_10023631 3300025933 Bacteria 5520
336 Ga0207706_10089715 3300025933 Bacteria 2703
337 Ga0207686_10020647 3300025934 Bacteria 3766
338 Ga0207686_10059068 3300025934 Bacteria 2421
339 Ga0207686_10461754 3300025934 Bacteria 979
340 Ga0207709_10015196 3300025935 Bacteria 4267
341 Ga0207709_10020150 3300025935 Bacteria 3759
342 Ga0207669_10006019 3300025937 Bacteria 5503
343 Ga0207669_10039257 3300025937 Bacteria 2734
344 Ga0207669_10075544 3300025937 Bacteria 2135
345 Ga0207704_10038463 3300025938 Bacteria 2775
346 Ga0207704_10065645 3300025938 Bacteria 2273
347 Ga0207704_10072194 3300025938 Bacteria 2193
348 Ga0207704_10255167 3300025938 Bacteria 1319
349 Ga0207691_10041610 3300025940 Bacteria 4241
350 Ga0207691_10044419 3300025940 Bacteria 4091
351 Ga0207691_10173734 3300025940 Bacteria 1885
352 Ga0207691_10250954 3300025940 Bacteria 1527
353 Ga0207711_10113217 3300025941 Bacteria 2415
354 Ga0207689_10029116 3300025942 Bacteria 4615
355 Ga0207689_10071972 3300025942 Bacteria 2840
356 Ga0207689_10095522 3300025942 Bacteria 2441
357 Ga0207689_10516871 3300025942 Bacteria 1001
358 Ga0207689_10585097 3300025942 Bacteria 938
359 Ga0207661_10427951 3300025944 Bacteria 1203
360 Ga0207661_10529543 3300025944 Unclassified 1078
361 Ga0207679_10002463 3300025945 Bacteria 11399
362 Ga0207679_10413219 3300025945 Bacteria 1189
363 Ga0207679_10510108 3300025945 Bacteria 1074
364 Ga0207667_10025589 3300025949 Bacteria 6457
365 Ga0207667_10074146 3300025949 Bacteria 3535
366 Ga0207667_10149044 3300025949 Bacteria 2408
367 Ga0207651_10147920 3300025960 Bacteria 1824
368 Ga0207712_10248203 3300025961 Bacteria 1437
369 Ga0207712_10296183 3300025961 Bacteria 1326
370 Ga0207712_10384915 3300025961 Bacteria 1175
371 Ga0207668_10095859 3300025972 Bacteria 2191
372 Ga0207668_10358386 3300025972 Bacteria 1221
373 Ga0207640_10003259 3300025981 Bacteria 8750
374 Ga0207640_10028606 3300025981 Bacteria 3410
375 Ga0207658_10089775 3300025986 Bacteria 2380
376 Ga0207658_10098308 3300025986 Bacteria 2287
377 Ga0207639_10079382 3300026041 Bacteria 2593
378 Ga0207639_10171574 3300026041 Bacteria 1837
379 Ga0207639_10484977 3300026041 Bacteria 1127
380 Ga0207678_10001614 3300026067 Bacteria 20747
381 Ga0207708_10021383 3300026075 Bacteria 4878
382 Ga0207708_10096513 3300026075 Bacteria 2284
383 Ga0207708_10236944 3300026075 Bacteria 1467
384 Ga0207702_10981586 3300026078 Bacteria 838
385 Ga0207641_10049012 3300026088 Bacteria 3568
386 Ga0207641_10504156 3300026088 Bacteria 1176
387 Ga0207648_10056939 3300026089 Bacteria 3411
388 Ga0207648_10070364 3300026089 Bacteria 3050
389 Ga0207648_10105618 3300026089 Bacteria 2471
390 Ga0207648_10174394 3300026089 Bacteria 1901
391 Ga0207674_10682938 3300026116 Bacteria 991
392 Ga0207675_100109639 3300026118 Bacteria 2604
393 Ga0207675_100189636 3300026118 Bacteria 1971
394 Ga0207675_100389911 3300026118 Bacteria 1371
395 Ga0207675_100517008 3300026118 Bacteria 1190
396 Ga0207683_10128796 3300026121 Bacteria 2276
397 Ga0207683_10129707 3300026121 Bacteria 2267
398 Ga0207683_10245640 3300026121 Bacteria 1633
399 Ga0207683_10301819 3300026121 Bacteria 1465
400 Ga0207683_10308742 3300026121 Bacteria 1448
401 Ga0207683_10404354 3300026121 Bacteria 1256
402 Ga0207698_10014070 3300026142 Bacteria 5304
403 Ga0209970_1006919 3300027614 Bacteria 1861
404 Ga0207428_10000181 3300027907 Bacteria 88299
405 Ga0207428_10000940 3300027907 Bacteria 32377
406 Ga0207428_10013218 3300027907 Bacteria 7223
407 Ga0207428_10028260 3300027907 Bacteria 4661
408 Ga0207428_10033089 3300027907 Bacteria 4248
409 Ga0268266_10112398 3300028379 Bacteria 2415
410 Ga0268265_10069296 3300028380 Bacteria 2738
411 Ga0268265_10283140 3300028380 Bacteria 1484
412 Ga0268264_10102520 3300028381 Bacteria 2490
413 Ga0265332_10001239 3300031238 Bacteria 14770
414 Ga0265332_10032007 3300031238 Bacteria 2293
415 Ga0307408_100014713 3300031548 Bacteria 5200
416 Ga0307408_100092663 3300031548 Bacteria 2284
417 Ga0307408_100147495 3300031548 Bacteria 1854
418 Ga0307408_100345762 3300031548 Bacteria 1260
419 Ga0265314_10021536 3300031711 Bacteria 4952
420 Ga0307405_10015462 3300031731 Bacteria 4135
421 Ga0307405_10019483 3300031731 Bacteria 3770
422 Ga0307405_10158482 3300031731 Bacteria 1600
423 Ga0307405_10222253 3300031731 Bacteria 1386
424 Ga0307405_10285619 3300031731 Bacteria 1244
425 Ga0307413_10034092 3300031824 Bacteria 2906
426 Ga0307413_10065310 3300031824 Bacteria 2265
427 Ga0307413_10073821 3300031824 Bacteria 2158
428 Ga0307413_10270250 3300031824 Bacteria 1272
429 Ga0307413_10324475 3300031824 Bacteria 1177
430 Ga0307410_10006908 3300031852 Bacteria 6167
431 Ga0307410_10035246 3300031852 Bacteria 3248
432 Ga0307410_10144593 3300031852 Bacteria 1763
433 Ga0307410_10334978 3300031852 Bacteria 1204
434 Ga0307406_10150192 3300031901 Bacteria 1661
435 Ga0307406_10172563 3300031901 Bacteria 1566
436 Ga0307406_10290417 3300031901 Bacteria 1251
437 Ga0307406_10323186 3300031901 Bacteria 1194
438 Ga0307407_10008769 3300031903 Bacteria 4665
439 Ga0307407_10011716 3300031903 Bacteria 4187
440 Ga0307407_10092500 3300031903 Bacteria 1857
441 Ga0307407_10113495 3300031903 Bacteria 1705
442 Ga0307407_10136373 3300031903 Bacteria 1577
443 Ga0307407_10178470 3300031903 Bacteria 1405
444 Ga0307407_10225928 3300031903 Bacteria 1268
445 Ga0307412_10032184 3300031911 Bacteria 3320
446 Ga0307412_10035950 3300031911 Bacteria 3169
447 Ga0307412_10152866 3300031911 Bacteria 1705
448 Ga0307412_10201863 3300031911 Bacteria 1510
449 Ga0307409_100004038 3300031995 Bacteria 8151
450 Ga0307409_100022546 3300031995 Bacteria 4344
451 Ga0307409_100029424 3300031995 Bacteria 3931
452 Ga0307409_100057205 3300031995 Bacteria 3020
453 Ga0307409_100252009 3300031995 Bacteria 1614
454 Ga0307409_100396684 3300031995 Bacteria 1316
455 Ga0307409_100855575 3300031995 Bacteria 920
456 Ga0307416_100011128 3300032002 Bacteria 5984
457 Ga0307416_100031363 3300032002 Bacteria 4000
458 Ga0307416_100116548 3300032002 Bacteria 2368
459 Ga0307416_100124086 3300032002 Bacteria 2309
460 Ga0307416_100159512 3300032002 Bacteria 2082
461 Ga0307416_100348465 3300032002 Bacteria 1497
462 Ga0307416_100358908 3300032002 Bacteria 1478
463 Ga0307416_100656510 3300032002 Bacteria 1134
464 Ga0307414_10018571 3300032004 Bacteria 4287
465 Ga0307414_10206247 3300032004 Bacteria 1603
466 Ga0307414_10293640 3300032004 Bacteria 1371
467 Ga0307414_10351472 3300032004 Bacteria 1265
468 Ga0307411_10010242 3300032005 Bacteria 4985
469 Ga0307411_10037532 3300032005 Bacteria 3047
470 Ga0307415_100002882 3300032126 Bacteria 8614
471 Ga0307415_100007232 3300032126 Bacteria 6060
472 Ga0307415_100010203 3300032126 Bacteria 5306
473 Ga0307415_100030385 3300032126 Bacteria 3467
474 Ga0307415_100032143 3300032126 Bacteria 3390
475 Ga0307415_100222013 3300032126 Bacteria 1515
476 Ga0373959_0030331 3300034820 Unclassified 1089
477 Ga0373938_0045743 3300034957 Bacteria 986
478 Ga0373928_0006299 3300035084 Bacteria 2282
479 Ga0373951_0025306 3300035091 Bacteria 1378
480 Ga0373943_0027797 3300035170 Bacteria 2661
481 Ga0373942_0036068 3300035207 Unclassified 1330
482 Ga0316574_0063247 3300035398 Bacteria 2327
483 Ga0373931_0113159 3300035691 Bacteria 1542
484 Ga0316584_0026232 3300036712 Bacteria 4282
485 Ga0395899_0111746 3300037312 Bacteria 1964
486 Ga0395900_0143240 3300037418 Bacteria 2446
487 Ga0395898_0042694 3300037466 Bacteria 4472
488 Ga0395898_0189316 3300037466 Bacteria 1966
489 Ga0395905_0319552 3300037471 Bacteria 1442
490 Ga0395901_0317491 3300038443 Bacteria 1612
491 Ga0395901_0815525 3300038443 Bacteria 921
492 Ga0439438_010111 3300041405 Bacteria 3007
493 Ga0439453_0007832 3300041408 Bacteria 1704
494 Ga0439461_0005197 3300041410 Bacteria 2210
495 Ga0451833_0895723 3300041491 Bacteria 2705
496 Ga0451853_1858440 3300041512 Bacteria 1131
497 Ga0439443_004916 3300042003 Bacteria 1767
498 Ga0439448_0002950 3300042005 Bacteria 4669
499 Ga0439448_0007317 3300042005 Bacteria 3196
500 Ga0439448_0011384 3300042005 Bacteria 2651
501 Ga0439450_000158 3300042008 Bacteria 7562
502 Ga0439451_009707 3300042009 Bacteria 1944
503 Ga0439451_015542 3300042009 Bacteria 1535
504 Ga0439455_0001859 3300042012 Bacteria 3688
505 Ga0439455_0024108 3300042012 Bacteria 1470
506 Ga0439456_012546 3300042013 Bacteria 1757
507 Ga0439463_015155 3300042016 Bacteria 1905
508 Ga0439463_021445 3300042016 Bacteria 1613
509 Ga0450912_008071 3300042116 Bacteria 867
510 Ga0450914_000145 3300042118 Bacteria 2457
511 Ga0450914_000312 3300042118 Bacteria 2080
512 Ga0450920_007738 3300042122 Bacteria 1950
513 Ga0450902_013431 3300042137 Bacteria 1319
514 Ga0450905_012360 3300042142 Bacteria 1201
515 Ga0439446_0065709 3300042156 Bacteria 1103
516 Ga0439435_0020022 3300042436 Bacteria 1721
517 Ga0439435_0047856 3300042436 Bacteria 1216
518 Ga0439444_0000598 3300042437 Bacteria 4144
519 Ga0439464_0002755 3300042439 Bacteria 4361
520 Ga0439464_0052653 3300042439 Bacteria 1179
521 Ga0439460_0003395 3300042461 Bacteria 3851
522 Ga0439460_0072430 3300042461 Bacteria 1070
523 Ga0450916_006767 3300042530 Bacteria 1359
524 Ga0450916_019153 3300042530 Bacteria 927
525 Ga0451577_0000018 3300042876 Bacteria 516495
526 Ga0451577_0013304 3300042876 Bacteria 7707
527 Ga0439440_0000656 3300042993 Bacteria 5899
528 Ga0439440_0012907 3300042993 Bacteria 1783
529 Ga0439440_0026233 3300042993 Bacteria 1347
530 Ga0439440_0029805 3300042993 Bacteria 1282
531 Ga0439440_0070224 3300042993 Bacteria 910
532 Ga0453683_0010655 3300044673 Bacteria 6087
533 Ga0453683_0127119 3300044673 Bacteria 1605
534 Ga0453684_0000166 3300044712 Bacteria 294291
535 Ga0453684_0215937 3300044712 Bacteria 2225
536 Ga0466959_0109449 3300045049 Bacteria 1973
537 Ga0451576_0076811 3300045051 Bacteria 3476
538 Ga0466967_0120373 3300045976 Bacteria 2424
539 Ga0495603_0009479 3300046455 Bacteria 5882
540 Ga0495605_0146463 3300046474 Bacteria 1056
541 Ga0495637_0155974 3300046520 Bacteria 859
542 Ga0495644_0056701 3300046523 Bacteria 1472
543 Ga0495656_0019032 3300046615 Bacteria 2645
544 Ga0495656_0127864 3300046615 Bacteria 1206
545 Ga0495668_0222359 3300046616 Bacteria 1034
546 Ga0495635_0107545 3300046663 Bacteria 1905
547 Ga0495661_0151986 3300046665 Bacteria 1250
548 Ga0495658_0204978 3300046683 Bacteria 1230
549 Ga0495613_0139481 3300046689 Bacteria 1733
550 Ga0495589_0031760 3300046794 Bacteria 2658
551 Ga0495676_0280356 3300047321 Bacteria 1129
552 Ga0495680_0045513 3300047322 Bacteria 3464
553 Ga0495675_0140580 3300047444 Bacteria 1497
554 Ga0495677_0051812 3300047445 Bacteria 1512
555 Ga0495684_0116625 3300047471 Bacteria 2013
556 Ga0496101_0057739 3300048904 Bacteria 2808
557 Ga0496101_0229900 3300048904 Bacteria 1441
558 Ga0496102_0402721 3300048905 Bacteria 1286
559 Ga0496103_0122877 3300048906 Bacteria 1655
560 Ga0496103_0257920 3300048906 Bacteria 1122
561 Ga0496104_0007555 3300048907 Bacteria 9614
562 Ga0496104_0106807 3300048907 Bacteria 2683
563 Ga0496104_0159220 3300048907 Bacteria 2166
564 Ga0496105_0069692 3300048908 Bacteria 2906
565 Ga0496105_0233566 3300048908 Bacteria 1494
566 Ga0496106_0081380 3300048909 Bacteria 2488
567 Ga0496107_0023742 3300048910 Bacteria 4334
568 Ga0496108_0003558 3300048911 Bacteria 12496
569 Ga0496108_0014247 3300048911 Bacteria 6488
570 Ga0496108_0099031 3300048911 Bacteria 2484
571 Ga0496108_0134961 3300048911 Bacteria 2122
572 Ga0496109_0001514 3300048912 Bacteria 19323
573 Ga0496109_0004877 3300048912 Bacteria 11204
574 Ga0496109_0026271 3300048912 Bacteria 5191
575 Ga0496110_0002017 3300048913 Bacteria 15118
576 Ga0496110_0017812 3300048913 Bacteria 5945
577 Ga0496110_0166123 3300048913 Bacteria 2001
578 Ga0496110_0257401 3300048913 Bacteria 1589
579 Ga0496111_0013343 3300048914 Bacteria 5588
580 Ga0496111_0027483 3300048914 Bacteria 4025
581 Ga0496111_0096517 3300048914 Bacteria 2169
582 Ga0496112_0003519 3300048915 Bacteria 12986
583 Ga0496112_0055411 3300048915 Bacteria 3898
584 Ga0496112_0307749 3300048915 Bacteria 1530
585 Ga0496113_0039042 3300048916 Bacteria 3493
586 Ga0496115_0054304 3300048918 Bacteria 3217
587 Ga0501031_0001922 3300049568 Bacteria 13097
588 Ga0501031_0004586 3300049568 Bacteria 8959
589 Ga0501031_0005873 3300049568 Bacteria 7999
590 Ga0501031_0007546 3300049568 Bacteria 7084
591 Ga0501031_0033548 3300049568 Bacteria 3349
592 Ga0501031_0102679 3300049568 Bacteria 1866
593 Ga0501032_0017685 3300049569 Bacteria 5004
594 Ga0501032_0038857 3300049569 Bacteria 3239
595 Ga0501032_0067085 3300049569 Bacteria 2397
596 Ga0501032_0131475 3300049569 Bacteria 1651
597 Ga0501032_0274223 3300049569 Bacteria 1092
598 Ga0501033_0007757 3300049570 Bacteria 8317
599 Ga0501033_0032916 3300049570 Bacteria 3892
600 Ga0501033_0063188 3300049570 Bacteria 2725
601 Ga0501033_0102821 3300049570 Bacteria 2084
602 Ga0501034_0031799 3300049571 Bacteria 5360
603 Ga0501034_0031978 3300049571 Bacteria 5345
604 Ga0501034_0044352 3300049571 Bacteria 4498
605 Ga0501034_0102501 3300049571 Bacteria 2855
606 Ga0501034_0142596 3300049571 Bacteria 2374
607 Ga0501034_0349449 3300049571 Unclassified 1407
608 Ga0501036_0004359 3300049572 Bacteria 11418
609 Ga0501036_0005127 3300049572 Bacteria 10584
610 Ga0501036_0006733 3300049572 Bacteria 9341
611 Ga0501036_0013364 3300049572 Bacteria 6820
612 Ga0501036_0036626 3300049572 Bacteria 4152
613 Ga0501036_0053873 3300049572 Bacteria 3405
614 Ga0501036_0075975 3300049572 Bacteria 2841
615 Ga0501036_0097244 3300049572 Bacteria 2489
616 Ga0501036_0308793 3300049572 Bacteria 1322
617 Ga0501036_0519720 3300049572 Bacteria 990
618 Ga0501037_0005752 3300049573 Bacteria 9054
619 Ga0501037_0006015 3300049573 Bacteria 8855
620 Ga0501037_0033311 3300049573 Bacteria 3806
621 Ga0501037_0043498 3300049573 Bacteria 3300
622 Ga0501037_0100517 3300049573 Bacteria 2088
623 Ga0501037_0105900 3300049573 Bacteria 2027
624 Ga0501037_0188639 3300049573 Bacteria 1460
625 Ga0501038_0001390 3300049574 Bacteria 22123
626 Ga0501038_0008382 3300049574 Bacteria 9506
627 Ga0501038_0034646 3300049574 Bacteria 4438
628 Ga0501038_0036113 3300049574 Bacteria 4337
629 Ga0501038_0071754 3300049574 Bacteria 2936
630 Ga0501038_0129668 3300049574 Bacteria 2072
631 Ga0501038_0201194 3300049574 Bacteria 1598
632 Ga0501039_0000514 3300049575 Bacteria 27982
633 Ga0501039_0007709 3300049575 Bacteria 8218
634 Ga0501039_0009669 3300049575 Bacteria 7350
635 Ga0501039_0018998 3300049575 Bacteria 5274
636 Ga0501039_0033719 3300049575 Bacteria 3949
637 Ga0501039_0749935 3300049575 Bacteria 762
638 Ga0501040_0001940 3300049576 Bacteria 13300
639 Ga0501040_0002053 3300049576 Bacteria 12978
640 Ga0501040_0002257 3300049576 Bacteria 12378
641 Ga0501040_0003883 3300049576 Bacteria 9696
642 Ga0501040_0055410 3300049576 Bacteria 2718
643 Ga0501041_0001929 3300049577 Bacteria 11642
644 Ga0501041_0002244 3300049577 Bacteria 10922
645 Ga0501041_0005986 3300049577 Bacteria 7116
646 Ga0501041_0033396 3300049577 Bacteria 3113
647 Ga0501041_0038812 3300049577 Bacteria 2888
648 Ga0501041_0269448 3300049577 Bacteria 1071
649 Ga0501042_0000491 3300049578 Bacteria 20534
650 Ga0501042_0002549 3300049578 Bacteria 11209
651 Ga0501042_0005512 3300049578 Bacteria 8158
652 Ga0501042_0025697 3300049578 Bacteria 4138
653 Ga0501042_0030030 3300049578 Bacteria 3837
654 Ga0501042_0032617 3300049578 Bacteria 3689
655 Ga0501042_0113157 3300049578 Bacteria 1954
656 Ga0501042_0258455 3300049578 Bacteria 1257
657 Ga0501043_0001621 3300049579 Bacteria 19585
658 Ga0501043_0007697 3300049579 Bacteria 8531
659 Ga0501043_0012540 3300049579 Bacteria 6628
660 Ga0501043_0076848 3300049579 Bacteria 2623
661 Ga0501046_0002227 3300049580 Bacteria 18292
662 Ga0501046_0005923 3300049580 Bacteria 10889
663 Ga0501046_0008923 3300049580 Bacteria 8705
664 Ga0501046_0033755 3300049580 Bacteria 4132
665 Ga0501046_0059635 3300049580 Bacteria 2988
666 Ga0501046_0093793 3300049580 Bacteria 2307
667 Ga0501047_0002716 3300049581 Bacteria 16841
668 Ga0501047_0063801 3300049581 Bacteria 3553
669 Ga0501047_0210979 3300049581 Bacteria 1800
670 Ga0501047_0260289 3300049581 Bacteria 1583
671 Ga0501048_0005257 3300049582 Bacteria 9858
672 Ga0501048_0015076 3300049582 Bacteria 5713
673 Ga0501048_0015470 3300049582 Bacteria 5636
674 Ga0501048_0020579 3300049582 Bacteria 4835
675 Ga0501048_0028320 3300049582 Bacteria 4066
676 Ga0501048_0056455 3300049582 Bacteria 2785
677 Ga0501067_0013588 3300049583 Bacteria 4508
678 Ga0501067_0021994 3300049583 Bacteria 3528
679 Ga0501067_0043193 3300049583 Bacteria 2503
680 Ga0501067_0134687 3300049583 Bacteria 1375
681 Ga0501067_0172639 3300049583 Bacteria 1204
682 Ga0501068_0002839 3300049584 Bacteria 9214
683 Ga0501068_0008513 3300049584 Bacteria 5711
684 Ga0501068_0037954 3300049584 Bacteria 2884
685 Ga0501069_0001652 3300049585 Bacteria 11081
686 Ga0501069_0008294 3300049585 Bacteria 5455
687 Ga0501069_0013440 3300049585 Bacteria 4365
688 Ga0501069_0016338 3300049585 Bacteria 3985
689 Ga0501069_0147419 3300049585 Bacteria 1351
690 Ga0501070_0081775 3300049586 Bacteria 2673
691 Ga0501070_0575994 3300049586 Bacteria 899
692 Ga0501071_0001083 3300049587 Bacteria 15121
693 Ga0501071_0004817 3300049587 Bacteria 8596
694 Ga0501071_0006237 3300049587 Bacteria 7736
695 Ga0501071_0013395 3300049587 Bacteria 5587
696 Ga0501071_0026294 3300049587 Bacteria 4084
697 Ga0501071_0120360 3300049587 Bacteria 1946
698 Ga0501071_0209544 3300049587 Bacteria 1465
699 Ga0501071_0258831 3300049587 Bacteria 1314
700 Ga0501071_0393464 3300049587 Bacteria 1058
701 Ga0501071_0431586 3300049587 Bacteria 1007
702 Ga0501072_0000404 3300049588 Bacteria 30870
703 Ga0501072_0001268 3300049588 Bacteria 18858
704 Ga0501072_0004161 3300049588 Bacteria 10950
705 Ga0501072_0004858 3300049588 Bacteria 10228
706 Ga0501072_0006223 3300049588 Bacteria 9089
707 Ga0501072_0016036 3300049588 Bacteria 5745
708 Ga0501072_0034100 3300049588 Bacteria 3989
709 Ga0501072_0076749 3300049588 Bacteria 2644
710 Ga0501072_0479462 3300049588 Bacteria 984
711 Ga0501073_0019204 3300049589 Bacteria 4938
712 Ga0501073_0028494 3300049589 Bacteria 3991
713 Ga0501073_0040361 3300049589 Bacteria 3303
714 Ga0501073_0050481 3300049589 Bacteria 2915
715 Ga0501073_0148326 3300049589 Bacteria 1625
716 Ga0501074_0003320 3300049590 Bacteria 11387
717 Ga0501074_0004221 3300049590 Bacteria 10271
718 Ga0501074_0009917 3300049590 Bacteria 6920
719 Ga0501074_0014693 3300049590 Bacteria 5694
720 Ga0501074_0283510 3300049590 Bacteria 1177
721 Ga0501075_0002542 3300049591 Bacteria 12148
722 Ga0501075_0003018 3300049591 Bacteria 11243
723 Ga0501075_0003133 3300049591 Bacteria 11058
724 Ga0501075_0061304 3300049591 Bacteria 2834
725 Ga0501075_0071352 3300049591 Bacteria 2625
726 Ga0501075_0238043 3300049591 Bacteria 1388
727 Ga0501075_0535545 3300049591 Bacteria 894
728 Ga0501076_0000287 3300049592 Bacteria 31492
729 Ga0501076_0011794 3300049592 Bacteria 6526
730 Ga0501076_0029915 3300049592 Bacteria 4239
731 Ga0501076_0034406 3300049592 Bacteria 3960
732 Ga0501076_0075450 3300049592 Bacteria 2702
733 Ga0501076_0092160 3300049592 Bacteria 2438
734 Ga0501076_0172123 3300049592 Bacteria 1765
735 Ga0501076_0200483 3300049592 Bacteria 1629
736 Ga0501076_0460314 3300049592 Bacteria 1047
737 Ga0501077_0001393 3300049593 Bacteria 14562
738 Ga0501077_0002156 3300049593 Bacteria 11896
739 Ga0501077_0002626 3300049593 Bacteria 10761
740 Ga0501077_0006182 3300049593 Bacteria 7314
741 Ga0501077_0013855 3300049593 Bacteria 5055
742 Ga0501077_0036232 3300049593 Bacteria 3142
743 Ga0501079_0000178 3300049741 Bacteria 36110
744 Ga0501079_0004169 3300049741 Bacteria 10711
745 Ga0501079_0008393 3300049741 Bacteria 7829
746 Ga0501079_0020897 3300049741 Bacteria 5006
747 Ga0501079_0036766 3300049741 Bacteria 3771
748 Ga0501079_0069872 3300049741 Bacteria 2711
749 Ga0501079_0321536 3300049741 Bacteria 1211
750 Ga0501080_0014568 3300049742 Bacteria 7243
751 Ga0501080_0020334 3300049742 Bacteria 6143
752 Ga0501080_0058666 3300049742 Bacteria 3582
753 Ga0501080_0173642 3300049742 Bacteria 1986
754 Ga0501080_0478342 3300049742 Bacteria 1114
755 Ga0501080_0650926 3300049742 Bacteria 932
756 Ga0501081_0004860 3300049743 Bacteria 8637
757 Ga0501081_0008530 3300049743 Bacteria 6659
758 Ga0501081_0016532 3300049743 Bacteria 4877
759 Ga0501081_0077170 3300049743 Bacteria 2327
760 Ga0501081_0227823 3300049743 Bacteria 1357
761 Ga0501081_0255217 3300049743 Bacteria 1280
762 Ga0501081_0408817 3300049743 Bacteria 1005
763 Ga0501083_0005072 3300049744 Bacteria 9327
764 Ga0501083_0022032 3300049744 Bacteria 4423
765 Ga0501083_0043806 3300049744 Bacteria 3031
766 Ga0501083_0044173 3300049744 Bacteria 3017
767 Ga0501083_0066575 3300049744 Bacteria 2398
768 Ga0501083_0205868 3300049744 Bacteria 1283
769 Ga0501035_0003302 3300049822 Bacteria 15457
770 Ga0501035_0063380 3300049822 Bacteria 3288
771 Ga0501035_0132062 3300049822 Bacteria 2176
772 Ga0501044_0006082 3300049823 Bacteria 13321
773 Ga0501044_0041360 3300049823 Bacteria 4797
774 Ga0501044_0083905 3300049823 Bacteria 3220
775 Ga0501044_0285897 3300049823 Bacteria 1582
776 Ga0501045_0000769 3300049824 Bacteria 20594
777 Ga0501045_0000836 3300049824 Bacteria 19929
778 Ga0501045_0003983 3300049824 Bacteria 10167
779 Ga0501045_0005468 3300049824 Bacteria 8794
780 Ga0501045_0010860 3300049824 Bacteria 6381
781 Ga0501045_0016096 3300049824 Bacteria 5306
782 nmdc:mga0yw44_18369_c1 3300050492 Bacteria 3828
783 nmdc:mga0yw44_20934_c1 3300050492 Bacteria 3640
784 nmdc:mga0yw44_372434_c1 3300050492 Bacteria 963
785 nmdc:mga0yw44_47549_c1 3300050492 Bacteria 2583
786 nmdc:mga05p37_152362_c1 3300050507 Bacteria 2827
787 nmdc:mga05p37_159715_c1 3300050507 Bacteria 2753
788 nmdc:mga05p37_171_c1 3300050507 Bacteria 63303
789 nmdc:mga05p37_456891_c1 3300050507 Bacteria 1477
790 nmdc:mga05p37_8497_c1 3300050507 Bacteria 12136
791 nmdc:mga09592_183_c1 3300050508 Bacteria 44709
792 nmdc:mga09592_49429_c1 3300050508 Bacteria 3545
793 nmdc:mga09592_51891_c1 3300050508 Bacteria 3460
794 nmdc:mga09592_565_c1 3300050508 Bacteria 28059
795 nmdc:mga09592_7268_c1 3300050508 Bacteria 9001
796 nmdc:mga0qj67_235385_c1 3300050509 Bacteria 1486
797 nmdc:mga0qj67_23635_c1 3300050509 Bacteria 4730
798 nmdc:mga0qj67_9166_c1 3300050509 Bacteria 7348
799 nmdc:mga06r32_110544_c1 3300050510 Bacteria 2704
800 nmdc:mga06r32_130942_c1 3300050510 Bacteria 2481
801 nmdc:mga06r32_181499_c1 3300050510 Bacteria 2091
802 nmdc:mga06r32_342_c1 3300050510 Bacteria 38838
803 nmdc:mga06r32_58859_c1 3300050510 Bacteria 3694
804 nmdc:mga06r32_657283_c1 3300050510 Bacteria 1016
805 nmdc:mga08y16_14638_c1 3300050511 Bacteria 8248
806 nmdc:mga08y16_172581_c1 3300050511 Bacteria 2246
807 nmdc:mga08y16_254941_c1 3300050511 Bacteria 1813
808 nmdc:mga08y16_288862_c1 3300050511 Bacteria 1691
809 nmdc:mga08y16_3559_c1 3300050511 Bacteria 16171
810 nmdc:mga0n895_121093_c1 3300050512 Bacteria 2638
811 nmdc:mga08x19_8292_c1 3300050514 Bacteria 6181
812 nmdc:mga0a205_2010_c1 3300050515 Bacteria 17745
813 nmdc:mga0a205_23037_c1 3300050515 Bacteria 5906
814 nmdc:mga0a205_242536_c1 3300050515 Bacteria 1683
815 nmdc:mga0a205_276528_c1 3300050515 Bacteria 1555
816 nmdc:mga0a205_660214_c1 3300050515 Bacteria 897
817 Ga0495601_0093137 3300053077 Bacteria 1941
818 Ga0495595_0104345 3300053084 Bacteria 1370
819 Ga0501084_0001563 3300054114 Bacteria 18161
820 Ga0501084_0012543 3300054114 Bacteria 7019
821 Ga0501084_0015419 3300054114 Bacteria 6336
822 Ga0501084_0020237 3300054114 Bacteria 5547
823 Ga0501084_0022076 3300054114 Bacteria 5309
824 Ga0501084_0034479 3300054114 Bacteria 4232
825 Ga0501084_0116735 3300054114 Bacteria 2244
826 Ga0501084_0138174 3300054114 Bacteria 2051
827 Ga0501084_0171823 3300054114 Bacteria 1829
828 Ga0501084_0296258 3300054114 Bacteria 1366
829 Ga0501084_0382694 3300054114 Bacteria 1189
830 Ga0501084_0429814 3300054114 Bacteria 1116
831 Ga0501084_0499999 3300054114 Bacteria 1027
832 Ga0501084_0762005 3300054114 Bacteria 815
833 Ga0590071_040604 3300059421 Bacteria 1119
834 Ga0501082_0005568 3300060353 Bacteria 10936
835 Ga0501082_0013019 3300060353 Bacteria 7150
836 Ga0501082_0013362 3300060353 Bacteria 7060
837 Ga0501082_0013533 3300060353 Bacteria 7009
838 Ga0501082_0098592 3300060353 Bacteria 2527
839 Ga0501082_0128605 3300060353 Bacteria 2197
840 Ga0530510_0003175 3300061734 Bacteria 11294
841 Ga0530510_0004362 3300061734 Bacteria 9792
842 Ga0530510_0005917 3300061734 Bacteria 8476
843 Ga0530510_0008315 3300061734 Bacteria 7237
844 Ga0530510_0058065 3300061734 Bacteria 2797
845 Ga0530510_0065548 3300061734 Bacteria 2632
846 Ga0530510_0126308 3300061734 Bacteria 1880
847 Ga0530510_0141159 3300061734 Bacteria 1775

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100699949 Ga0068856_1006999492 213
2 3300025893 Ga0207682_10187268 Ga0207682_101872681 214
3 3300005336 Ga0070680_100390189 Ga0070680_1003901891 215
4 3300045976 Ga0466967_0120373 Ga0466967_0120373_535_1350 215
5 3300047322 Ga0495680_0045513 Ga0495680_0045513_1637_2452 215
6 3300050507 nmdc:mga05p37_456891_c1 nmdc:mga05p37_456891_c1_21_731 217
7 3300054114 Ga0501084_0762005 Ga0501084_0762005_15_695 219
8 3300042122 Ga0450920_007738 Ga0450920_007738_1022_1837 225
9 3300049744 Ga0501083_0043806 Ga0501083_0043806_860_1540 226
10 3300050510 nmdc:mga06r32_657283_c1 nmdc:mga06r32_657283_c1_308_988 226
11 3300044673 Ga0453683_0127119 Ga0453683_0127119_497_1192 228
12 3300006038 Ga0075365_10009452 Ga0075365_100094525 229
13 3300044673 Ga0453683_0010655 Ga0453683_0010655_1711_2427 229
14 3300049568 Ga0501031_0102679 Ga0501031_0102679_731_1492 231
15 3300049572 Ga0501036_0097244 Ga0501036_0097244_374_1135 231
16 3300049591 Ga0501075_0071352 Ga0501075_0071352_986_1747 231
17 3300049575 Ga0501039_0749935 Ga0501039_0749935_10_732 233
18 3300061734 Ga0530510_0126308 Ga0530510_0126308_10_735 234
19 3300031731 Ga0307405_10285619 Ga0307405_102856192 235
20 3300031824 Ga0307413_10270250 Ga0307413_102702501 235
21 3300031901 Ga0307406_10290417 Ga0307406_102904171 235
22 3300031903 Ga0307407_10225928 Ga0307407_102259282 235
23 3300031995 Ga0307409_100252009 Ga0307409_1002520091 235
24 3300032126 Ga0307415_100222013 Ga0307415_1002220132 235
25 3300005937 Ga0081455_10006029 Ga0081455_1000602924 236
26 3300005937 Ga0081455_10126583 Ga0081455_101265832 236
27 3300006844 Ga0075428_100073820 Ga0075428_1000738203 236
28 3300006847 Ga0075431_100160303 Ga0075431_1001603032 236
29 3300006880 Ga0075429_100047699 Ga0075429_1000476993 236
30 3300027907 Ga0207428_10033089 Ga0207428_100330894 236
31 3300032002 Ga0307416_100116548 Ga0307416_1001165481 236
32 3300048914 Ga0496111_0027483 Ga0496111_0027483_18_728 236
33 3300049570 Ga0501033_0102821 Ga0501033_0102821_817_1527 236
34 3300049572 Ga0501036_0053873 Ga0501036_0053873_2170_2880 236
35 3300049574 Ga0501038_0034646 Ga0501038_0034646_1889_2599 236
36 3300049576 Ga0501040_0002053 Ga0501040_0002053_5983_6693 236
37 3300049577 Ga0501041_0033396 Ga0501041_0033396_265_975 236
38 3300049578 Ga0501042_0030030 Ga0501042_0030030_1807_2517 236
39 3300049580 Ga0501046_0033755 Ga0501046_0033755_1823_2533 236
40 3300049582 Ga0501048_0015076 Ga0501048_0015076_3669_4379 236
41 3300049587 Ga0501071_0026294 Ga0501071_0026294_1667_2377 236
42 3300049588 Ga0501072_0000404 Ga0501072_0000404_17524_18234 236
43 3300049591 Ga0501075_0003133 Ga0501075_0003133_1694_2404 236
44 3300049592 Ga0501076_0034406 Ga0501076_0034406_1335_2045 236
45 3300049741 Ga0501079_0036766 Ga0501079_0036766_1859_2569 236
46 3300049743 Ga0501081_0077170 Ga0501081_0077170_45_755 236
47 3300049822 Ga0501035_0132062 Ga0501035_0132062_261_971 236
48 3300049824 Ga0501045_0000769 Ga0501045_0000769_2011_2721 236
49 3300054114 Ga0501084_0138174 Ga0501084_0138174_139_849 236
50 3300060353 Ga0501082_0005568 Ga0501082_0005568_9251_9961 236
51 3300061734 Ga0530510_0008315 Ga0530510_0008315_5156_5866 236
52 3300005339 Ga0070660_100017962 Ga0070660_1000179621 237
53 3300005530 Ga0070679_100099326 Ga0070679_1000993261 237
54 3300005578 Ga0068854_100470447 Ga0068854_1004704472 237
55 3300005614 Ga0068856_100306283 Ga0068856_1003062832 237
56 3300025909 Ga0207705_10002123 Ga0207705_1000212311 237
57 3300025913 Ga0207695_10004617 Ga0207695_1000461725 237
58 3300025919 Ga0207657_10001138 Ga0207657_1000113814 237
59 3300025920 Ga0207649_10079656 Ga0207649_100796562 237
60 3300025949 Ga0207667_10025589 Ga0207667_100255893 237
61 3300025981 Ga0207640_10003259 Ga0207640_100032599 237
62 3300026067 Ga0207678_10001614 Ga0207678_1000161414 237
63 3300031548 Ga0307408_100014713 Ga0307408_1000147132 237
64 3300032002 Ga0307416_100011128 Ga0307416_1000111283 237
65 3300005356 Ga0070674_100021069 Ga0070674_1000210696 238
66 3300050515 nmdc:mga0a205_242536_c1 nmdc:mga0a205_242536_c1_229_954 238
67 3300038443 Ga0395901_0815525 Ga0395901_0815525_142_894 239
68 3300046665 Ga0495661_0151986 Ga0495661_0151986_27_785 239
69 3300005290 Ga0065712_10070868 Ga0065712_100708684 240
70 3300005329 Ga0070683_100000726 Ga0070683_10000072631 240
71 3300005331 Ga0070670_100230401 Ga0070670_1002304012 240
72 3300005344 Ga0070661_100010076 Ga0070661_1000100765 240
73 3300005353 Ga0070669_100001695 Ga0070669_10000169526 240
74 3300005355 Ga0070671_100069069 Ga0070671_1000690693 240
75 3300005535 Ga0070684_100083429 Ga0070684_1000834292 240
76 3300005543 Ga0070672_100035663 Ga0070672_1000356633 240
77 3300005564 Ga0070664_100004358 Ga0070664_1000043587 240
78 3300005981 Ga0081538_10001905 Ga0081538_1000190521 240
79 3300006881 Ga0068865_100232198 Ga0068865_1002321982 240
80 3300025931 Ga0207644_10064475 Ga0207644_100644753 240
81 3300025938 Ga0207704_10255167 Ga0207704_102551672 240
82 3300025940 Ga0207691_10044419 Ga0207691_100444194 240
83 3300025945 Ga0207679_10002463 Ga0207679_100024639 240
84 3300025961 Ga0207712_10384915 Ga0207712_103849152 240
85 3300025986 Ga0207658_10098308 Ga0207658_100983082 240
86 3300026078 Ga0207702_10981586 Ga0207702_109815861 240
87 3300026121 Ga0207683_10301819 Ga0207683_103018191 240
88 3300032002 Ga0307416_100124086 Ga0307416_1001240861 240
89 3300050511 nmdc:mga08y16_288862_c1 nmdc:mga08y16_288862_c1_312_1043 240
90 3300005356 Ga0070674_100040505 Ga0070674_1000405053 241
91 3300005719 Ga0068861_100272968 Ga0068861_1002729682 241
92 3300025942 Ga0207689_10071972 Ga0207689_100719724 241
93 3300042142 Ga0450905_012360 Ga0450905_012360_208_975 241
94 3300049583 Ga0501067_0134687 Ga0501067_0134687_622_1365 241
95 3300049592 Ga0501076_0460314 Ga0501076_0460314_10_756 241
96 3300050492 nmdc:mga0yw44_20934_c1 nmdc:mga0yw44_20934_c1_157_921 241
97 3300005981 Ga0081538_10004338 Ga0081538_1000433811 242
98 3300042118 Ga0450914_000312 Ga0450914_000312_884_1678 242
99 3300005293 Ga0065715_10021290 Ga0065715_100212902 243
100 iso_pu_bacteria 2867475112 2867479923 244
101 iso_pu_bacteria 8053945823 8053948567 244
102 3300035398 Ga0316574_0063247 Ga0316574_0063247_1421_2182 245
103 3300036712 Ga0316584_0026232 Ga0316584_0026232_1355_2116 245
104 3300049571 Ga0501034_0031978 Ga0501034_0031978_1306_2064 245
105 3300049572 Ga0501036_0006733 Ga0501036_0006733_6547_7305 245
106 3300049573 Ga0501037_0033311 Ga0501037_0033311_1495_2253 245
107 3300049574 Ga0501038_0008382 Ga0501038_0008382_2763_3521 245
108 3300049578 Ga0501042_0025697 Ga0501042_0025697_175_933 245
109 3300049579 Ga0501043_0001621 Ga0501043_0001621_15483_16241 245
110 3300049581 Ga0501047_0063801 Ga0501047_0063801_832_1590 245
111 3300049582 Ga0501048_0028320 Ga0501048_0028320_123_881 245
112 3300049587 Ga0501071_0393464 Ga0501071_0393464_125_940 245
113 3300049589 Ga0501073_0019204 Ga0501073_0019204_1839_2597 245
114 3300049590 Ga0501074_0004221 Ga0501074_0004221_6743_7501 245
115 3300049823 Ga0501044_0041360 Ga0501044_0041360_1571_2329 245
116 3300006844 Ga0075428_100006199 Ga0075428_10000619914 246
117 3300006847 Ga0075431_100102472 Ga0075431_1001024723 246
118 3300009147 Ga0114129_10043279 Ga0114129_100432797 246
119 3300050510 nmdc:mga06r32_110544_c1 nmdc:mga06r32_110544_c1_1183_1923 246
120 3300054114 Ga0501084_0022076 Ga0501084_0022076_2491_3255 246
121 3300005341 Ga0070691_10034218 Ga0070691_100342183 247
122 3300006038 Ga0075365_10416730 Ga0075365_104167302 247
123 3300006844 Ga0075428_100219366 Ga0075428_1002193663 247
124 3300006844 Ga0075428_100361103 Ga0075428_1003611032 247
125 3300006846 Ga0075430_100004496 Ga0075430_1000044965 247
126 3300006846 Ga0075430_100006208 Ga0075430_10000620818 247
127 3300006847 Ga0075431_100014147 Ga0075431_10001414717 247
128 3300006847 Ga0075431_100014487 Ga0075431_1000144874 247
129 3300006880 Ga0075429_100001166 Ga0075429_10000116626 247
130 3300006880 Ga0075429_100004700 Ga0075429_1000047005 247
131 3300009094 Ga0111539_10059988 Ga0111539_100599883 247
132 3300009147 Ga0114129_10013234 Ga0114129_1001323416 247
133 3300009147 Ga0114129_10183448 Ga0114129_101834482 247
134 3300027907 Ga0207428_10028260 Ga0207428_100282602 247
135 3300031238 Ga0265332_10032007 Ga0265332_100320072 247
136 3300041491 Ga0451833_0895723 Ga0451833_0895723_284_1042 247
137 3300045051 Ga0451576_0076811 Ga0451576_0076811_616_1374 247
138 3300048918 Ga0496115_0054304 Ga0496115_0054304_1371_2120 247
139 3300049743 Ga0501081_0227823 Ga0501081_0227823_567_1319 247
140 3300050492 nmdc:mga0yw44_372434_c1 nmdc:mga0yw44_372434_c1_171_914 247
141 3300050507 nmdc:mga05p37_159715_c1 nmdc:mga05p37_159715_c1_639_1382 247
142 3300050507 nmdc:mga05p37_171_c1 nmdc:mga05p37_171_c1_41787_42530 247
143 3300050508 nmdc:mga09592_183_c1 nmdc:mga09592_183_c1_20430_21173 247
144 3300050508 nmdc:mga09592_565_c1 nmdc:mga09592_565_c1_19274_20017 247
145 3300050509 nmdc:mga0qj67_235385_c1 nmdc:mga0qj67_235385_c1_347_1090 247
146 3300050509 nmdc:mga0qj67_23635_c1 nmdc:mga0qj67_23635_c1_2889_3632 247
147 3300050510 nmdc:mga06r32_130942_c1 nmdc:mga06r32_130942_c1_1121_1864 247
148 3300050510 nmdc:mga06r32_342_c1 nmdc:mga06r32_342_c1_32153_32896 247
149 3300050510 nmdc:mga06r32_58859_c1 nmdc:mga06r32_58859_c1_733_1476 247
150 3300003354 JGI25160J50197_1012574 JGI25160J50197_10125743 248
151 3300005327 Ga0070658_10010785 Ga0070658_100107859 248
152 3300005339 Ga0070660_100105368 Ga0070660_1001053682 248
153 3300005366 Ga0070659_100091822 Ga0070659_1000918222 248
154 3300013307 Ga0157372_10300965 Ga0157372_103009652 248
155 3300014325 Ga0163163_10267244 Ga0163163_102672442 248
156 3300025302 Ga0207426_1059139 Ga0207426_10591391 248
157 3300025909 Ga0207705_10030861 Ga0207705_100308612 248
158 3300025919 Ga0207657_10317004 Ga0207657_103170042 248
159 3300025932 Ga0207690_10402741 Ga0207690_104027412 248
160 3300031238 Ga0265332_10001239 Ga0265332_1000123921 248
161 3300031711 Ga0265314_10021536 Ga0265314_100215362 248
162 3300031903 Ga0307407_10008769 Ga0307407_100087691 248
163 3300042876 Ga0451577_0000018 Ga0451577_0000018_278085_278837 248
164 3300044712 Ga0453684_0000166 Ga0453684_0000166_237663_238415 248
165 3300047321 Ga0495676_0280356 Ga0495676_0280356_230_976 248
166 3300047444 Ga0495675_0140580 Ga0495675_0140580_222_989 248
167 3300048907 Ga0496104_0159220 Ga0496104_0159220_376_1122 248
168 3300048911 Ga0496108_0014247 Ga0496108_0014247_1175_1921 248
169 3300048912 Ga0496109_0004877 Ga0496109_0004877_7105_7851 248
170 3300048915 Ga0496112_0003519 Ga0496112_0003519_7713_8459 248
171 3300049571 Ga0501034_0349449 Ga0501034_0349449_218_988 248
172 3300049577 Ga0501041_0269448 Ga0501041_0269448_184_930 248
173 3300049591 Ga0501075_0535545 Ga0501075_0535545_100_861 248
174 3300053077 Ga0495601_0093137 Ga0495601_0093137_345_1091 248
175 3300005295 Ga0065707_10237328 Ga0065707_102373281 249
176 3300005329 Ga0070683_100009922 Ga0070683_1000099229 249
177 3300005334 Ga0068869_100564387 Ga0068869_1005643872 249
178 3300005341 Ga0070691_10037701 Ga0070691_100377012 249
179 3300005353 Ga0070669_100650324 Ga0070669_1006503241 249
180 3300005354 Ga0070675_100041134 Ga0070675_1000411342 249
181 3300005365 Ga0070688_100216061 Ga0070688_1002160612 249
182 3300005455 Ga0070663_100027522 Ga0070663_1000275221 249
183 3300005468 Ga0070707_100373712 Ga0070707_1003737122 249
184 3300005471 Ga0070698_100001954 Ga0070698_10000195434 249
185 3300005536 Ga0070697_100199816 Ga0070697_1001998162 249
186 3300005549 Ga0070704_100051520 Ga0070704_1000515202 249
187 3300005563 Ga0068855_100691304 Ga0068855_1006913042 249
188 3300005617 Ga0068859_100049834 Ga0068859_1000498343 249
189 3300005844 Ga0068862_100040658 Ga0068862_1000406583 249
190 3300006846 Ga0075430_100147575 Ga0075430_1001475752 249
191 3300006847 Ga0075431_100432973 Ga0075431_1004329732 249
192 3300006880 Ga0075429_100131214 Ga0075429_1001312142 249
193 3300006880 Ga0075429_100144630 Ga0075429_1001446302 249
194 3300006931 Ga0097620_100049836 Ga0097620_1000498363 249
195 3300009093 Ga0105240_10202343 Ga0105240_102023432 249
196 3300009094 Ga0111539_10121671 Ga0111539_101216713 249
197 3300009094 Ga0111539_10137909 Ga0111539_101379093 249
198 3300009176 Ga0105242_10181157 Ga0105242_101811574 249
199 3300009551 Ga0105238_10038782 Ga0105238_100387823 249
200 3300025922 Ga0207646_10314340 Ga0207646_103143402 249
201 3300025925 Ga0207650_10006120 Ga0207650_100061205 249
202 3300025926 Ga0207659_10193525 Ga0207659_101935252 249
203 3300025926 Ga0207659_10375175 Ga0207659_103751751 249
204 3300025942 Ga0207689_10585097 Ga0207689_105850971 249
205 3300025944 Ga0207661_10529543 Ga0207661_105295432 249
206 3300025949 Ga0207667_10149044 Ga0207667_101490443 249
207 3300026075 Ga0207708_10021383 Ga0207708_100213832 249
208 3300026088 Ga0207641_10504156 Ga0207641_105041561 249
209 3300027614 Ga0209970_1006919 Ga0209970_10069193 249
210 3300028380 Ga0268265_10283140 Ga0268265_102831401 249
211 3300031911 Ga0307412_10201863 Ga0307412_102018632 249
212 3300042156 Ga0439446_0065709 Ga0439446_0065709_125_895 249
213 3300050508 nmdc:mga09592_49429_c1 nmdc:mga09592_49429_c1_2610_3380 249
214 3300050511 nmdc:mga08y16_172581_c1 nmdc:mga08y16_172581_c1_124_894 249
215 3300050515 nmdc:mga0a205_276528_c1 nmdc:mga0a205_276528_c1_400_1170 249
216 3300054114 Ga0501084_0382694 Ga0501084_0382694_215_985 249
217 3300006852 Ga0075433_10272836 Ga0075433_102728364 250
218 3300031548 Ga0307408_100092663 Ga0307408_1000926633 250
219 3300031731 Ga0307405_10222253 Ga0307405_102222532 250
220 3300031824 Ga0307413_10034092 Ga0307413_100340923 250
221 3300031824 Ga0307413_10073821 Ga0307413_100738212 250
222 3300031852 Ga0307410_10334978 Ga0307410_103349781 250
223 3300031901 Ga0307406_10150192 Ga0307406_101501923 250
224 3300031903 Ga0307407_10113495 Ga0307407_101134952 250
225 3300031911 Ga0307412_10152866 Ga0307412_101528662 250
226 3300031995 Ga0307409_100855575 Ga0307409_1008555752 250
227 3300032002 Ga0307416_100031363 Ga0307416_1000313636 250
228 3300032004 Ga0307414_10018571 Ga0307414_100185712 250
229 3300032004 Ga0307414_10293640 Ga0307414_102936402 250
230 3300032005 Ga0307411_10037532 Ga0307411_100375323 250
231 3300032126 Ga0307415_100032143 Ga0307415_1000321433 250
232 3300046663 Ga0495635_0107545 Ga0495635_0107545_374_1135 250
233 3300046683 Ga0495658_0204978 Ga0495658_0204978_74_835 250
234 3300046689 Ga0495613_0139481 Ga0495613_0139481_528_1289 250
235 3300049568 Ga0501031_0001922 Ga0501031_0001922_8131_8931 250
236 3300049570 Ga0501033_0032916 Ga0501033_0032916_3006_3806 250
237 3300049571 Ga0501034_0031799 Ga0501034_0031799_4159_4959 250
238 3300049573 Ga0501037_0005752 Ga0501037_0005752_8201_9001 250
239 3300049575 Ga0501039_0009669 Ga0501039_0009669_3974_4774 250
240 3300049577 Ga0501041_0001929 Ga0501041_0001929_6606_7406 250
241 3300049578 Ga0501042_0032617 Ga0501042_0032617_86_886 250
242 3300049580 Ga0501046_0008923 Ga0501046_0008923_1302_2102 250
243 3300049582 Ga0501048_0020579 Ga0501048_0020579_2577_3377 250
244 3300049584 Ga0501068_0008513 Ga0501068_0008513_4730_5530 250
245 3300049585 Ga0501069_0001652 Ga0501069_0001652_425_1225 250
246 3300049587 Ga0501071_0209544 Ga0501071_0209544_254_1054 250
247 3300049588 Ga0501072_0001268 Ga0501072_0001268_3499_4299 250
248 3300049592 Ga0501076_0075450 Ga0501076_0075450_467_1267 250
249 3300049592 Ga0501076_0200483 Ga0501076_0200483_700_1500 250
250 3300049593 Ga0501077_0036232 Ga0501077_0036232_2161_2961 250
251 3300049741 Ga0501079_0321536 Ga0501079_0321536_90_890 250
252 3300049742 Ga0501080_0020334 Ga0501080_0020334_2653_3453 250
253 3300049744 Ga0501083_0005072 Ga0501083_0005072_1459_2259 250
254 3300049822 Ga0501035_0003302 Ga0501035_0003302_9253_10053 250
255 3300049823 Ga0501044_0006082 Ga0501044_0006082_2826_3626 250
256 3300049824 Ga0501045_0016096 Ga0501045_0016096_4040_4840 250
257 3300053084 Ga0495595_0104345 Ga0495595_0104345_337_1098 250
258 3300054114 Ga0501084_0296258 Ga0501084_0296258_406_1206 250
259 3300061734 Ga0530510_0065548 Ga0530510_0065548_1333_2133 250
260 3300003373 JGI25407J50210_10002038 JGI25407J50210_100020383 251
261 3300003373 JGI25407J50210_10010081 JGI25407J50210_100100813 251
262 3300005347 Ga0070668_100093920 Ga0070668_1000939201 251
263 3300005457 Ga0070662_100040253 Ga0070662_1000402532 251
264 3300005468 Ga0070707_100096597 Ga0070707_1000965972 251
265 3300005981 Ga0081538_10003017 Ga0081538_100030178 251
266 3300005981 Ga0081538_10012849 Ga0081538_100128498 251
267 3300005981 Ga0081538_10014859 Ga0081538_100148597 251
268 3300005981 Ga0081538_10070824 Ga0081538_100708243 251
269 3300005983 Ga0081540_1104800 Ga0081540_11048002 251
270 3300005985 Ga0081539_10011818 Ga0081539_100118182 251
271 3300006844 Ga0075428_100028437 Ga0075428_1000284373 251
272 3300006844 Ga0075428_100566912 Ga0075428_1005669122 251
273 3300006846 Ga0075430_100016007 Ga0075430_1000160079 251
274 3300006846 Ga0075430_100430170 Ga0075430_1004301701 251
275 3300006847 Ga0075431_100004224 Ga0075431_10000422411 251
276 3300006847 Ga0075431_100023806 Ga0075431_1000238068 251
277 3300006852 Ga0075433_10035210 Ga0075433_100352105 251
278 3300006871 Ga0075434_100100364 Ga0075434_1001003644 251
279 3300006880 Ga0075429_100003288 Ga0075429_1000032883 251
280 3300006880 Ga0075429_100521353 Ga0075429_1005213532 251
281 3300009093 Ga0105240_10547015 Ga0105240_105470152 251
282 3300009094 Ga0111539_10081413 Ga0111539_100814134 251
283 3300009094 Ga0111539_10760519 Ga0111539_107605192 251
284 3300009147 Ga0114129_10033068 Ga0114129_100330683 251
285 3300009147 Ga0114129_10348568 Ga0114129_103485682 251
286 3300009147 Ga0114129_10563445 Ga0114129_105634452 251
287 3300009148 Ga0105243_10520870 Ga0105243_105208701 251
288 3300013306 Ga0163162_10081796 Ga0163162_100817962 251
289 3300014497 Ga0182008_10082412 Ga0182008_100824122 251
290 3300017792 Ga0163161_10131546 Ga0163161_101315461 251
291 3300025922 Ga0207646_10044515 Ga0207646_100445153 251
292 3300025933 Ga0207706_10023631 Ga0207706_100236314 251
293 3300025961 Ga0207712_10296183 Ga0207712_102961832 251
294 3300025972 Ga0207668_10358386 Ga0207668_103583862 251
295 3300026118 Ga0207675_100517008 Ga0207675_1005170082 251
296 3300027907 Ga0207428_10000940 Ga0207428_100009402 251
297 3300031548 Ga0307408_100147495 Ga0307408_1001474952 251
298 3300031548 Ga0307408_100345762 Ga0307408_1003457622 251
299 3300031731 Ga0307405_10019483 Ga0307405_100194833 251
300 3300031731 Ga0307405_10158482 Ga0307405_101584822 251
301 3300031824 Ga0307413_10324475 Ga0307413_103244752 251
302 3300031852 Ga0307410_10006908 Ga0307410_100069088 251
303 3300031852 Ga0307410_10035246 Ga0307410_100352462 251
304 3300031852 Ga0307410_10144593 Ga0307410_101445932 251
305 3300031901 Ga0307406_10172563 Ga0307406_101725632 251
306 3300031901 Ga0307406_10323186 Ga0307406_103231862 251
307 3300031903 Ga0307407_10011716 Ga0307407_100117163 251
308 3300031903 Ga0307407_10136373 Ga0307407_101363732 251
309 3300031903 Ga0307407_10178470 Ga0307407_101784702 251
310 3300031911 Ga0307412_10032184 Ga0307412_100321845 251
311 3300031911 Ga0307412_10035950 Ga0307412_100359504 251
312 3300031995 Ga0307409_100004038 Ga0307409_1000040382 251
313 3300031995 Ga0307409_100022546 Ga0307409_1000225464 251
314 3300031995 Ga0307409_100057205 Ga0307409_1000572052 251
315 3300031995 Ga0307409_100396684 Ga0307409_1003966841 251
316 3300032002 Ga0307416_100159512 Ga0307416_1001595123 251
317 3300032002 Ga0307416_100348465 Ga0307416_1003484652 251
318 3300032002 Ga0307416_100358908 Ga0307416_1003589082 251
319 3300032002 Ga0307416_100656510 Ga0307416_1006565102 251
320 3300032004 Ga0307414_10206247 Ga0307414_102062472 251
321 3300032004 Ga0307414_10351472 Ga0307414_103514722 251
322 3300032126 Ga0307415_100002882 Ga0307415_1000028829 251
323 3300032126 Ga0307415_100007232 Ga0307415_1000072323 251
324 3300032126 Ga0307415_100010203 Ga0307415_1000102037 251
325 3300037312 Ga0395899_0111746 Ga0395899_0111746_215_1009 251
326 3300037418 Ga0395900_0143240 Ga0395900_0143240_1280_2092 251
327 3300037466 Ga0395898_0042694 Ga0395898_0042694_774_1586 251
328 3300037466 Ga0395898_0189316 Ga0395898_0189316_779_1573 251
329 3300042003 Ga0439443_004916 Ga0439443_004916_914_1708 251
330 3300042005 Ga0439448_0002950 Ga0439448_0002950_3381_4175 251
331 3300042005 Ga0439448_0007317 Ga0439448_0007317_1527_2321 251
332 3300042008 Ga0439450_000158 Ga0439450_000158_4611_5405 251
333 3300042009 Ga0439451_009707 Ga0439451_009707_540_1334 251
334 3300042009 Ga0439451_015542 Ga0439451_015542_707_1501 251
335 3300042012 Ga0439455_0001859 Ga0439455_0001859_2322_3116 251
336 3300042012 Ga0439455_0024108 Ga0439455_0024108_403_1197 251
337 3300042013 Ga0439456_012546 Ga0439456_012546_398_1192 251
338 3300042016 Ga0439463_015155 Ga0439463_015155_174_968 251
339 3300042016 Ga0439463_021445 Ga0439463_021445_540_1334 251
340 3300042116 Ga0450912_008071 Ga0450912_008071_35_829 251
341 3300042118 Ga0450914_000145 Ga0450914_000145_146_940 251
342 3300042137 Ga0450902_013431 Ga0450902_013431_199_993 251
343 3300042436 Ga0439435_0020022 Ga0439435_0020022_398_1192 251
344 3300042437 Ga0439444_0000598 Ga0439444_0000598_801_1595 251
345 3300042439 Ga0439464_0002755 Ga0439464_0002755_2635_3429 251
346 3300042439 Ga0439464_0052653 Ga0439464_0052653_142_936 251
347 3300042461 Ga0439460_0003395 Ga0439460_0003395_793_1587 251
348 3300042461 Ga0439460_0072430 Ga0439460_0072430_28_819 251
349 3300042530 Ga0450916_006767 Ga0450916_006767_312_1106 251
350 3300042530 Ga0450916_019153 Ga0450916_019153_99_893 251
351 3300042993 Ga0439440_0000656 Ga0439440_0000656_3566_4360 251
352 3300042993 Ga0439440_0012907 Ga0439440_0012907_444_1238 251
353 3300042993 Ga0439440_0026233 Ga0439440_0026233_112_906 251
354 3300042993 Ga0439440_0029805 Ga0439440_0029805_310_1104 251
355 3300046520 Ga0495637_0155974 Ga0495637_0155974_16_810 251
356 3300046523 Ga0495644_0056701 Ga0495644_0056701_489_1283 251
357 3300046615 Ga0495656_0127864 Ga0495656_0127864_174_968 251
358 3300046616 Ga0495668_0222359 Ga0495668_0222359_168_962 251
359 3300047445 Ga0495677_0051812 Ga0495677_0051812_442_1236 251
360 3300049568 Ga0501031_0005873 Ga0501031_0005873_3083_3877 251
361 3300049568 Ga0501031_0007546 Ga0501031_0007546_5905_6699 251
362 3300049569 Ga0501032_0017685 Ga0501032_0017685_90_884 251
363 3300049570 Ga0501033_0007757 Ga0501033_0007757_7295_8089 251
364 3300049572 Ga0501036_0004359 Ga0501036_0004359_243_1037 251
365 3300049572 Ga0501036_0005127 Ga0501036_0005127_6080_6874 251
366 3300049573 Ga0501037_0006015 Ga0501037_0006015_7793_8587 251
367 3300049573 Ga0501037_0100517 Ga0501037_0100517_1084_1878 251
368 3300049574 Ga0501038_0036113 Ga0501038_0036113_3322_4116 251
369 3300049575 Ga0501039_0000514 Ga0501039_0000514_20935_21729 251
370 3300049575 Ga0501039_0033719 Ga0501039_0033719_2930_3724 251
371 3300049576 Ga0501040_0002257 Ga0501040_0002257_5299_6093 251
372 3300049576 Ga0501040_0003883 Ga0501040_0003883_198_992 251
373 3300049577 Ga0501041_0005986 Ga0501041_0005986_340_1134 251
374 3300049578 Ga0501042_0000491 Ga0501042_0000491_9363_10157 251
375 3300049578 Ga0501042_0002549 Ga0501042_0002549_4514_5308 251
376 3300049579 Ga0501043_0012540 Ga0501043_0012540_726_1520 251
377 3300049580 Ga0501046_0002227 Ga0501046_0002227_15343_16137 251
378 3300049580 Ga0501046_0005923 Ga0501046_0005923_5762_6556 251
379 3300049582 Ga0501048_0005257 Ga0501048_0005257_360_1154 251
380 3300049585 Ga0501069_0147419 Ga0501069_0147419_385_1179 251
381 3300049586 Ga0501070_0081775 Ga0501070_0081775_1797_2591 251
382 3300049587 Ga0501071_0006237 Ga0501071_0006237_4152_4946 251
383 3300049587 Ga0501071_0431586 Ga0501071_0431586_98_892 251
384 3300049588 Ga0501072_0004161 Ga0501072_0004161_9959_10753 251
385 3300049588 Ga0501072_0004858 Ga0501072_0004858_650_1444 251
386 3300049590 Ga0501074_0009917 Ga0501074_0009917_5944_6738 251
387 3300049590 Ga0501074_0014693 Ga0501074_0014693_4156_4950 251
388 3300049591 Ga0501075_0002542 Ga0501075_0002542_10030_10824 251
389 3300049591 Ga0501075_0061304 Ga0501075_0061304_1021_1815 251
390 3300049592 Ga0501076_0000287 Ga0501076_0000287_14691_15485 251
391 3300049593 Ga0501077_0002626 Ga0501077_0002626_4057_4851 251
392 3300049593 Ga0501077_0013855 Ga0501077_0013855_3978_4772 251
393 3300049741 Ga0501079_0000178 Ga0501079_0000178_5919_6713 251
394 3300049741 Ga0501079_0004169 Ga0501079_0004169_4156_4950 251
395 3300049743 Ga0501081_0008530 Ga0501081_0008530_3422_4216 251
396 3300049743 Ga0501081_0255217 Ga0501081_0255217_320_1114 251
397 3300049744 Ga0501083_0205868 Ga0501083_0205868_98_892 251
398 3300049822 Ga0501035_0063380 Ga0501035_0063380_2269_3063 251
399 3300049824 Ga0501045_0000836 Ga0501045_0000836_15953_16747 251
400 3300049824 Ga0501045_0005468 Ga0501045_0005468_4990_5784 251
401 3300050507 nmdc:mga05p37_8497_c1 nmdc:mga05p37_8497_c1_11330_12124 251
402 3300050508 nmdc:mga09592_7268_c1 nmdc:mga09592_7268_c1_7345_8139 251
403 3300050509 nmdc:mga0qj67_9166_c1 nmdc:mga0qj67_9166_c1_366_1160 251
404 3300050510 nmdc:mga06r32_181499_c1 nmdc:mga06r32_181499_c1_1222_2016 251
405 3300050511 nmdc:mga08y16_3559_c1 nmdc:mga08y16_3559_c1_14031_14825 251
406 3300050512 nmdc:mga0n895_121093_c1 nmdc:mga0n895_121093_c1_1668_2462 251
407 3300050515 nmdc:mga0a205_23037_c1 nmdc:mga0a205_23037_c1_1596_2390 251
408 3300054114 Ga0501084_0001563 Ga0501084_0001563_6604_7398 251
409 3300054114 Ga0501084_0012543 Ga0501084_0012543_386_1180 251
410 3300059421 Ga0590071_040604 Ga0590071_040604_117_911 251
411 3300060353 Ga0501082_0013019 Ga0501082_0013019_573_1367 251
412 3300060353 Ga0501082_0013533 Ga0501082_0013533_5990_6784 251
413 3300061734 Ga0530510_0003175 Ga0530510_0003175_226_1020 251
414 3300061734 Ga0530510_0005917 Ga0530510_0005917_5202_5996 251
415 3300005331 Ga0070670_100148007 Ga0070670_1001480072 252
416 3300005365 Ga0070688_100078573 Ga0070688_1000785733 252
417 3300005366 Ga0070659_100201856 Ga0070659_1002018562 252
418 3300005438 Ga0070701_10166397 Ga0070701_101663972 252
419 3300005456 Ga0070678_100269414 Ga0070678_1002694142 252
420 3300005719 Ga0068861_100345788 Ga0068861_1003457882 252
421 3300005844 Ga0068862_100088910 Ga0068862_1000889102 252
422 3300006914 Ga0075436_100035555 Ga0075436_1000355552 252
423 3300009094 Ga0111539_10357808 Ga0111539_103578082 252
424 3300009177 Ga0105248_10087502 Ga0105248_100875027 252
425 3300009553 Ga0105249_10002497 Ga0105249_1000249722 252
426 3300011119 Ga0105246_10172615 Ga0105246_101726152 252
427 3300013296 Ga0157374_10123125 Ga0157374_101231253 252
428 3300013297 Ga0157378_10737456 Ga0157378_107374561 252
429 3300013308 Ga0157375_10380097 Ga0157375_103800972 252
430 3300013308 Ga0157375_10740519 Ga0157375_107405192 252
431 3300014325 Ga0163163_10103012 Ga0163163_101030126 252
432 3300014326 Ga0157380_10588274 Ga0157380_105882741 252
433 3300014968 Ga0157379_10163590 Ga0157379_101635904 252
434 3300014968 Ga0157379_10448881 Ga0157379_104488811 252
435 3300025923 Ga0207681_10504880 Ga0207681_105048802 252
436 3300025926 Ga0207659_10559143 Ga0207659_105591432 252
437 3300025927 Ga0207687_10030837 Ga0207687_100308371 252
438 3300026118 Ga0207675_100389911 Ga0207675_1003899112 252
439 3300026121 Ga0207683_10129707 Ga0207683_101297072 252
440 3300028380 Ga0268265_10069296 Ga0268265_100692963 252
441 3300031731 Ga0307405_10015462 Ga0307405_100154622 252
442 3300031824 Ga0307413_10065310 Ga0307413_100653103 252
443 3300031903 Ga0307407_10092500 Ga0307407_100925002 252
444 3300031995 Ga0307409_100029424 Ga0307409_1000294245 252
445 3300032005 Ga0307411_10010242 Ga0307411_100102427 252
446 3300032126 Ga0307415_100030385 Ga0307415_1000303854 252
447 3300034820 Ga0373959_0030331 Ga0373959_0030331_53_817 252
448 3300035170 Ga0373943_0027797 Ga0373943_0027797_1668_2435 252
449 3300041410 Ga0439461_0005197 Ga0439461_0005197_978_1745 252
450 3300042436 Ga0439435_0047856 Ga0439435_0047856_418_1185 252
451 3300042993 Ga0439440_0070224 Ga0439440_0070224_32_799 252
452 3300047471 Ga0495684_0116625 Ga0495684_0116625_963_1748 252
453 3300048904 Ga0496101_0057739 Ga0496101_0057739_597_1382 252
454 3300048906 Ga0496103_0122877 Ga0496103_0122877_399_1181 252
455 3300048907 Ga0496104_0007555 Ga0496104_0007555_3699_4466 252
456 3300048908 Ga0496105_0233566 Ga0496105_0233566_408_1193 252
457 3300048909 Ga0496106_0081380 Ga0496106_0081380_1541_2326 252
458 3300048911 Ga0496108_0003558 Ga0496108_0003558_6338_7105 252
459 3300048912 Ga0496109_0001514 Ga0496109_0001514_16370_17137 252
460 3300048913 Ga0496110_0002017 Ga0496110_0002017_2686_3453 252
461 3300048914 Ga0496111_0013343 Ga0496111_0013343_1113_1880 252
462 3300048915 Ga0496112_0055411 Ga0496112_0055411_2257_3024 252
463 3300049572 Ga0501036_0519720 Ga0501036_0519720_106_873 252
464 3300049583 Ga0501067_0013588 Ga0501067_0013588_2933_3715 252
465 3300049583 Ga0501067_0021994 Ga0501067_0021994_621_1403 252
466 3300049583 Ga0501067_0172639 Ga0501067_0172639_112_897 252
467 3300049585 Ga0501069_0016338 Ga0501069_0016338_1232_2014 252
468 3300049587 Ga0501071_0258831 Ga0501071_0258831_176_958 252
469 3300049588 Ga0501072_0034100 Ga0501072_0034100_42_824 252
470 3300049588 Ga0501072_0076749 Ga0501072_0076749_1028_1795 252
471 3300050514 nmdc:mga08x19_8292_c1 nmdc:mga08x19_8292_c1_3012_3794 252
472 3300054114 Ga0501084_0171823 Ga0501084_0171823_221_1003 252
473 3300060353 Ga0501082_0098592 Ga0501082_0098592_1162_1986 252
474 3300061734 Ga0530510_0058065 Ga0530510_0058065_1672_2454 252
475 3300005937 Ga0081455_10166555 Ga0081455_101665553 253
476 3300009094 Ga0111539_10268456 Ga0111539_102684564 253
477 3300014326 Ga0157380_10562006 Ga0157380_105620062 253
478 3300049569 Ga0501032_0038857 Ga0501032_0038857_1769_2548 253
479 3300049569 Ga0501032_0131475 Ga0501032_0131475_694_1473 253
480 3300049569 Ga0501032_0274223 Ga0501032_0274223_179_958 253
481 3300049571 Ga0501034_0044352 Ga0501034_0044352_2128_2907 253
482 3300049571 Ga0501034_0102501 Ga0501034_0102501_1742_2521 253
483 3300049571 Ga0501034_0142596 Ga0501034_0142596_1500_2279 253
484 3300049572 Ga0501036_0075975 Ga0501036_0075975_384_1163 253
485 3300049572 Ga0501036_0308793 Ga0501036_0308793_393_1172 253
486 3300049573 Ga0501037_0188639 Ga0501037_0188639_432_1211 253
487 3300049574 Ga0501038_0071754 Ga0501038_0071754_1769_2548 253
488 3300049574 Ga0501038_0201194 Ga0501038_0201194_179_958 253
489 3300049579 Ga0501043_0076848 Ga0501043_0076848_425_1204 253
490 3300049580 Ga0501046_0059635 Ga0501046_0059635_1833_2612 253
491 3300049581 Ga0501047_0002716 Ga0501047_0002716_14984_15763 253
492 3300049581 Ga0501047_0210979 Ga0501047_0210979_803_1582 253
493 3300049584 Ga0501068_0037954 Ga0501068_0037954_1728_2507 253
494 3300049585 Ga0501069_0008294 Ga0501069_0008294_1742_2521 253
495 3300049586 Ga0501070_0575994 Ga0501070_0575994_25_804 253
496 3300049588 Ga0501072_0479462 Ga0501072_0479462_59_838 253
497 3300049589 Ga0501073_0040361 Ga0501073_0040361_1769_2548 253
498 3300049589 Ga0501073_0148326 Ga0501073_0148326_413_1192 253
499 3300049592 Ga0501076_0092160 Ga0501076_0092160_574_1353 253
500 3300049742 Ga0501080_0014568 Ga0501080_0014568_5587_6366 253
501 3300049742 Ga0501080_0478342 Ga0501080_0478342_157_936 253
502 3300049742 Ga0501080_0650926 Ga0501080_0650926_10_789 253
503 3300049744 Ga0501083_0022032 Ga0501083_0022032_1446_2225 253
504 3300049744 Ga0501083_0066575 Ga0501083_0066575_771_1550 253
505 3300049823 Ga0501044_0083905 Ga0501044_0083905_673_1452 253
506 3300054114 Ga0501084_0020237 Ga0501084_0020237_2864_3643 253
507 3300060353 Ga0501082_0128605 Ga0501082_0128605_1093_1872 253
508 3300041512 Ga0451853_1858440 Ga0451853_1858440_54_845 254
509 3300026089 Ga0207648_10105618 Ga0207648_101056183 255
510 3300014969 Ga0157376_10071200 Ga0157376_100712004 256
511 3300037471 Ga0395905_0319552 Ga0395905_0319552_191_970 256
512 3300038443 Ga0395901_0317491 Ga0395901_0317491_792_1571 256
513 3300042005 Ga0439448_0011384 Ga0439448_0011384_333_1136 256
514 3300049591 Ga0501075_0238043 Ga0501075_0238043_205_990 256
515 3300049593 Ga0501077_0002156 Ga0501077_0002156_858_1649 256
516 3300049743 Ga0501081_0408817 Ga0501081_0408817_12_797 256
517 3300054114 Ga0501084_0116735 Ga0501084_0116735_153_938 256
518 3300041408 Ga0439453_0007832 Ga0439453_0007832_702_1499 257
519 3300005356 Ga0070674_100042929 Ga0070674_1000429293 258
520 3300009094 Ga0111539_10137421 Ga0111539_101374213 258
521 3300014326 Ga0157380_10538289 Ga0157380_105382891 258
522 3300025937 Ga0207669_10075544 Ga0207669_100755443 258
523 3300026089 Ga0207648_10056939 Ga0207648_100569394 258
524 3300045049 Ga0466959_0109449 Ga0466959_0109449_299_1135 258
525 3300049568 Ga0501031_0004586 Ga0501031_0004586_5537_6340 258
526 3300049569 Ga0501032_0067085 Ga0501032_0067085_1447_2250 258
527 3300049570 Ga0501033_0063188 Ga0501033_0063188_891_1694 258
528 3300049572 Ga0501036_0013364 Ga0501036_0013364_3716_4519 258
529 3300049573 Ga0501037_0043498 Ga0501037_0043498_1648_2451 258
530 3300049574 Ga0501038_0001390 Ga0501038_0001390_17272_18075 258
531 3300049575 Ga0501039_0018998 Ga0501039_0018998_756_1559 258
532 3300049576 Ga0501040_0001940 Ga0501040_0001940_10426_11229 258
533 3300049577 Ga0501041_0002244 Ga0501041_0002244_5001_5804 258
534 3300049578 Ga0501042_0005512 Ga0501042_0005512_5079_5882 258
535 3300049579 Ga0501043_0007697 Ga0501043_0007697_3664_4467 258
536 3300049581 Ga0501047_0260289 Ga0501047_0260289_499_1302 258
537 3300049582 Ga0501048_0056455 Ga0501048_0056455_966_1769 258
538 3300049584 Ga0501068_0002839 Ga0501068_0002839_1911_2714 258
539 3300049585 Ga0501069_0013440 Ga0501069_0013440_1912_2715 258
540 3300049587 Ga0501071_0004817 Ga0501071_0004817_3265_4068 258
541 3300049588 Ga0501072_0006223 Ga0501072_0006223_4828_5631 258
542 3300049589 Ga0501073_0028494 Ga0501073_0028494_1649_2452 258
543 3300049590 Ga0501074_0003320 Ga0501074_0003320_5826_6629 258
544 3300049592 Ga0501076_0029915 Ga0501076_0029915_2849_3652 258
545 3300049593 Ga0501077_0006182 Ga0501077_0006182_4814_5617 258
546 3300049741 Ga0501079_0020897 Ga0501079_0020897_30_833 258
547 3300049742 Ga0501080_0173642 Ga0501080_0173642_400_1203 258
548 3300049743 Ga0501081_0004860 Ga0501081_0004860_4820_5623 258
549 3300049744 Ga0501083_0044173 Ga0501083_0044173_1488_2291 258
550 3300049824 Ga0501045_0003983 Ga0501045_0003983_6459_7262 258
551 3300054114 Ga0501084_0034479 Ga0501084_0034479_1999_2802 258
552 3300060353 Ga0501082_0013362 Ga0501082_0013362_3243_4046 258
553 3300061734 Ga0530510_0004362 Ga0530510_0004362_5146_5949 258
554 3300049578 Ga0501042_0258455 Ga0501042_0258455_379_1185 259
555 3300049583 Ga0501067_0043193 Ga0501067_0043193_1559_2341 259
556 3300049587 Ga0501071_0120360 Ga0501071_0120360_1075_1881 259
557 3300049592 Ga0501076_0172123 Ga0501076_0172123_684_1490 259
558 3300049741 Ga0501079_0069872 Ga0501079_0069872_1753_2535 259
559 3300054114 Ga0501084_0429814 Ga0501084_0429814_241_1047 259
560 3300061734 Ga0530510_0141159 Ga0530510_0141159_56_838 259
561 3300002074 JGI24748J21848_1006401 JGI24748J21848_10064012 260
562 3300002075 JGI24738J21930_10004317 JGI24738J21930_100043173 260
563 3300003203 JGI25406J46586_10011827 JGI25406J46586_100118273 260
564 3300005328 Ga0070676_10108046 Ga0070676_101080462 260
565 3300005328 Ga0070676_10392510 Ga0070676_103925101 260
566 3300005329 Ga0070683_100043756 Ga0070683_1000437561 260
567 3300005329 Ga0070683_100084911 Ga0070683_1000849113 260
568 3300005329 Ga0070683_100207816 Ga0070683_1002078163 260
569 3300005329 Ga0070683_100307032 Ga0070683_1003070322 260
570 3300005330 Ga0070690_100147623 Ga0070690_1001476233 260
571 3300005334 Ga0068869_100012691 Ga0068869_1000126916 260
572 3300005334 Ga0068869_100229827 Ga0068869_1002298271 260
573 3300005335 Ga0070666_10190318 Ga0070666_101903182 260
574 3300005336 Ga0070680_100464555 Ga0070680_1004645551 260
575 3300005337 Ga0070682_100031746 Ga0070682_1000317464 260
576 3300005337 Ga0070682_100127151 Ga0070682_1001271512 260
577 3300005337 Ga0070682_100401730 Ga0070682_1004017302 260
578 3300005338 Ga0068868_100028641 Ga0068868_1000286411 260
579 3300005338 Ga0068868_100363306 Ga0068868_1003633061 260
580 3300005338 Ga0068868_100423937 Ga0068868_1004239372 260
581 3300005339 Ga0070660_100048573 Ga0070660_1000485734 260
582 3300005339 Ga0070660_100329361 Ga0070660_1003293611 260
583 3300005341 Ga0070691_10003867 Ga0070691_100038676 260
584 3300005344 Ga0070661_100053195 Ga0070661_1000531953 260
585 3300005345 Ga0070692_10019897 Ga0070692_100198973 260
586 3300005345 Ga0070692_10064286 Ga0070692_100642861 260
587 3300005347 Ga0070668_100070704 Ga0070668_1000707043 260
588 3300005347 Ga0070668_100113261 Ga0070668_1001132613 260
589 3300005354 Ga0070675_100061051 Ga0070675_1000610511 260
590 3300005354 Ga0070675_100137200 Ga0070675_1001372001 260
591 3300005354 Ga0070675_100267156 Ga0070675_1002671562 260
592 3300005355 Ga0070671_100060488 Ga0070671_1000604882 260
593 3300005355 Ga0070671_100062030 Ga0070671_1000620303 260
594 3300005356 Ga0070674_100041590 Ga0070674_1000415903 260
595 3300005356 Ga0070674_100183521 Ga0070674_1001835211 260
596 3300005364 Ga0070673_100019981 Ga0070673_1000199816 260
597 3300005365 Ga0070688_100019230 Ga0070688_1000192301 260
598 3300005366 Ga0070659_100022749 Ga0070659_1000227496 260
599 3300005366 Ga0070659_100173710 Ga0070659_1001737101 260
600 3300005366 Ga0070659_100584563 Ga0070659_1005845631 260
601 3300005438 Ga0070701_10109767 Ga0070701_101097672 260
602 3300005438 Ga0070701_10268780 Ga0070701_102687802 260
603 3300005441 Ga0070700_100248892 Ga0070700_1002488922 260
604 3300005441 Ga0070700_100434057 Ga0070700_1004340571 260
605 3300005444 Ga0070694_100208965 Ga0070694_1002089652 260
606 3300005455 Ga0070663_100063895 Ga0070663_1000638953 260
607 3300005455 Ga0070663_100200179 Ga0070663_1002001792 260
608 3300005456 Ga0070678_100058968 Ga0070678_1000589683 260
609 3300005456 Ga0070678_100097324 Ga0070678_1000973243 260
610 3300005456 Ga0070678_100110108 Ga0070678_1001101083 260
611 3300005457 Ga0070662_100017781 Ga0070662_1000177818 260
612 3300005457 Ga0070662_100117753 Ga0070662_1001177531 260
613 3300005457 Ga0070662_100149537 Ga0070662_1001495372 260
614 3300005458 Ga0070681_10300368 Ga0070681_103003682 260
615 3300005459 Ga0068867_100049389 Ga0068867_1000493896 260
616 3300005459 Ga0068867_100246320 Ga0068867_1002463201 260
617 3300005518 Ga0070699_100121129 Ga0070699_1001211293 260
618 3300005518 Ga0070699_100495249 Ga0070699_1004952491 260
619 3300005530 Ga0070679_100436369 Ga0070679_1004363692 260
620 3300005535 Ga0070684_100101399 Ga0070684_1001013993 260
621 3300005535 Ga0070684_100114067 Ga0070684_1001140673 260
622 3300005535 Ga0070684_100402910 Ga0070684_1004029102 260
623 3300005535 Ga0070684_100476083 Ga0070684_1004760832 260
624 3300005535 Ga0070684_100570992 Ga0070684_1005709921 260
625 3300005539 Ga0068853_100092055 Ga0068853_1000920551 260
626 3300005539 Ga0068853_100414531 Ga0068853_1004145311 260
627 3300005539 Ga0068853_100480312 Ga0068853_1004803122 260
628 3300005543 Ga0070672_100077300 Ga0070672_1000773003 260
629 3300005543 Ga0070672_100155724 Ga0070672_1001557242 260
630 3300005544 Ga0070686_100082484 Ga0070686_1000824842 260
631 3300005546 Ga0070696_100082497 Ga0070696_1000824972 260
632 3300005547 Ga0070693_100095721 Ga0070693_1000957212 260
633 3300005548 Ga0070665_100140484 Ga0070665_1001404842 260
634 3300005563 Ga0068855_100158907 Ga0068855_1001589073 260
635 3300005564 Ga0070664_100010033 Ga0070664_10001003311 260
636 3300005564 Ga0070664_100413985 Ga0070664_1004139852 260
637 3300005564 Ga0070664_100653388 Ga0070664_1006533881 260
638 3300005577 Ga0068857_100608269 Ga0068857_1006082692 260
639 3300005578 Ga0068854_100021594 Ga0068854_1000215942 260
640 3300005578 Ga0068854_100099990 Ga0068854_1000999901 260
641 3300005615 Ga0070702_100273883 Ga0070702_1002738832 260
642 3300005616 Ga0068852_100162678 Ga0068852_1001626783 260
643 3300005616 Ga0068852_100462886 Ga0068852_1004628862 260
644 3300005616 Ga0068852_100709780 Ga0068852_1007097802 260
645 3300005617 Ga0068859_100038389 Ga0068859_1000383895 260
646 3300005617 Ga0068859_100242972 Ga0068859_1002429723 260
647 3300005618 Ga0068864_100151738 Ga0068864_1001517383 260
648 3300005718 Ga0068866_10216495 Ga0068866_102164951 260
649 3300005719 Ga0068861_100315511 Ga0068861_1003155111 260
650 3300005834 Ga0068851_10029573 Ga0068851_100295733 260
651 3300005840 Ga0068870_10027826 Ga0068870_100278264 260
652 3300005840 Ga0068870_10098639 Ga0068870_100986392 260
653 3300005840 Ga0068870_10127219 Ga0068870_101272192 260
654 3300005841 Ga0068863_100176216 Ga0068863_1001762162 260
655 3300005842 Ga0068858_100046786 Ga0068858_1000467866 260
656 3300005843 Ga0068860_100027971 Ga0068860_1000279716 260
657 3300005843 Ga0068860_100601624 Ga0068860_1006016241 260
658 3300005844 Ga0068862_100143650 Ga0068862_1001436503 260
659 3300005844 Ga0068862_100550823 Ga0068862_1005508232 260
660 3300005937 Ga0081455_10031276 Ga0081455_100312765 260
661 3300005937 Ga0081455_10047065 Ga0081455_100470656 260
662 3300005937 Ga0081455_10080350 Ga0081455_100803501 260
663 3300005985 Ga0081539_10000433 Ga0081539_1000043372 260
664 3300006038 Ga0075365_10021528 Ga0075365_100215285 260
665 3300006038 Ga0075365_10314612 Ga0075365_103146122 260
666 3300006058 Ga0075432_10015139 Ga0075432_100151392 260
667 3300006237 Ga0097621_100024219 Ga0097621_1000242193 260
668 3300006237 Ga0097621_100079474 Ga0097621_1000794743 260
669 3300006358 Ga0068871_100208481 Ga0068871_1002084812 260
670 3300006358 Ga0068871_100416634 Ga0068871_1004166342 260
671 3300006844 Ga0075428_100004768 Ga0075428_10000476817 260
672 3300006880 Ga0075429_100264330 Ga0075429_1002643303 260
673 3300006881 Ga0068865_100036260 Ga0068865_1000362604 260
674 3300006881 Ga0068865_100059793 Ga0068865_1000597933 260
675 3300006881 Ga0068865_100064080 Ga0068865_1000640802 260
676 3300006931 Ga0097620_100038389 Ga0097620_1000383895 260
677 3300006931 Ga0097620_100242983 Ga0097620_1002429833 260
678 3300009094 Ga0111539_10008690 Ga0111539_1000869021 260
679 3300009094 Ga0111539_10315418 Ga0111539_103154183 260
680 3300009098 Ga0105245_10039562 Ga0105245_100395626 260
681 3300009098 Ga0105245_10041639 Ga0105245_100416396 260
682 3300009098 Ga0105245_10411317 Ga0105245_104113172 260
683 3300009101 Ga0105247_10046136 Ga0105247_100461364 260
684 3300009147 Ga0114129_10238681 Ga0114129_102386813 260
685 3300009148 Ga0105243_10035607 Ga0105243_100356075 260
686 3300009148 Ga0105243_10100000 Ga0105243_101000003 260
687 3300009148 Ga0105243_10122737 Ga0105243_101227373 260
688 3300009148 Ga0105243_10254320 Ga0105243_102543203 260
689 3300009174 Ga0105241_10072501 Ga0105241_100725012 260
690 3300009176 Ga0105242_10030307 Ga0105242_100303076 260
691 3300009176 Ga0105242_10104555 Ga0105242_101045552 260
692 3300009177 Ga0105248_10158140 Ga0105248_101581401 260
693 3300009551 Ga0105238_10096099 Ga0105238_100960992 260
694 3300009551 Ga0105238_10327807 Ga0105238_103278071 260
695 3300009553 Ga0105249_10298265 Ga0105249_102982653 260
696 3300009553 Ga0105249_10416330 Ga0105249_104163302 260
697 3300010375 Ga0105239_10052822 Ga0105239_100528224 260
698 3300010375 Ga0105239_10152239 Ga0105239_101522393 260
699 3300010375 Ga0105239_10324882 Ga0105239_103248823 260
700 3300011119 Ga0105246_10049177 Ga0105246_100491774 260
701 3300011119 Ga0105246_10114755 Ga0105246_101147552 260
702 3300011119 Ga0105246_10363322 Ga0105246_103633221 260
703 3300013102 Ga0157371_10061279 Ga0157371_100612792 260
704 3300013306 Ga0163162_10794903 Ga0163162_107949032 260
705 3300013307 Ga0157372_10067081 Ga0157372_100670816 260
706 3300013307 Ga0157372_10108401 Ga0157372_101084013 260
707 3300013307 Ga0157372_10553710 Ga0157372_105537101 260
708 3300013308 Ga0157375_10136867 Ga0157375_101368673 260
709 3300014325 Ga0163163_10096702 Ga0163163_100967025 260
710 3300014325 Ga0163163_10197777 Ga0163163_101977773 260
711 3300014325 Ga0163163_10385625 Ga0163163_103856252 260
712 3300014326 Ga0157380_10047519 Ga0157380_100475194 260
713 3300014326 Ga0157380_10129723 Ga0157380_101297233 260
714 3300014745 Ga0157377_10009126 Ga0157377_100091266 260
715 3300014745 Ga0157377_10439888 Ga0157377_104398882 260
716 3300014968 Ga0157379_10276812 Ga0157379_102768122 260
717 3300014969 Ga0157376_10045570 Ga0157376_100455703 260
718 3300017792 Ga0163161_10081962 Ga0163161_100819624 260
719 3300020082 Ga0206353_11223501 Ga0206353_112235012 260
720 3300025899 Ga0207642_10105205 Ga0207642_101052052 260
721 3300025901 Ga0207688_10016881 Ga0207688_100168814 260
722 3300025901 Ga0207688_10036391 Ga0207688_100363915 260
723 3300025903 Ga0207680_10278277 Ga0207680_102782771 260
724 3300025904 Ga0207647_10021889 Ga0207647_100218897 260
725 3300025907 Ga0207645_10064369 Ga0207645_100643694 260
726 3300025908 Ga0207643_10048389 Ga0207643_100483894 260
727 3300025908 Ga0207643_10135575 Ga0207643_101355752 260
728 3300025909 Ga0207705_10013197 Ga0207705_100131974 260
729 3300025912 Ga0207707_10139507 Ga0207707_101395071 260
730 3300025917 Ga0207660_10345055 Ga0207660_103450551 260
731 3300025919 Ga0207657_10028407 Ga0207657_100284071 260
732 3300025919 Ga0207657_10294684 Ga0207657_102946842 260
733 3300025919 Ga0207657_10297142 Ga0207657_102971421 260
734 3300025920 Ga0207649_10020612 Ga0207649_100206124 260
735 3300025923 Ga0207681_10151818 Ga0207681_101518182 260
736 3300025923 Ga0207681_10582520 Ga0207681_105825201 260
737 3300025924 Ga0207694_10010017 Ga0207694_100100174 260
738 3300025925 Ga0207650_10424144 Ga0207650_104241442 260
739 3300025926 Ga0207659_10306903 Ga0207659_103069032 260
740 3300025927 Ga0207687_10018414 Ga0207687_100184147 260
741 3300025931 Ga0207644_10038542 Ga0207644_100385425 260
742 3300025932 Ga0207690_10096274 Ga0207690_100962744 260
743 3300025933 Ga0207706_10089715 Ga0207706_100897153 260
744 3300025934 Ga0207686_10020647 Ga0207686_100206476 260
745 3300025934 Ga0207686_10059068 Ga0207686_100590684 260
746 3300025934 Ga0207686_10461754 Ga0207686_104617541 260
747 3300025935 Ga0207709_10015196 Ga0207709_100151966 260
748 3300025935 Ga0207709_10020150 Ga0207709_100201506 260
749 3300025937 Ga0207669_10006019 Ga0207669_100060199 260
750 3300025937 Ga0207669_10039257 Ga0207669_100392573 260
751 3300025938 Ga0207704_10038463 Ga0207704_100384633 260
752 3300025938 Ga0207704_10065645 Ga0207704_100656452 260
753 3300025938 Ga0207704_10072194 Ga0207704_100721941 260
754 3300025940 Ga0207691_10041610 Ga0207691_100416106 260
755 3300025940 Ga0207691_10173734 Ga0207691_101737342 260
756 3300025940 Ga0207691_10250954 Ga0207691_102509542 260
757 3300025941 Ga0207711_10113217 Ga0207711_101132174 260
758 3300025942 Ga0207689_10029116 Ga0207689_100291164 260
759 3300025942 Ga0207689_10095522 Ga0207689_100955225 260
760 3300025942 Ga0207689_10516871 Ga0207689_105168712 260
761 3300025944 Ga0207661_10427951 Ga0207661_104279511 260
762 3300025945 Ga0207679_10413219 Ga0207679_104132191 260
763 3300025945 Ga0207679_10510108 Ga0207679_105101081 260
764 3300025949 Ga0207667_10074146 Ga0207667_100741463 260
765 3300025960 Ga0207651_10147920 Ga0207651_101479201 260
766 3300025961 Ga0207712_10248203 Ga0207712_102482033 260
767 3300025972 Ga0207668_10095859 Ga0207668_100958593 260
768 3300025981 Ga0207640_10028606 Ga0207640_100286063 260
769 3300025986 Ga0207658_10089775 Ga0207658_100897753 260
770 3300026041 Ga0207639_10079382 Ga0207639_100793823 260
771 3300026041 Ga0207639_10171574 Ga0207639_101715742 260
772 3300026041 Ga0207639_10484977 Ga0207639_104849771 260
773 3300026075 Ga0207708_10096513 Ga0207708_100965133 260
774 3300026075 Ga0207708_10236944 Ga0207708_102369441 260
775 3300026088 Ga0207641_10049012 Ga0207641_100490125 260
776 3300026089 Ga0207648_10070364 Ga0207648_100703641 260
777 3300026089 Ga0207648_10174394 Ga0207648_101743942 260
778 3300026116 Ga0207674_10682938 Ga0207674_106829381 260
779 3300026118 Ga0207675_100109639 Ga0207675_1001096391 260
780 3300026118 Ga0207675_100189636 Ga0207675_1001896361 260
781 3300026121 Ga0207683_10128796 Ga0207683_101287961 260
782 3300026121 Ga0207683_10245640 Ga0207683_102456401 260
783 3300026121 Ga0207683_10308742 Ga0207683_103087421 260
784 3300026121 Ga0207683_10404354 Ga0207683_104043542 260
785 3300026142 Ga0207698_10014070 Ga0207698_100140702 260
786 3300027907 Ga0207428_10000181 Ga0207428_1000018177 260
787 3300027907 Ga0207428_10013218 Ga0207428_100132183 260
788 3300028379 Ga0268266_10112398 Ga0268266_101123981 260
789 3300028381 Ga0268264_10102520 Ga0268264_101025201 260
790 3300034957 Ga0373938_0045743 Ga0373938_0045743_155_937 260
791 3300035084 Ga0373928_0006299 Ga0373928_0006299_121_903 260
792 3300035091 Ga0373951_0025306 Ga0373951_0025306_272_1054 260
793 3300035207 Ga0373942_0036068 Ga0373942_0036068_320_1102 260
794 3300035691 Ga0373931_0113159 Ga0373931_0113159_737_1519 260
795 3300041405 Ga0439438_010111 Ga0439438_010111_839_1900 260
796 3300042876 Ga0451577_0013304 Ga0451577_0013304_4105_4947 260
797 3300044712 Ga0453684_0215937 Ga0453684_0215937_992_1834 260
798 3300046455 Ga0495603_0009479 Ga0495603_0009479_1642_2445 260
799 3300046474 Ga0495605_0146463 Ga0495605_0146463_29_832 260
800 3300046615 Ga0495656_0019032 Ga0495656_0019032_1386_2189 260
801 3300046794 Ga0495589_0031760 Ga0495589_0031760_1309_2112 260
802 3300048904 Ga0496101_0229900 Ga0496101_0229900_315_1118 260
803 3300048905 Ga0496102_0402721 Ga0496102_0402721_173_955 260
804 3300048906 Ga0496103_0257920 Ga0496103_0257920_202_984 260
805 3300048907 Ga0496104_0106807 Ga0496104_0106807_622_1425 260
806 3300048908 Ga0496105_0069692 Ga0496105_0069692_1340_2122 260
807 3300048910 Ga0496107_0023742 Ga0496107_0023742_993_1775 260
808 3300048911 Ga0496108_0099031 Ga0496108_0099031_775_1557 260
809 3300048911 Ga0496108_0134961 Ga0496108_0134961_704_1507 260
810 3300048912 Ga0496109_0026271 Ga0496109_0026271_863_1645 260
811 3300048913 Ga0496110_0017812 Ga0496110_0017812_3269_4051 260
812 3300048913 Ga0496110_0166123 Ga0496110_0166123_312_1109 260
813 3300048913 Ga0496110_0257401 Ga0496110_0257401_142_942 260
814 3300048914 Ga0496111_0096517 Ga0496111_0096517_173_955 260
815 3300048915 Ga0496112_0307749 Ga0496112_0307749_340_1122 260
816 3300048916 Ga0496113_0039042 Ga0496113_0039042_1936_2718 260
817 3300049568 Ga0501031_0033548 Ga0501031_0033548_1898_2701 260
818 3300049572 Ga0501036_0036626 Ga0501036_0036626_1441_2244 260
819 3300049573 Ga0501037_0105900 Ga0501037_0105900_1174_1977 260
820 3300049574 Ga0501038_0129668 Ga0501038_0129668_699_1502 260
821 3300049575 Ga0501039_0007709 Ga0501039_0007709_6035_6838 260
822 3300049576 Ga0501040_0055410 Ga0501040_0055410_755_1558 260
823 3300049577 Ga0501041_0038812 Ga0501041_0038812_1378_2181 260
824 3300049578 Ga0501042_0113157 Ga0501042_0113157_179_982 260
825 3300049580 Ga0501046_0093793 Ga0501046_0093793_500_1303 260
826 3300049582 Ga0501048_0015470 Ga0501048_0015470_4184_4987 260
827 3300049587 Ga0501071_0001083 Ga0501071_0001083_2043_2846 260
828 3300049587 Ga0501071_0013395 Ga0501071_0013395_2925_3728 260
829 3300049588 Ga0501072_0016036 Ga0501072_0016036_4721_5524 260
830 3300049589 Ga0501073_0050481 Ga0501073_0050481_81_884 260
831 3300049590 Ga0501074_0283510 Ga0501074_0283510_293_1096 260
832 3300049591 Ga0501075_0003018 Ga0501075_0003018_5325_6128 260
833 3300049592 Ga0501076_0011794 Ga0501076_0011794_2826_3629 260
834 3300049593 Ga0501077_0001393 Ga0501077_0001393_1293_2096 260
835 3300049741 Ga0501079_0008393 Ga0501079_0008393_1430_2233 260
836 3300049742 Ga0501080_0058666 Ga0501080_0058666_1118_1921 260
837 3300049743 Ga0501081_0016532 Ga0501081_0016532_2115_2918 260
838 3300049823 Ga0501044_0285897 Ga0501044_0285897_204_1007 260
839 3300049824 Ga0501045_0010860 Ga0501045_0010860_4149_4952 260
840 3300050492 nmdc:mga0yw44_18369_c1 nmdc:mga0yw44_18369_c1_496_1296 260
841 3300050492 nmdc:mga0yw44_47549_c1 nmdc:mga0yw44_47549_c1_1192_1995 260
842 3300050507 nmdc:mga05p37_152362_c1 nmdc:mga05p37_152362_c1_1690_2493 260
843 3300050508 nmdc:mga09592_51891_c1 nmdc:mga09592_51891_c1_902_1705 260
844 3300050511 nmdc:mga08y16_14638_c1 nmdc:mga08y16_14638_c1_2919_3716 260
845 3300050511 nmdc:mga08y16_254941_c1 nmdc:mga08y16_254941_c1_174_956 260
846 3300050515 nmdc:mga0a205_2010_c1 nmdc:mga0a205_2010_c1_184_987 260
847 3300050515 nmdc:mga0a205_660214_c1 nmdc:mga0a205_660214_c1_92_874 260
848 3300054114 Ga0501084_0015419 Ga0501084_0015419_1993_2796 260
849 3300054114 Ga0501084_0499999 Ga0501084_0499999_38_841 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

11

239

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9903 1 248
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9895 1 247
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.986 1 249
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.986 1 246
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9816 1 247
ID Description Score Start End Superfamily
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9912 15 123 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9904 1 247 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.986 1 246 3.90.230.10
af_P9WK21_10_265_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9829 1 247 3.90.230.10
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9828 1 247 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7X7PQL7-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9983 1 247 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A554JTL7-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.996 32 247 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A3D0E855-F1-model_v4 deleted 0.9957 1 246
AF-A0A6N8I3V3-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9956 1 247 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-C7LQ58-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9954 2 247 GO:0004239
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
96.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map