F483395
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 849 | 368 | 1699 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10000018|Ga0157380_1000001885 |
| Length | 321 |
| Sequence | LKSSKEIIDLARQTFDIEAEAIAGLKPFINDDFVESVKLIYSAKGRVIVTGIGKSAIIANKIVATFNSTGTPAVFLHAADAIHGDLGMIQQNDVIICISKSGNTSEIKVLVPLLKNGGNKLIAIVGNMDSYLAGSADLVLNTTIEKEACPNNLAPTTSTTAQLAMGDALAVCLLDYRGFTSGDFARFHPGGALGKRLYLRVGDLYKHNAQPGVNENAGIEEIIMEISSKRLGATAVINDHKLAGIITDGDLRRMMQQHKPLDKVKAKDIMTVNPKTADPEMMAVDALRMMKEFNITQLVVTDKMKYLGFVHLHDLLREGII |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 224 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 225 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 228 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 229 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 230 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 231 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 241 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 242 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 291 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 292 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 293 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 294 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 295 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 296 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 297 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 298 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 299 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 300 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 305 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 310 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 318 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 320 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 321 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 322 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 323 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 324 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 325 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 326 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 327 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 329 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 330 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 331 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 332 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 333 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 334 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 335 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 336 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 338 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 339 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 340 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 343 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 344 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 345 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 346 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 347 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 348 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 349 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 350 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 351 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 352 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 353 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 354 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 355 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 356 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 357 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 358 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 359 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 360 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 361 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 362 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 363 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 364 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 365 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 366 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 367 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 368 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.06 |
| Metatranscriptomes | 0 |
| Isolates | 2.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.24 |
| Nodule | 0 |
| Rhizoplane | 0.71 |
| Rhizosphere | 84.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157380_10000018 | 3300014326 | Bacteria | 116537 |
| 2 | MRS1b_contig_4233568 | 2162886011 | Unclassified | 1547 |
| 3 | MRS1b_contig_448359 | 2162886011 | Bacteria | 1369 |
| 4 | MBSR1b_contig_1406278 | 2162886012 | Bacteria | 2197 |
| 5 | MBSR1b_contig_7589204 | 2162886012 | Bacteria | 2472 |
| 6 | JGI24744J21845_10003674 | 3300002077 | Bacteria | 3161 |
| 7 | JGI24751J29686_10000540 | 3300002459 | Bacteria | 10612 |
| 8 | JGI25152J39213_1000647 | 3300002773 | Bacteria | 18444 |
| 9 | JGI25150J39212_1000009 | 3300002774 | Bacteria | 249509 |
| 10 | JGI25151J46595_10000017 | 3300003187 | Bacteria | 249509 |
| 11 | JGI25153J46596_10000023 | 3300003215 | Bacteria | 249509 |
| 12 | JGI25153J46596_10023575 | 3300003215 | Bacteria | 2239 |
| 13 | rootH1_10004252 | 3300003316 | Bacteria | 8332 |
| 14 | rootH1_10013495 | 3300003316 | Bacteria | 2356 |
| 15 | rootH1_10013813 | 3300003316 | Bacteria | 11218 |
| 16 | rootH1_10013813 | 3300003323 | Bacteria | 1368 |
| 17 | rootH2_10019275 | 3300003320 | Bacteria | 26987 |
| 18 | rootH2_10039673 | 3300003320 | Bacteria | 11437 |
| 19 | rootH2_10075767 | 3300003320 | Bacteria | 1678 |
| 20 | rootH2_10135544 | 3300003320 | Bacteria | 6928 |
| 21 | rootH2_10166600 | 3300003320 | Bacteria | 4060 |
| 22 | rootH2_10213033 | 3300003320 | Bacteria | 2091 |
| 23 | rootH2_10232790 | 3300003320 | Bacteria | 1248 |
| 24 | rootL2_10000984 | 3300003322 | Bacteria | 19559 |
| 25 | rootL2_10001672 | 3300003322 | Bacteria | 4737 |
| 26 | rootL2_10023331 | 3300003322 | Bacteria | 2597 |
| 27 | rootL2_10041649 | 3300003322 | Bacteria | 1912 |
| 28 | rootL2_10062550 | 3300003322 | Bacteria | 3641 |
| 29 | rootL2_10082800 | 3300003322 | Bacteria | 3650 |
| 30 | rootH1_10003699 | 3300003323 | Bacteria | 25103 |
| 31 | rootH1_10011437 | 3300003323 | Bacteria | 74019 |
| 32 | rootH1_10044529 | 3300003323 | Bacteria | 12446 |
| 33 | rootH1_10064744 | 3300003323 | Bacteria | 6408 |
| 34 | rootH1_10175021 | 3300003323 | Bacteria | 3205 |
| 35 | rootH1_10311342 | 3300003323 | Bacteria | 1623 |
| 36 | JGI25160J50197_1001239 | 3300003354 | Bacteria | 12966 |
| 37 | Ga0055535_1003210 | 3300003761 | Bacteria | 4823 |
| 38 | Ga0055542_1004148 | 3300003762 | Bacteria | 3639 |
| 39 | Ga0055536_1000011 | 3300003781 | Bacteria | 275969 |
| 40 | Ga0055528_1001011 | 3300003790 | Bacteria | 18675 |
| 41 | Ga0055530_10000880 | 3300003791 | Bacteria | 24686 |
| 42 | Ga0055530_10002755 | 3300003791 | Bacteria | 10873 |
| 43 | Ga0055531_10000054 | 3300003794 | Bacteria | 123684 |
| 44 | Ga0055543_1014584 | 3300004625 | Bacteria | 1529 |
| 45 | Ga0065165_1000027 | 3300005262 | Bacteria | 228507 |
| 46 | Ga0065714_10004769 | 3300005288 | Bacteria | 5412 |
| 47 | Ga0065714_10073672 | 3300005288 | Bacteria | 3137 |
| 48 | Ga0065704_10101212 | 3300005289 | Unclassified | 2240 |
| 49 | Ga0065712_10072246 | 3300005290 | Bacteria | 4834 |
| 50 | Ga0065712_10080579 | 3300005290 | Bacteria | 3089 |
| 51 | Ga0065712_10084814 | 3300005290 | Bacteria | 2739 |
| 52 | Ga0065712_10109904 | 3300005290 | Bacteria | 1844 |
| 53 | Ga0065715_10113921 | 3300005293 | Bacteria | 2470 |
| 54 | Ga0070658_10051009 | 3300005327 | Bacteria | 3353 |
| 55 | Ga0070658_10121863 | 3300005327 | Bacteria | 2167 |
| 56 | Ga0070683_100000327 | 3300005329 | Bacteria | 32861 |
| 57 | Ga0070683_100015832 | 3300005329 | Bacteria | 6632 |
| 58 | Ga0070683_100047014 | 3300005329 | Bacteria | 3987 |
| 59 | Ga0070683_100069592 | 3300005329 | Bacteria | 3281 |
| 60 | Ga0070683_100160628 | 3300005329 | Bacteria | 2132 |
| 61 | Ga0070683_100192250 | 3300005329 | Bacteria | 1938 |
| 62 | Ga0070683_100208963 | 3300005329 | Bacteria | 1854 |
| 63 | Ga0070690_100006021 | 3300005330 | Bacteria | 6857 |
| 64 | Ga0070670_100002147 | 3300005331 | Bacteria | 16194 |
| 65 | Ga0070670_100026886 | 3300005331 | Bacteria | 4949 |
| 66 | Ga0070670_100088497 | 3300005331 | Bacteria | 2662 |
| 67 | Ga0070670_100193003 | 3300005331 | Bacteria | 1769 |
| 68 | Ga0070677_10105904 | 3300005333 | Bacteria | 1248 |
| 69 | Ga0068869_100004838 | 3300005334 | Bacteria | 8409 |
| 70 | Ga0068869_100007443 | 3300005334 | Bacteria | 6998 |
| 71 | Ga0068869_100009710 | 3300005334 | Bacteria | 6249 |
| 72 | Ga0068869_100033079 | 3300005334 | Bacteria | 3649 |
| 73 | Ga0068869_100135103 | 3300005334 | Bacteria | 1899 |
| 74 | Ga0070666_10010282 | 3300005335 | Bacteria | 5848 |
| 75 | Ga0070666_10015901 | 3300005335 | Bacteria | 4806 |
| 76 | Ga0070666_10057022 | 3300005335 | Bacteria | 2639 |
| 77 | Ga0070680_100030529 | 3300005336 | Bacteria | 4329 |
| 78 | Ga0070680_100039686 | 3300005336 | Bacteria | 3809 |
| 79 | Ga0070682_100036209 | 3300005337 | Unclassified | 3016 |
| 80 | Ga0068868_100001123 | 3300005338 | Bacteria | 18309 |
| 81 | Ga0068868_100009009 | 3300005338 | Bacteria | 7164 |
| 82 | Ga0068868_100155187 | 3300005338 | Bacteria | 1888 |
| 83 | Ga0068868_100237886 | 3300005338 | Archaea | 1529 |
| 84 | Ga0070660_100000435 | 3300005339 | Bacteria | 27665 |
| 85 | Ga0070660_100243923 | 3300005339 | Bacteria | 1464 |
| 86 | Ga0070689_100013812 | 3300005340 | Bacteria | 5850 |
| 87 | Ga0070689_100014333 | 3300005340 | Bacteria | 5756 |
| 88 | Ga0070689_100014980 | 3300005340 | Bacteria | 5645 |
| 89 | Ga0070691_10087870 | 3300005341 | Bacteria | 1529 |
| 90 | Ga0070661_100003284 | 3300005344 | Bacteria | 11166 |
| 91 | Ga0070661_100011988 | 3300005344 | Bacteria | 6056 |
| 92 | Ga0070661_100120125 | 3300005344 | Unclassified | 1968 |
| 93 | Ga0070668_100165525 | 3300005347 | Bacteria | 1797 |
| 94 | Ga0070669_100006429 | 3300005353 | Bacteria | 8458 |
| 95 | Ga0070669_100014257 | 3300005353 | Bacteria | 5656 |
| 96 | Ga0070669_100024594 | 3300005353 | Bacteria | 4320 |
| 97 | Ga0070669_100038623 | 3300005353 | Bacteria | 3466 |
| 98 | Ga0070675_100055992 | 3300005354 | Bacteria | 3248 |
| 99 | Ga0070675_100117262 | 3300005354 | Bacteria | 2259 |
| 100 | Ga0070671_100053038 | 3300005355 | Bacteria | 3371 |
| 101 | Ga0070671_100144493 | 3300005355 | Bacteria | 2008 |
| 102 | Ga0070671_100268721 | 3300005355 | Bacteria | 1449 |
| 103 | Ga0070674_100020838 | 3300005356 | Bacteria | 4198 |
| 104 | Ga0070673_100040106 | 3300005364 | Bacteria | 3590 |
| 105 | Ga0070673_100042302 | 3300005364 | Bacteria | 3512 |
| 106 | Ga0070673_100118290 | 3300005364 | Bacteria | 2206 |
| 107 | Ga0070673_100149021 | 3300005364 | Unclassified | 1980 |
| 108 | Ga0070673_100293831 | 3300005364 | Bacteria | 1429 |
| 109 | Ga0070688_100084798 | 3300005365 | Bacteria | 2058 |
| 110 | Ga0070659_100008871 | 3300005366 | Bacteria | 7367 |
| 111 | Ga0070659_100009567 | 3300005366 | Bacteria | 7122 |
| 112 | Ga0070659_100019255 | 3300005366 | Bacteria | 5168 |
| 113 | Ga0070667_100018912 | 3300005367 | Bacteria | 5712 |
| 114 | Ga0070667_100050896 | 3300005367 | Bacteria | 3491 |
| 115 | Ga0070667_100222256 | 3300005367 | Bacteria | 1681 |
| 116 | Ga0070700_100035240 | 3300005441 | Bacteria | 3027 |
| 117 | Ga0070663_100209846 | 3300005455 | Bacteria | 1524 |
| 118 | Ga0070663_100428230 | 3300005455 | Bacteria | 1087 |
| 119 | Ga0070678_100011344 | 3300005456 | Bacteria | 5491 |
| 120 | Ga0070678_100119505 | 3300005456 | Bacteria | 2076 |
| 121 | Ga0070662_100000209 | 3300005457 | Bacteria | 34168 |
| 122 | Ga0070662_100046050 | 3300005457 | Bacteria | 3133 |
| 123 | Ga0070681_10012536 | 3300005458 | Bacteria | 8413 |
| 124 | Ga0070681_10051031 | 3300005458 | Bacteria | 4126 |
| 125 | Ga0070681_10102633 | 3300005458 | Bacteria | 2805 |
| 126 | Ga0068867_100003103 | 3300005459 | Bacteria | 11709 |
| 127 | Ga0068867_100039779 | 3300005459 | Bacteria | 3430 |
| 128 | Ga0068867_100257655 | 3300005459 | Unclassified | 1421 |
| 129 | Ga0068867_100274327 | 3300005459 | Bacteria | 1380 |
| 130 | Ga0070685_10004060 | 3300005466 | Bacteria | 7394 |
| 131 | Ga0070685_10123337 | 3300005466 | Bacteria | 1611 |
| 132 | Ga0070685_10262349 | 3300005466 | Unclassified | 1149 |
| 133 | Ga0070698_100000282 | 3300005471 | Bacteria | 51827 |
| 134 | Ga0070698_100002541 | 3300005471 | Bacteria | 20094 |
| 135 | Ga0070698_100006847 | 3300005471 | Bacteria | 12348 |
| 136 | Ga0070679_100094063 | 3300005530 | Bacteria | 2984 |
| 137 | Ga0070684_100000290 | 3300005535 | Bacteria | 34902 |
| 138 | Ga0070684_100001419 | 3300005535 | Bacteria | 17242 |
| 139 | Ga0070684_100080123 | 3300005535 | Bacteria | 2888 |
| 140 | Ga0070684_100094748 | 3300005535 | Bacteria | 2659 |
| 141 | Ga0068853_100009821 | 3300005539 | Bacteria | 7723 |
| 142 | Ga0068853_100010194 | 3300005539 | Bacteria | 7596 |
| 143 | Ga0068853_100029290 | 3300005539 | Bacteria | 4639 |
| 144 | Ga0068853_100041203 | 3300005539 | Bacteria | 3943 |
| 145 | Ga0068853_100087689 | 3300005539 | Bacteria | 2731 |
| 146 | Ga0068853_100417602 | 3300005539 | Bacteria | 1258 |
| 147 | Ga0070672_100008190 | 3300005543 | Bacteria | 7143 |
| 148 | Ga0070672_100079570 | 3300005543 | Bacteria | 2624 |
| 149 | Ga0070672_100147053 | 3300005543 | Bacteria | 1947 |
| 150 | Ga0070686_100042729 | 3300005544 | Bacteria | 2841 |
| 151 | Ga0070686_100072943 | 3300005544 | Bacteria | 2252 |
| 152 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 153 | Ga0070665_100229319 | 3300005548 | Bacteria | 1857 |
| 154 | Ga0068855_100000081 | 3300005563 | Bacteria | 115707 |
| 155 | Ga0068855_100013609 | 3300005563 | Bacteria | 9810 |
| 156 | Ga0068855_100023253 | 3300005563 | Bacteria | 7424 |
| 157 | Ga0068855_100024021 | 3300005563 | Bacteria | 7298 |
| 158 | Ga0068855_100059131 | 3300005563 | Bacteria | 4486 |
| 159 | Ga0068855_100062546 | 3300005563 | Unclassified | 4345 |
| 160 | Ga0068855_100198910 | 3300005563 | Bacteria | 2257 |
| 161 | Ga0068855_100680977 | 3300005563 | Bacteria | 1102 |
| 162 | Ga0070664_100000509 | 3300005564 | Bacteria | 29514 |
| 163 | Ga0070664_100005422 | 3300005564 | Bacteria | 10239 |
| 164 | Ga0070664_100008601 | 3300005564 | Bacteria | 8259 |
| 165 | Ga0070664_100391241 | 3300005564 | Unclassified | 1270 |
| 166 | Ga0068857_100000579 | 3300005577 | Bacteria | 26747 |
| 167 | Ga0068857_100002654 | 3300005577 | Bacteria | 14675 |
| 168 | Ga0068857_100008029 | 3300005577 | Bacteria | 9102 |
| 169 | Ga0068857_100073334 | 3300005577 | Bacteria | 3050 |
| 170 | Ga0068857_100160766 | 3300005577 | Bacteria | 2038 |
| 171 | Ga0068857_100164503 | 3300005577 | Bacteria | 2014 |
| 172 | Ga0068854_100032309 | 3300005578 | Bacteria | 3641 |
| 173 | Ga0068854_100046669 | 3300005578 | Bacteria | 3085 |
| 174 | Ga0068854_100071526 | 3300005578 | Bacteria | 2538 |
| 175 | Ga0068854_100093732 | 3300005578 | Bacteria | 2239 |
| 176 | Ga0068856_100024646 | 3300005614 | Bacteria | 5857 |
| 177 | Ga0068856_100054252 | 3300005614 | Bacteria | 3953 |
| 178 | Ga0068856_100067961 | 3300005614 | Bacteria | 3522 |
| 179 | Ga0068856_100077785 | 3300005614 | Bacteria | 3288 |
| 180 | Ga0068852_100014577 | 3300005616 | Bacteria | 6057 |
| 181 | Ga0068852_100035186 | 3300005616 | Bacteria | 4175 |
| 182 | Ga0068852_100075342 | 3300005616 | Bacteria | 2976 |
| 183 | Ga0068852_100090210 | 3300005616 | Bacteria | 2741 |
| 184 | Ga0068852_100197709 | 3300005616 | Bacteria | 1901 |
| 185 | Ga0068852_100366226 | 3300005616 | Bacteria | 1411 |
| 186 | Ga0068852_100368481 | 3300005616 | Unclassified | 1407 |
| 187 | Ga0068859_100000289 | 3300005617 | Bacteria | 49979 |
| 188 | Ga0068859_100017809 | 3300005617 | Bacteria | 7141 |
| 189 | Ga0068859_100086698 | 3300005617 | Bacteria | 3178 |
| 190 | Ga0068864_100002659 | 3300005618 | Bacteria | 14761 |
| 191 | Ga0068864_100004779 | 3300005618 | Bacteria | 11103 |
| 192 | Ga0068864_100043128 | 3300005618 | Bacteria | 3862 |
| 193 | Ga0068864_100088090 | 3300005618 | Bacteria | 2734 |
| 194 | Ga0068864_100127278 | 3300005618 | Bacteria | 2284 |
| 195 | Ga0068864_100257686 | 3300005618 | Bacteria | 1622 |
| 196 | Ga0068864_100303098 | 3300005618 | Unclassified | 1496 |
| 197 | Ga0068864_100644796 | 3300005618 | Unclassified | 1031 |
| 198 | Ga0068866_10014018 | 3300005718 | Bacteria | 3530 |
| 199 | Ga0068866_10031820 | 3300005718 | Unclassified | 2545 |
| 200 | Ga0068861_100001502 | 3300005719 | Bacteria | 14807 |
| 201 | Ga0068861_100020793 | 3300005719 | Bacteria | 4707 |
| 202 | Ga0068861_100049553 | 3300005719 | Bacteria | 3181 |
| 203 | Ga0068861_100164123 | 3300005719 | Bacteria | 1835 |
| 204 | Ga0068861_100462228 | 3300005719 | Bacteria | 1139 |
| 205 | Ga0068851_10008435 | 3300005834 | Bacteria | 4762 |
| 206 | Ga0068870_10002263 | 3300005840 | Bacteria | 7992 |
| 207 | Ga0068870_10095513 | 3300005840 | Bacteria | 1670 |
| 208 | Ga0068863_100026959 | 3300005841 | Bacteria | 5479 |
| 209 | Ga0068863_100405149 | 3300005841 | Bacteria | 1334 |
| 210 | Ga0068863_100481938 | 3300005841 | Bacteria | 1220 |
| 211 | Ga0068858_100104708 | 3300005842 | Bacteria | 2640 |
| 212 | Ga0068858_100119796 | 3300005842 | Bacteria | 2460 |
| 213 | Ga0068858_100527839 | 3300005842 | Bacteria | 1142 |
| 214 | Ga0068860_100008699 | 3300005843 | Bacteria | 10113 |
| 215 | Ga0068860_100054588 | 3300005843 | Bacteria | 3798 |
| 216 | Ga0068860_100343310 | 3300005843 | Unclassified | 1468 |
| 217 | Ga0068862_100011939 | 3300005844 | Bacteria | 7176 |
| 218 | Ga0068862_100027366 | 3300005844 | Bacteria | 4799 |
| 219 | Ga0068862_100058506 | 3300005844 | Bacteria | 3306 |
| 220 | Ga0068862_100132285 | 3300005844 | Bacteria | 2207 |
| 221 | Ga0068862_100306494 | 3300005844 | Bacteria | 1462 |
| 222 | Ga0075366_10096980 | 3300006195 | Bacteria | 1768 |
| 223 | Ga0097621_100000036 | 3300006237 | Bacteria | 67999 |
| 224 | Ga0097621_100070027 | 3300006237 | Bacteria | 2896 |
| 225 | Ga0097621_100215805 | 3300006237 | Bacteria | 1670 |
| 226 | Ga0097621_100225479 | 3300006237 | Unclassified | 1634 |
| 227 | Ga0068871_100005055 | 3300006358 | Bacteria | 9209 |
| 228 | Ga0068871_100033550 | 3300006358 | Bacteria | 4066 |
| 229 | Ga0068871_100326025 | 3300006358 | Unclassified | 1353 |
| 230 | Ga0068871_100343538 | 3300006358 | Unclassified | 1318 |
| 231 | Ga0075428_100006607 | 3300006844 | Bacteria | 12900 |
| 232 | Ga0075428_100093975 | 3300006844 | Bacteria | 3269 |
| 233 | Ga0075428_100152663 | 3300006844 | Bacteria | 2509 |
| 234 | Ga0075428_100294134 | 3300006844 | Bacteria | 1746 |
| 235 | Ga0075430_100104237 | 3300006846 | Bacteria | 2368 |
| 236 | Ga0075430_100175362 | 3300006846 | Bacteria | 1783 |
| 237 | Ga0075431_100055523 | 3300006847 | Bacteria | 4085 |
| 238 | Ga0075431_100110345 | 3300006847 | Bacteria | 2839 |
| 239 | Ga0075431_100127855 | 3300006847 | Bacteria | 2622 |
| 240 | Ga0075431_100147598 | 3300006847 | Unclassified | 2423 |
| 241 | Ga0075429_100000136 | 3300006880 | Bacteria | 44169 |
| 242 | Ga0075429_100001725 | 3300006880 | Bacteria | 18078 |
| 243 | Ga0068865_100095874 | 3300006881 | Bacteria | 2162 |
| 244 | Ga0097620_100000289 | 3300006931 | Bacteria | 49979 |
| 245 | Ga0097620_100017809 | 3300006931 | Bacteria | 7141 |
| 246 | Ga0097620_100086694 | 3300006931 | Bacteria | 3178 |
| 247 | Ga0097620_100446771 | 3300006931 | Bacteria | 1389 |
| 248 | Ga0105240_10000106 | 3300009093 | Bacteria | 171825 |
| 249 | Ga0105240_10000606 | 3300009093 | Bacteria | 66467 |
| 250 | Ga0105240_10002298 | 3300009093 | Bacteria | 30947 |
| 251 | Ga0105240_10003660 | 3300009093 | Bacteria | 23789 |
| 252 | Ga0105240_10006503 | 3300009093 | Bacteria | 17166 |
| 253 | Ga0105240_10062121 | 3300009093 | Bacteria | 4652 |
| 254 | Ga0105240_10067774 | 3300009093 | Bacteria | 4423 |
| 255 | Ga0105240_10085981 | 3300009093 | Bacteria | 3852 |
| 256 | Ga0105240_10363012 | 3300009093 | Bacteria | 1640 |
| 257 | Ga0111539_10000601 | 3300009094 | Bacteria | 46564 |
| 258 | Ga0111539_10033061 | 3300009094 | Bacteria | 6280 |
| 259 | Ga0111539_10077796 | 3300009094 | Bacteria | 3904 |
| 260 | Ga0111539_10157727 | 3300009094 | Bacteria | 2655 |
| 261 | Ga0111539_10571069 | 3300009094 | Unclassified | 1317 |
| 262 | Ga0111539_10632485 | 3300009094 | Bacteria | 1246 |
| 263 | Ga0105247_10001391 | 3300009101 | Bacteria | 17555 |
| 264 | Ga0114129_10004956 | 3300009147 | Bacteria | 18775 |
| 265 | Ga0114129_10007484 | 3300009147 | Bacteria | 15553 |
| 266 | Ga0114129_10039792 | 3300009147 | Bacteria | 6631 |
| 267 | Ga0114129_10138808 | 3300009147 | Bacteria | 3334 |
| 268 | Ga0105243_10120919 | 3300009148 | Bacteria | 2207 |
| 269 | Ga0105241_10004142 | 3300009174 | Bacteria | 10702 |
| 270 | Ga0105241_10033823 | 3300009174 | Bacteria | 3839 |
| 271 | Ga0105241_10034973 | 3300009174 | Bacteria | 3778 |
| 272 | Ga0105241_10169024 | 3300009174 | Bacteria | 1804 |
| 273 | Ga0105242_10078638 | 3300009176 | Bacteria | 2753 |
| 274 | Ga0105242_10084012 | 3300009176 | Bacteria | 2667 |
| 275 | Ga0105237_10003013 | 3300009545 | Bacteria | 20323 |
| 276 | Ga0105237_10014210 | 3300009545 | Bacteria | 8336 |
| 277 | Ga0105237_10016066 | 3300009545 | Bacteria | 7784 |
| 278 | Ga0105237_10036411 | 3300009545 | Bacteria | 4980 |
| 279 | Ga0105237_10137911 | 3300009545 | Bacteria | 2434 |
| 280 | Ga0105237_10186331 | 3300009545 | Bacteria | 2075 |
| 281 | Ga0105238_10002205 | 3300009551 | Bacteria | 19643 |
| 282 | Ga0105238_10080747 | 3300009551 | Bacteria | 3241 |
| 283 | Ga0105249_10000635 | 3300009553 | Bacteria | 32011 |
| 284 | Ga0105249_10001404 | 3300009553 | Bacteria | 21086 |
| 285 | Ga0105249_10044696 | 3300009553 | Bacteria | 4027 |
| 286 | Ga0105249_10054284 | 3300009553 | Unclassified | 3664 |
| 287 | Ga0105249_10144835 | 3300009553 | Bacteria | 2281 |
| 288 | Ga0105249_10175047 | 3300009553 | Bacteria | 2084 |
| 289 | Ga0105249_10455591 | 3300009553 | Bacteria | 1318 |
| 290 | Ga0105239_10000404 | 3300010375 | Bacteria | 63332 |
| 291 | Ga0105239_10006097 | 3300010375 | Bacteria | 14036 |
| 292 | Ga0105239_10006227 | 3300010375 | Bacteria | 13883 |
| 293 | Ga0105239_10015063 | 3300010375 | Bacteria | 8572 |
| 294 | Ga0105239_10205164 | 3300010375 | Bacteria | 2209 |
| 295 | Ga0105239_10347541 | 3300010375 | Bacteria | 1674 |
| 296 | Ga0105246_10024851 | 3300011119 | Bacteria | 3899 |
| 297 | Ga0105246_10039983 | 3300011119 | Bacteria | 3162 |
| 298 | Ga0157373_10002753 | 3300013100 | Bacteria | 13315 |
| 299 | Ga0157373_10026532 | 3300013100 | Bacteria | 4183 |
| 300 | Ga0157371_10000009 | 3300013102 | Bacteria | 392895 |
| 301 | Ga0157371_10000518 | 3300013102 | Bacteria | 46197 |
| 302 | Ga0157371_10002698 | 3300013102 | Bacteria | 16766 |
| 303 | Ga0157371_10004536 | 3300013102 | Bacteria | 12096 |
| 304 | Ga0157371_10012494 | 3300013102 | Bacteria | 6489 |
| 305 | Ga0157371_10036915 | 3300013102 | Bacteria | 3500 |
| 306 | Ga0157371_10203478 | 3300013102 | Bacteria | 1420 |
| 307 | Ga0157370_10000408 | 3300013104 | Bacteria | 54355 |
| 308 | Ga0157370_10016291 | 3300013104 | Bacteria | 7532 |
| 309 | Ga0157370_10018111 | 3300013104 | Bacteria | 7090 |
| 310 | Ga0157370_10055556 | 3300013104 | Bacteria | 3771 |
| 311 | Ga0157370_10061782 | 3300013104 | Bacteria | 3555 |
| 312 | Ga0157370_10070626 | 3300013104 | Bacteria | 3296 |
| 313 | Ga0157370_10087246 | 3300013104 | Bacteria | 2931 |
| 314 | Ga0157370_10434281 | 3300013104 | Bacteria | 1207 |
| 315 | Ga0157369_10000006 | 3300013105 | Bacteria | 412230 |
| 316 | Ga0157369_10075403 | 3300013105 | Bacteria | 3617 |
| 317 | Ga0157369_10182337 | 3300013105 | Unclassified | 2209 |
| 318 | Ga0157369_10252579 | 3300013105 | Bacteria | 1840 |
| 319 | Ga0157374_10000027 | 3300013296 | Bacteria | 233444 |
| 320 | Ga0157374_10000587 | 3300013296 | Bacteria | 32144 |
| 321 | Ga0157374_10000745 | 3300013296 | Bacteria | 28347 |
| 322 | Ga0157374_10028707 | 3300013296 | Bacteria | 5028 |
| 323 | Ga0157374_10062246 | 3300013296 | Bacteria | 3497 |
| 324 | Ga0157374_10125984 | 3300013296 | Bacteria | 2476 |
| 325 | Ga0157374_10184131 | 3300013296 | Bacteria | 2041 |
| 326 | Ga0157378_10015554 | 3300013297 | Bacteria | 6664 |
| 327 | Ga0157378_10035720 | 3300013297 | Bacteria | 4397 |
| 328 | Ga0157378_10150092 | 3300013297 | Bacteria | 2171 |
| 329 | Ga0157378_10330464 | 3300013297 | Unclassified | 1483 |
| 330 | Ga0163162_10000177 | 3300013306 | Bacteria | 58576 |
| 331 | Ga0163162_10002271 | 3300013306 | Bacteria | 18040 |
| 332 | Ga0163162_10002571 | 3300013306 | Bacteria | 17169 |
| 333 | Ga0163162_10002830 | 3300013306 | Bacteria | 16503 |
| 334 | Ga0163162_10010645 | 3300013306 | Bacteria | 8945 |
| 335 | Ga0163162_10023096 | 3300013306 | Bacteria | 6135 |
| 336 | Ga0163162_10068630 | 3300013306 | Bacteria | 3597 |
| 337 | Ga0163162_10077356 | 3300013306 | Bacteria | 3390 |
| 338 | Ga0163162_10138178 | 3300013306 | Bacteria | 2548 |
| 339 | Ga0163162_10172929 | 3300013306 | Bacteria | 2285 |
| 340 | Ga0163162_10201986 | 3300013306 | Bacteria | 2116 |
| 341 | Ga0163162_10434663 | 3300013306 | Archaea | 1445 |
| 342 | Ga0157372_10002627 | 3300013307 | Bacteria | 19456 |
| 343 | Ga0157372_10018986 | 3300013307 | Bacteria | 7399 |
| 344 | Ga0157372_10022449 | 3300013307 | Bacteria | 6830 |
| 345 | Ga0157372_10026460 | 3300013307 | Bacteria | 6312 |
| 346 | Ga0157372_10029218 | 3300013307 | Bacteria | 6018 |
| 347 | Ga0157372_10052938 | 3300013307 | Bacteria | 4522 |
| 348 | Ga0157372_10078140 | 3300013307 | Bacteria | 3739 |
| 349 | Ga0157372_10080014 | 3300013307 | Bacteria | 3697 |
| 350 | Ga0157372_10117112 | 3300013307 | Bacteria | 3055 |
| 351 | Ga0157372_10190194 | 3300013307 | Bacteria | 2377 |
| 352 | Ga0157372_10197822 | 3300013307 | Bacteria | 2328 |
| 353 | Ga0157375_10000067 | 3300013308 | Bacteria | 110313 |
| 354 | Ga0157375_10011638 | 3300013308 | Bacteria | 7774 |
| 355 | Ga0157375_10085934 | 3300013308 | Bacteria | 3196 |
| 356 | Ga0163163_10000432 | 3300014325 | Bacteria | 38603 |
| 357 | Ga0163163_10014374 | 3300014325 | Bacteria | 7277 |
| 358 | Ga0163163_10040694 | 3300014325 | Bacteria | 4540 |
| 359 | Ga0163163_10107022 | 3300014325 | Bacteria | 2823 |
| 360 | Ga0163163_10128193 | 3300014325 | Bacteria | 2576 |
| 361 | Ga0163163_10172155 | 3300014325 | Bacteria | 2212 |
| 362 | Ga0157380_10028507 | 3300014326 | Bacteria | 4257 |
| 363 | Ga0157380_10050708 | 3300014326 | Bacteria | 3279 |
| 364 | Ga0157380_10069798 | 3300014326 | Bacteria | 2837 |
| 365 | Ga0157380_10102592 | 3300014326 | Bacteria | 2385 |
| 366 | Ga0157380_10370164 | 3300014326 | Bacteria | 1348 |
| 367 | Ga0157379_10008380 | 3300014968 | Bacteria | 8984 |
| 368 | Ga0157379_10028680 | 3300014968 | Bacteria | 4950 |
| 369 | Ga0157379_10059561 | 3300014968 | Bacteria | 3414 |
| 370 | Ga0157376_10000341 | 3300014969 | Bacteria | 31058 |
| 371 | Ga0157376_10115471 | 3300014969 | Bacteria | 2370 |
| 372 | Ga0157376_10154924 | 3300014969 | Bacteria | 2070 |
| 373 | Ga0157376_10213854 | 3300014969 | Bacteria | 1782 |
| 374 | Ga0157376_10419471 | 3300014969 | Bacteria | 1298 |
| 375 | Ga0182006_1000322 | 3300015261 | Bacteria | 41718 |
| 376 | Ga0182006_1000622 | 3300015261 | Bacteria | 25427 |
| 377 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 378 | Ga0182005_1000097 | 3300015265 | Bacteria | 66720 |
| 379 | Ga0183373_1006 | 3300015682 | Bacteria | 328276 |
| 380 | Ga0163161_10001724 | 3300017792 | Bacteria | 16022 |
| 381 | Ga0163161_10002308 | 3300017792 | Bacteria | 13670 |
| 382 | Ga0163161_10059225 | 3300017792 | Bacteria | 2784 |
| 383 | Ga0163161_10060984 | 3300017792 | Bacteria | 2746 |
| 384 | Ga0163161_10072665 | 3300017792 | Bacteria | 2519 |
| 385 | Ga0163161_10267700 | 3300017792 | Bacteria | 1336 |
| 386 | Ga0213876_10001574 | 3300021384 | Bacteria | 14029 |
| 387 | Ga0209436_100324 | 3300025208 | Bacteria | 21828 |
| 388 | Ga0209436_114708 | 3300025208 | Bacteria | 1237 |
| 389 | Ga0209258_100302 | 3300025242 | Bacteria | 79794 |
| 390 | Ga0209258_108334 | 3300025242 | Bacteria | 1464 |
| 391 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 392 | Ga0209148_1000131 | 3300025254 | Bacteria | 174079 |
| 393 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 394 | Ga0209673_1000203 | 3300025273 | Bacteria | 119623 |
| 395 | Ga0209130_1001297 | 3300025284 | Bacteria | 17208 |
| 396 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 397 | Ga0209025_1000025 | 3300025294 | Bacteria | 524454 |
| 398 | Ga0209564_1022859 | 3300025295 | Bacteria | 2192 |
| 399 | Ga0209564_1022867 | 3300025295 | Bacteria | 2192 |
| 400 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 401 | Ga0209050_1000016 | 3300025298 | Bacteria | 729149 |
| 402 | Ga0209050_1000888 | 3300025298 | Bacteria | 39848 |
| 403 | Ga0209050_1037458 | 3300025298 | Bacteria | 1398 |
| 404 | Ga0207426_1000024 | 3300025302 | Bacteria | 534075 |
| 405 | Ga0207426_1000806 | 3300025302 | Bacteria | 33910 |
| 406 | Ga0207426_1017306 | 3300025302 | Bacteria | 2565 |
| 407 | Ga0209257_1000070 | 3300025304 | Bacteria | 336454 |
| 408 | Ga0209257_1002474 | 3300025304 | Bacteria | 18274 |
| 409 | Ga0207697_10028263 | 3300025315 | Unclassified | 2294 |
| 410 | Ga0207697_10051444 | 3300025315 | Bacteria | 1702 |
| 411 | Ga0207682_10107132 | 3300025893 | Bacteria | 1227 |
| 412 | Ga0207710_10000673 | 3300025900 | Bacteria | 19242 |
| 413 | Ga0207710_10102145 | 3300025900 | Bacteria | 1353 |
| 414 | Ga0207688_10002217 | 3300025901 | Bacteria | 10462 |
| 415 | Ga0207680_10036735 | 3300025903 | Bacteria | 2823 |
| 416 | Ga0207680_10043288 | 3300025903 | Bacteria | 2640 |
| 417 | Ga0207680_10190488 | 3300025903 | Bacteria | 1392 |
| 418 | Ga0207647_10000210 | 3300025904 | Bacteria | 47384 |
| 419 | Ga0207647_10006574 | 3300025904 | Bacteria | 8445 |
| 420 | Ga0207647_10044652 | 3300025904 | Bacteria | 2767 |
| 421 | Ga0207685_10012593 | 3300025905 | Bacteria | 2586 |
| 422 | Ga0207645_10002084 | 3300025907 | Bacteria | 16005 |
| 423 | Ga0207645_10012266 | 3300025907 | Bacteria | 5821 |
| 424 | Ga0207645_10077695 | 3300025907 | Bacteria | 2127 |
| 425 | Ga0207645_10142380 | 3300025907 | Bacteria | 1563 |
| 426 | Ga0207645_10155718 | 3300025907 | Bacteria | 1493 |
| 427 | Ga0207643_10106547 | 3300025908 | Bacteria | 1648 |
| 428 | Ga0207643_10179534 | 3300025908 | Unclassified | 1280 |
| 429 | Ga0207654_10017862 | 3300025911 | Bacteria | 3716 |
| 430 | Ga0207654_10062096 | 3300025911 | Bacteria | 2188 |
| 431 | Ga0207707_10096103 | 3300025912 | Unclassified | 2589 |
| 432 | Ga0207707_10285942 | 3300025912 | Unclassified | 1427 |
| 433 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 434 | Ga0207695_10000685 | 3300025913 | Bacteria | 66448 |
| 435 | Ga0207695_10000917 | 3300025913 | Bacteria | 52754 |
| 436 | Ga0207695_10001873 | 3300025913 | Bacteria | 32931 |
| 437 | Ga0207695_10028845 | 3300025913 | Bacteria | 6143 |
| 438 | Ga0207695_10038240 | 3300025913 | Bacteria | 5169 |
| 439 | Ga0207695_10118885 | 3300025913 | Bacteria | 2613 |
| 440 | Ga0207671_10000637 | 3300025914 | Bacteria | 45954 |
| 441 | Ga0207671_10004496 | 3300025914 | Bacteria | 13275 |
| 442 | Ga0207671_10011235 | 3300025914 | Bacteria | 7305 |
| 443 | Ga0207671_10051595 | 3300025914 | Bacteria | 3048 |
| 444 | Ga0207671_10053268 | 3300025914 | Bacteria | 2998 |
| 445 | Ga0207660_10021719 | 3300025917 | Bacteria | 4319 |
| 446 | Ga0207662_10064031 | 3300025918 | Bacteria | 2211 |
| 447 | Ga0207657_10004066 | 3300025919 | Bacteria | 15521 |
| 448 | Ga0207657_10105987 | 3300025919 | Bacteria | 2326 |
| 449 | Ga0207649_10000567 | 3300025920 | Bacteria | 25427 |
| 450 | Ga0207649_10007810 | 3300025920 | Bacteria | 5820 |
| 451 | Ga0207649_10021250 | 3300025920 | Bacteria | 3733 |
| 452 | Ga0207652_10000771 | 3300025921 | Bacteria | 30684 |
| 453 | Ga0207652_10007027 | 3300025921 | Bacteria | 9072 |
| 454 | Ga0207681_10010977 | 3300025923 | Bacteria | 5563 |
| 455 | Ga0207681_10034340 | 3300025923 | Bacteria | 3334 |
| 456 | Ga0207681_10034444 | 3300025923 | Bacteria | 3330 |
| 457 | Ga0207681_10119055 | 3300025923 | Bacteria | 1934 |
| 458 | Ga0207681_10282478 | 3300025923 | Bacteria | 1307 |
| 459 | Ga0207694_10004594 | 3300025924 | Bacteria | 10748 |
| 460 | Ga0207694_10016687 | 3300025924 | Bacteria | 5550 |
| 461 | Ga0207650_10001513 | 3300025925 | Bacteria | 16609 |
| 462 | Ga0207650_10061492 | 3300025925 | Bacteria | 2804 |
| 463 | Ga0207650_10232685 | 3300025925 | Bacteria | 1487 |
| 464 | Ga0207650_10273390 | 3300025925 | Bacteria | 1374 |
| 465 | Ga0207659_10032388 | 3300025926 | Bacteria | 3587 |
| 466 | Ga0207659_10049585 | 3300025926 | Bacteria | 2979 |
| 467 | Ga0207659_10065881 | 3300025926 | Bacteria | 2627 |
| 468 | Ga0207687_10123453 | 3300025927 | Bacteria | 1940 |
| 469 | Ga0207644_10131582 | 3300025931 | Unclassified | 1916 |
| 470 | Ga0207644_10157076 | 3300025931 | Bacteria | 1765 |
| 471 | Ga0207644_10384966 | 3300025931 | Bacteria | 1144 |
| 472 | Ga0207690_10003267 | 3300025932 | Bacteria | 9722 |
| 473 | Ga0207690_10010426 | 3300025932 | Bacteria | 5522 |
| 474 | Ga0207690_10087329 | 3300025932 | Bacteria | 2194 |
| 475 | Ga0207690_10276472 | 3300025932 | Bacteria | 1306 |
| 476 | Ga0207706_10003474 | 3300025933 | Bacteria | 15037 |
| 477 | Ga0207706_10010648 | 3300025933 | Bacteria | 8399 |
| 478 | Ga0207706_10012403 | 3300025933 | Bacteria | 7765 |
| 479 | Ga0207706_10017700 | 3300025933 | Bacteria | 6420 |
| 480 | Ga0207706_10052797 | 3300025933 | Bacteria | 3588 |
| 481 | Ga0207670_10039676 | 3300025936 | Bacteria | 3085 |
| 482 | Ga0207670_10042328 | 3300025936 | Bacteria | 3001 |
| 483 | Ga0207669_10023300 | 3300025937 | Bacteria | 3305 |
| 484 | Ga0207669_10024850 | 3300025937 | Bacteria | 3227 |
| 485 | Ga0207704_10006232 | 3300025938 | Bacteria | 5547 |
| 486 | Ga0207704_10009596 | 3300025938 | Bacteria | 4677 |
| 487 | Ga0207704_10112509 | 3300025938 | Bacteria | 1844 |
| 488 | Ga0207704_10194021 | 3300025938 | Unclassified | 1480 |
| 489 | Ga0207691_10063280 | 3300025940 | Bacteria | 3355 |
| 490 | Ga0207689_10000843 | 3300025942 | Bacteria | 29516 |
| 491 | Ga0207689_10007268 | 3300025942 | Bacteria | 9723 |
| 492 | Ga0207689_10008486 | 3300025942 | Bacteria | 8952 |
| 493 | Ga0207689_10031074 | 3300025942 | Bacteria | 4448 |
| 494 | Ga0207689_10043750 | 3300025942 | Bacteria | 3701 |
| 495 | Ga0207689_10058060 | 3300025942 | Bacteria | 3183 |
| 496 | Ga0207689_10065028 | 3300025942 | Bacteria | 3000 |
| 497 | Ga0207689_10201162 | 3300025942 | Bacteria | 1644 |
| 498 | Ga0207661_10000411 | 3300025944 | Bacteria | 27626 |
| 499 | Ga0207661_10007500 | 3300025944 | Bacteria | 7759 |
| 500 | Ga0207661_10045221 | 3300025944 | Bacteria | 3484 |
| 501 | Ga0207679_10000297 | 3300025945 | Bacteria | 37427 |
| 502 | Ga0207679_10000800 | 3300025945 | Bacteria | 20460 |
| 503 | Ga0207679_10069473 | 3300025945 | Bacteria | 2651 |
| 504 | Ga0207667_10000172 | 3300025949 | Bacteria | 95455 |
| 505 | Ga0207667_10008374 | 3300025949 | Bacteria | 12289 |
| 506 | Ga0207667_10031326 | 3300025949 | Bacteria | 5742 |
| 507 | Ga0207667_10055066 | 3300025949 | Bacteria | 4182 |
| 508 | Ga0207667_10602907 | 3300025949 | Bacteria | 1107 |
| 509 | Ga0207667_10638672 | 3300025949 | Bacteria | 1071 |
| 510 | Ga0207651_10009901 | 3300025960 | Bacteria | 5248 |
| 511 | Ga0207651_10017040 | 3300025960 | Bacteria | 4279 |
| 512 | Ga0207651_10020151 | 3300025960 | Bacteria | 4018 |
| 513 | Ga0207651_10027456 | 3300025960 | Bacteria | 3575 |
| 514 | Ga0207651_10098862 | 3300025960 | Bacteria | 2159 |
| 515 | Ga0207651_10317908 | 3300025960 | Bacteria | 1300 |
| 516 | Ga0207712_10001470 | 3300025961 | Bacteria | 16071 |
| 517 | Ga0207712_10002610 | 3300025961 | Bacteria | 11559 |
| 518 | Ga0207712_10017162 | 3300025961 | Bacteria | 4697 |
| 519 | Ga0207712_10315442 | 3300025961 | Unclassified | 1288 |
| 520 | Ga0207668_10130649 | 3300025972 | Bacteria | 1917 |
| 521 | Ga0207668_10330547 | 3300025972 | Unclassified | 1268 |
| 522 | Ga0207640_10035190 | 3300025981 | Bacteria | 3132 |
| 523 | Ga0207640_10197708 | 3300025981 | Bacteria | 1521 |
| 524 | Ga0207640_10201479 | 3300025981 | Unclassified | 1509 |
| 525 | Ga0207658_10192703 | 3300025986 | Unclassified | 1696 |
| 526 | Ga0207677_10000816 | 3300026023 | Bacteria | 17807 |
| 527 | Ga0207677_10039609 | 3300026023 | Bacteria | 3101 |
| 528 | Ga0207677_10103563 | 3300026023 | Unclassified | 2101 |
| 529 | Ga0207677_10174711 | 3300026023 | Archaea | 1684 |
| 530 | Ga0207703_10027443 | 3300026035 | Bacteria | 4485 |
| 531 | Ga0207703_10222294 | 3300026035 | Bacteria | 1689 |
| 532 | Ga0207703_10335913 | 3300026035 | Bacteria | 1387 |
| 533 | Ga0207639_10001395 | 3300026041 | Bacteria | 16309 |
| 534 | Ga0207639_10002886 | 3300026041 | Bacteria | 11551 |
| 535 | Ga0207639_10055557 | 3300026041 | Bacteria | 3031 |
| 536 | Ga0207639_10074264 | 3300026041 | Unclassified | 2669 |
| 537 | Ga0207678_10033889 | 3300026067 | Unclassified | 4448 |
| 538 | Ga0207708_10020703 | 3300026075 | Bacteria | 4961 |
| 539 | Ga0207708_10231220 | 3300026075 | Bacteria | 1484 |
| 540 | Ga0207702_10085938 | 3300026078 | Unclassified | 2742 |
| 541 | Ga0207702_10145534 | 3300026078 | Bacteria | 2150 |
| 542 | Ga0207702_10189987 | 3300026078 | Bacteria | 1897 |
| 543 | Ga0207641_10128901 | 3300026088 | Bacteria | 2269 |
| 544 | Ga0207648_10000384 | 3300026089 | Bacteria | 48937 |
| 545 | Ga0207648_10010983 | 3300026089 | Bacteria | 8553 |
| 546 | Ga0207648_10026353 | 3300026089 | Bacteria | 5167 |
| 547 | Ga0207648_10057208 | 3300026089 | Bacteria | 3402 |
| 548 | Ga0207648_10057945 | 3300026089 | Bacteria | 3379 |
| 549 | Ga0207648_10350676 | 3300026089 | Unclassified | 1330 |
| 550 | Ga0207676_10009634 | 3300026095 | Bacteria | 6874 |
| 551 | Ga0207676_10012634 | 3300026095 | Bacteria | 6058 |
| 552 | Ga0207676_10054242 | 3300026095 | Bacteria | 3141 |
| 553 | Ga0207676_10084359 | 3300026095 | Bacteria | 2590 |
| 554 | Ga0207676_10336798 | 3300026095 | Unclassified | 1390 |
| 555 | Ga0207674_10004626 | 3300026116 | Bacteria | 16516 |
| 556 | Ga0207674_10012404 | 3300026116 | Bacteria | 9527 |
| 557 | Ga0207674_10025239 | 3300026116 | Bacteria | 6342 |
| 558 | Ga0207674_10090545 | 3300026116 | Bacteria | 3050 |
| 559 | Ga0207674_10128342 | 3300026116 | Bacteria | 2500 |
| 560 | Ga0207674_10208408 | 3300026116 | Bacteria | 1904 |
| 561 | Ga0207674_10249965 | 3300026116 | Bacteria | 1720 |
| 562 | Ga0207674_10325876 | 3300026116 | Bacteria | 1486 |
| 563 | Ga0207674_10460949 | 3300026116 | Bacteria | 1228 |
| 564 | Ga0207675_100009007 | 3300026118 | Bacteria | 9365 |
| 565 | Ga0207675_100012296 | 3300026118 | Bacteria | 7996 |
| 566 | Ga0207675_100055186 | 3300026118 | Bacteria | 3706 |
| 567 | Ga0207675_100139269 | 3300026118 | Bacteria | 2304 |
| 568 | Ga0207683_10004211 | 3300026121 | Bacteria | 12434 |
| 569 | Ga0207683_10007595 | 3300026121 | Bacteria | 9286 |
| 570 | Ga0207698_10018321 | 3300026142 | Bacteria | 4769 |
| 571 | Ga0207698_10032497 | 3300026142 | Bacteria | 3781 |
| 572 | Ga0207698_10037614 | 3300026142 | Bacteria | 3566 |
| 573 | Ga0207698_10080910 | 3300026142 | Bacteria | 2619 |
| 574 | Ga0207698_10087442 | 3300026142 | Bacteria | 2538 |
| 575 | Ga0207698_10302729 | 3300026142 | Bacteria | 1489 |
| 576 | Ga0207428_10047103 | 3300027907 | Bacteria | 3463 |
| 577 | Ga0268266_10000048 | 3300028379 | Bacteria | 310336 |
| 578 | Ga0268265_10009060 | 3300028380 | Bacteria | 6731 |
| 579 | Ga0268265_10073620 | 3300028380 | Unclassified | 2669 |
| 580 | Ga0268265_10102517 | 3300028380 | Bacteria | 2315 |
| 581 | Ga0268265_10292943 | 3300028380 | Bacteria | 1462 |
| 582 | Ga0268264_10001761 | 3300028381 | Bacteria | 19835 |
| 583 | Ga0268264_10006470 | 3300028381 | Bacteria | 9862 |
| 584 | Ga0268264_10006760 | 3300028381 | Bacteria | 9638 |
| 585 | Ga0268264_10010034 | 3300028381 | Bacteria | 7841 |
| 586 | Ga0268264_10028275 | 3300028381 | Bacteria | 4585 |
| 587 | Ga0268264_10037291 | 3300028381 | Bacteria | 4007 |
| 588 | Ga0268264_10086516 | 3300028381 | Bacteria | 2693 |
| 589 | Ga0268264_10353553 | 3300028381 | Bacteria | 1399 |
| 590 | Ga0307517_10099816 | 3300028786 | Bacteria | 2298 |
| 591 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 592 | Ga0307515_10104701 | 3300028794 | Bacteria | 3377 |
| 593 | Ga0265338_10000651 | 3300028800 | Bacteria | 59980 |
| 594 | Ga0265324_10016585 | 3300029957 | Unclassified | 2686 |
| 595 | Ga0307511_10000002 | 3300030521 | Bacteria | 199923 |
| 596 | Ga0265327_10000024 | 3300031251 | Bacteria | 382499 |
| 597 | Ga0265327_10000611 | 3300031251 | Bacteria | 59062 |
| 598 | Ga0265327_10023609 | 3300031251 | Bacteria | 3639 |
| 599 | Ga0307513_10104373 | 3300031456 | Unclassified | 2848 |
| 600 | Ga0307513_10178269 | 3300031456 | Bacteria | 1992 |
| 601 | Ga0307513_10279393 | 3300031456 | Unclassified | 1448 |
| 602 | Ga0307408_100035930 | 3300031548 | Bacteria | 3480 |
| 603 | Ga0307408_100047911 | 3300031548 | Bacteria | 3063 |
| 604 | Ga0307516_10000159 | 3300031730 | Bacteria | 84553 |
| 605 | Ga0307405_10000010 | 3300031731 | Bacteria | 250978 |
| 606 | Ga0307405_10011620 | 3300031731 | Bacteria | 4626 |
| 607 | Ga0307413_10084608 | 3300031824 | Bacteria | 2045 |
| 608 | Ga0307413_10415306 | 3300031824 | Bacteria | 1058 |
| 609 | Ga0307410_10038701 | 3300031852 | Bacteria | 3126 |
| 610 | Ga0307410_10047385 | 3300031852 | Bacteria | 2872 |
| 611 | Ga0307406_10042856 | 3300031901 | Bacteria | 2828 |
| 612 | Ga0307407_10000042 | 3300031903 | Bacteria | 65025 |
| 613 | Ga0307407_10016140 | 3300031903 | Bacteria | 3711 |
| 614 | Ga0307412_10007998 | 3300031911 | Bacteria | 6029 |
| 615 | Ga0307412_10047391 | 3300031911 | Bacteria | 2823 |
| 616 | Ga0307416_100000019 | 3300032002 | Bacteria | 199706 |
| 617 | Ga0307416_100000227 | 3300032002 | Bacteria | 29912 |
| 618 | Ga0307414_10000306 | 3300032004 | Bacteria | 28470 |
| 619 | Ga0307414_10002825 | 3300032004 | Bacteria | 9156 |
| 620 | Ga0307414_10032781 | 3300032004 | Bacteria | 3425 |
| 621 | Ga0307414_10082052 | 3300032004 | Bacteria | 2363 |
| 622 | Ga0307414_10122685 | 3300032004 | Bacteria | 2001 |
| 623 | Ga0307411_10012364 | 3300032005 | Bacteria | 4656 |
| 624 | Ga0307411_10373447 | 3300032005 | Bacteria | 1170 |
| 625 | Ga0307415_100001349 | 3300032126 | Bacteria | 11675 |
| 626 | Ga0373923_0089517 | 3300035111 | Bacteria | 1344 |
| 627 | Ga0373957_0061332 | 3300035120 | Bacteria | 1457 |
| 628 | Ga0373943_0010590 | 3300035170 | Bacteria | 4136 |
| 629 | Ga0373955_0025009 | 3300035172 | Bacteria | 3061 |
| 630 | Ga0373924_0107162 | 3300035410 | Bacteria | 1205 |
| 631 | Ga0373935_0056690 | 3300035692 | Unclassified | 2499 |
| 632 | Ga0373933_0036103 | 3300035724 | Bacteria | 2891 |
| 633 | Ga0373947_0166463 | 3300035725 | Bacteria | 1428 |
| 634 | Ga0373937_0023277 | 3300036401 | Bacteria | 5576 |
| 635 | Ga0395899_0176928 | 3300037312 | Bacteria | 1500 |
| 636 | Ga0395900_0156079 | 3300037418 | Bacteria | 2331 |
| 637 | Ga0395900_0287650 | 3300037418 | Bacteria | 1633 |
| 638 | Ga0395898_0010318 | 3300037466 | Bacteria | 9772 |
| 639 | Ga0395898_0059676 | 3300037466 | Bacteria | 3710 |
| 640 | Ga0395898_0126493 | 3300037466 | Bacteria | 2448 |
| 641 | Ga0395905_0021187 | 3300037471 | Bacteria | 6152 |
| 642 | Ga0395905_0163871 | 3300037471 | Bacteria | 2089 |
| 643 | Ga0395901_0063597 | 3300038443 | Bacteria | 3840 |
| 644 | Ga0395901_0192630 | 3300038443 | Bacteria | 2138 |
| 645 | Ga0395901_0595718 | 3300038443 | Bacteria | 1115 |
| 646 | Ga0395901_0605526 | 3300038443 | Bacteria | 1104 |
| 647 | Ga0436365_1249677 | 3300039437 | Bacteria | 17339 |
| 648 | Ga0439436_0002706 | 3300041404 | Bacteria | 5349 |
| 649 | Ga0439461_0012376 | 3300041410 | Bacteria | 1596 |
| 650 | Ga0451793_1329962 | 3300041452 | Bacteria | 1090 |
| 651 | Ga0451804_1149675 | 3300041463 | Bacteria | 1178 |
| 652 | Ga0451843_0703108 | 3300041509 | Unclassified | 988 |
| 653 | Ga0439449_0002729 | 3300042007 | Bacteria | 6868 |
| 654 | Ga0439449_0024418 | 3300042007 | Bacteria | 2260 |
| 655 | Ga0439457_002111 | 3300042014 | Bacteria | 5781 |
| 656 | Ga0439462_0004635 | 3300042015 | Bacteria | 3362 |
| 657 | Ga0439462_0008387 | 3300042015 | Bacteria | 2604 |
| 658 | Ga0450923_000505 | 3300042125 | Bacteria | 4323 |
| 659 | Ga0451577_0006113 | 3300042876 | Bacteria | 12094 |
| 660 | Ga0451577_0123920 | 3300042876 | Bacteria | 2316 |
| 661 | Ga0451577_0345943 | 3300042876 | Unclassified | 1349 |
| 662 | Ga0466969_0000127 | 3300044656 | Bacteria | 41196 |
| 663 | Ga0466969_0061212 | 3300044656 | Unclassified | 1829 |
| 664 | Ga0466972_0000080 | 3300044658 | Bacteria | 89226 |
| 665 | Ga0453683_0259989 | 3300044673 | Bacteria | 1107 |
| 666 | Ga0466965_0102220 | 3300044683 | Bacteria | 1466 |
| 667 | Ga0466966_0000120 | 3300044684 | Bacteria | 49271 |
| 668 | Ga0466961_0064528 | 3300044693 | Bacteria | 2327 |
| 669 | Ga0466964_0041728 | 3300044706 | Bacteria | 1857 |
| 670 | Ga0453684_0108162 | 3300044712 | Bacteria | 3384 |
| 671 | Ga0453684_0147752 | 3300044712 | Bacteria | 2797 |
| 672 | Ga0466970_0136481 | 3300044765 | Bacteria | 1349 |
| 673 | Ga0466957_0000380 | 3300044842 | Bacteria | 21740 |
| 674 | Ga0466957_0010728 | 3300044842 | Bacteria | 5269 |
| 675 | Ga0466957_0022142 | 3300044842 | Bacteria | 3747 |
| 676 | Ga0466957_0105888 | 3300044842 | Bacteria | 1778 |
| 677 | Ga0466959_0000014 | 3300045049 | Bacteria | 150962 |
| 678 | Ga0466959_0024738 | 3300045049 | Bacteria | 4448 |
| 679 | Ga0451576_0544710 | 3300045051 | Bacteria | 1219 |
| 680 | Ga0495627_044497 | 3300046453 | Bacteria | 1355 |
| 681 | Ga0495592_0129451 | 3300046454 | Bacteria | 1767 |
| 682 | Ga0495638_0000040 | 3300046460 | Bacteria | 241883 |
| 683 | Ga0495638_0220178 | 3300046460 | Unclassified | 1061 |
| 684 | Ga0495653_0064121 | 3300046463 | Bacteria | 2769 |
| 685 | Ga0495650_0031064 | 3300046471 | Bacteria | 2409 |
| 686 | Ga0495580_0341116 | 3300046472 | Bacteria | 1016 |
| 687 | Ga0495664_0202465 | 3300046477 | Bacteria | 1203 |
| 688 | Ga0495606_0005804 | 3300046507 | Bacteria | 11654 |
| 689 | Ga0495610_0000035 | 3300046512 | Bacteria | 189683 |
| 690 | Ga0495610_0015914 | 3300046512 | Bacteria | 4350 |
| 691 | Ga0495628_0027888 | 3300046516 | Bacteria | 4591 |
| 692 | Ga0495630_0063686 | 3300046517 | Bacteria | 2770 |
| 693 | Ga0495587_0066048 | 3300046536 | Bacteria | 2111 |
| 694 | Ga0495621_0036727 | 3300046539 | Bacteria | 1702 |
| 695 | Ga0495633_0000125 | 3300046558 | Bacteria | 104459 |
| 696 | Ga0495633_0133656 | 3300046558 | Bacteria | 1148 |
| 697 | Ga0495668_0002554 | 3300046616 | Bacteria | 14799 |
| 698 | Ga0495634_0009802 | 3300046642 | Bacteria | 7051 |
| 699 | Ga0495611_0000354 | 3300046648 | Bacteria | 29975 |
| 700 | Ga0495611_0102676 | 3300046648 | Bacteria | 1329 |
| 701 | Ga0495635_0104075 | 3300046663 | Bacteria | 1940 |
| 702 | Ga0495658_0046740 | 3300046683 | Bacteria | 2435 |
| 703 | Ga0495636_0000060 | 3300047318 | Bacteria | 47278 |
| 704 | Ga0495672_0010446 | 3300047320 | Bacteria | 6613 |
| 705 | Ga0495672_0021009 | 3300047320 | Unclassified | 4265 |
| 706 | Ga0495672_0028859 | 3300047320 | Bacteria | 3503 |
| 707 | Ga0495680_0273032 | 3300047322 | Bacteria | 1193 |
| 708 | Ga0495687_000261 | 3300047443 | Bacteria | 71090 |
| 709 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 710 | Ga0495686_0007643 | 3300047472 | Bacteria | 8070 |
| 711 | Ga0495686_0056486 | 3300047472 | Bacteria | 2452 |
| 712 | Ga0496106_0348409 | 3300048909 | Unclassified | 1190 |
| 713 | Ga0496110_0055506 | 3300048913 | Bacteria | 3486 |
| 714 | Ga0496111_0098458 | 3300048914 | Bacteria | 2147 |
| 715 | Ga0496114_0094838 | 3300048917 | Bacteria | 2539 |
| 716 | Ga0496121_0000081 | 3300048924 | Bacteria | 229506 |
| 717 | Ga0496126_0042525 | 3300048929 | Bacteria | 4196 |
| 718 | Ga0501031_0143800 | 3300049568 | Bacteria | 1558 |
| 719 | Ga0501032_0004132 | 3300049569 | Bacteria | 11001 |
| 720 | Ga0501032_0086164 | 3300049569 | Bacteria | 2088 |
| 721 | Ga0501032_0148383 | 3300049569 | Bacteria | 1543 |
| 722 | Ga0501033_0017643 | 3300049570 | Bacteria | 5391 |
| 723 | Ga0501033_0113556 | 3300049570 | Bacteria | 1970 |
| 724 | Ga0501034_0007421 | 3300049571 | Bacteria | 11669 |
| 725 | Ga0501034_0213240 | 3300049571 | Bacteria | 1885 |
| 726 | Ga0501034_0241907 | 3300049571 | Bacteria | 1750 |
| 727 | Ga0501036_0034595 | 3300049572 | Bacteria | 4274 |
| 728 | Ga0501036_0124345 | 3300049572 | Bacteria | 2178 |
| 729 | Ga0501037_0031925 | 3300049573 | Bacteria | 3888 |
| 730 | Ga0501037_0033161 | 3300049573 | Bacteria | 3814 |
| 731 | Ga0501038_0017313 | 3300049574 | Bacteria | 6515 |
| 732 | Ga0501038_0030627 | 3300049574 | Bacteria | 4758 |
| 733 | Ga0501038_0104439 | 3300049574 | Bacteria | 2355 |
| 734 | Ga0501038_0161412 | 3300049574 | Bacteria | 1821 |
| 735 | Ga0501043_0003893 | 3300049579 | Bacteria | 12252 |
| 736 | Ga0501043_0030664 | 3300049579 | Bacteria | 4227 |
| 737 | Ga0501043_0068367 | 3300049579 | Unclassified | 2789 |
| 738 | Ga0501046_0089336 | 3300049580 | Bacteria | 2372 |
| 739 | Ga0501046_0220574 | 3300049580 | Bacteria | 1404 |
| 740 | Ga0501047_0013596 | 3300049581 | Bacteria | 7720 |
| 741 | Ga0501047_0082793 | 3300049581 | Bacteria | 3084 |
| 742 | Ga0501047_0169887 | 3300049581 | Bacteria | 2050 |
| 743 | Ga0501047_0348637 | 3300049581 | Bacteria | 1317 |
| 744 | Ga0501048_0006258 | 3300049582 | Bacteria | 9053 |
| 745 | Ga0501067_0036099 | 3300049583 | Bacteria | 2745 |
| 746 | Ga0501070_0078985 | 3300049586 | Bacteria | 2723 |
| 747 | Ga0501070_0082958 | 3300049586 | Bacteria | 2653 |
| 748 | Ga0501073_0006651 | 3300049589 | Bacteria | 8610 |
| 749 | Ga0501074_0002599 | 3300049590 | Bacteria | 12616 |
| 750 | Ga0501202_004033 | 3300049652 | Bacteria | 2552 |
| 751 | Ga0501207_003749 | 3300049654 | Bacteria | 2038 |
| 752 | Ga0501216_011083 | 3300049660 | Bacteria | 1460 |
| 753 | Ga0501217_000586 | 3300049661 | Bacteria | 6138 |
| 754 | Ga0501217_004764 | 3300049661 | Bacteria | 2803 |
| 755 | Ga0501222_001557 | 3300049662 | Bacteria | 3197 |
| 756 | Ga0501240_000977 | 3300049673 | Bacteria | 2632 |
| 757 | Ga0501243_007387 | 3300049675 | Bacteria | 1679 |
| 758 | Ga0501257_026722 | 3300049686 | Bacteria | 1379 |
| 759 | Ga0501219_000133 | 3300049703 | Bacteria | 13105 |
| 760 | Ga0501221_002892 | 3300049704 | Bacteria | 2829 |
| 761 | Ga0501225_0000505 | 3300049705 | Bacteria | 12150 |
| 762 | Ga0501225_0012912 | 3300049705 | Bacteria | 2342 |
| 763 | Ga0501225_0030894 | 3300049705 | Bacteria | 1474 |
| 764 | Ga0501079_0049322 | 3300049741 | Bacteria | 3249 |
| 765 | Ga0501080_0030856 | 3300049742 | Bacteria | 4994 |
| 766 | Ga0501083_0015427 | 3300049744 | Bacteria | 5350 |
| 767 | Ga0501083_0205002 | 3300049744 | Unclassified | 1286 |
| 768 | Ga0501241_003764 | 3300049758 | Bacteria | 2858 |
| 769 | Ga0501264_000116 | 3300049761 | Bacteria | 12192 |
| 770 | Ga0501035_0002433 | 3300049822 | Bacteria | 18202 |
| 771 | Ga0501035_0007289 | 3300049822 | Bacteria | 10349 |
| 772 | Ga0501035_0261765 | 3300049822 | Bacteria | 1466 |
| 773 | Ga0501044_0013650 | 3300049823 | Bacteria | 8779 |
| 774 | Ga0501044_0016689 | 3300049823 | Bacteria | 7884 |
| 775 | Ga0501044_0021227 | 3300049823 | Bacteria | 6932 |
| 776 | Ga0501044_0158829 | 3300049823 | Bacteria | 2239 |
| 777 | Ga0501044_0447847 | 3300049823 | Bacteria | 1198 |
| 778 | Ga0501044_0538019 | 3300049823 | Bacteria | 1066 |
| 779 | Ga0501045_0135871 | 3300049824 | Bacteria | 1828 |
| 780 | Ga0501284_00007 | 3300050005 | Bacteria | 147956 |
| 781 | nmdc:mga0k408_54752_c1 | 3300050493 | Bacteria | 2312 |
| 782 | nmdc:mga05p37_827_c1 | 3300050507 | Bacteria | 34726 |
| 783 | nmdc:mga09592_5573_c1 | 3300050508 | Bacteria | 10252 |
| 784 | nmdc:mga0qj67_115904_c1 | 3300050509 | Bacteria | 2165 |
| 785 | nmdc:mga0qj67_154999_c1 | 3300050509 | Bacteria | 1859 |
| 786 | nmdc:mga06r32_338867_c1 | 3300050510 | Bacteria | 1488 |
| 787 | nmdc:mga08y16_110978_c1 | 3300050511 | Bacteria | 2855 |
| 788 | nmdc:mga08y16_143375_c1 | 3300050511 | Bacteria | 2483 |
| 789 | nmdc:mga08y16_198399_c1 | 3300050511 | Bacteria | 2080 |
| 790 | nmdc:mga08y16_33793_c1 | 3300050511 | Bacteria | 5371 |
| 791 | nmdc:mga08y16_57703_c1 | 3300050511 | Bacteria | 4056 |
| 792 | Ga0495619_0207720 | 3300053085 | Bacteria | 1356 |
| 793 | Ga0500578_0000836 | 3300053086 | Bacteria | 35575 |
| 794 | Ga0500644_0000026 | 3300053088 | Bacteria | 93328 |
| 795 | Ga0500644_0002655 | 3300053088 | Bacteria | 4465 |
| 796 | Ga0500646_0013350 | 3300053090 | Bacteria | 2125 |
| 797 | Ga0500583_0000001 | 3300053092 | Bacteria | 241642 |
| 798 | Ga0500583_0002299 | 3300053092 | Bacteria | 5712 |
| 799 | Ga0500651_0079068 | 3300053093 | Bacteria | 2039 |
| 800 | Ga0500641_0004524 | 3300053096 | Bacteria | 4915 |
| 801 | Ga0500556_0003125 | 3300053104 | Bacteria | 4944 |
| 802 | Ga0500569_000047 | 3300053109 | Bacteria | 22066 |
| 803 | Ga0500607_046686 | 3300053121 | Bacteria | 2321 |
| 804 | Ga0500642_0001746 | 3300053130 | Bacteria | 6263 |
| 805 | Ga0500658_0003491 | 3300053134 | Bacteria | 5931 |
| 806 | Ga0500559_0002568 | 3300053136 | Bacteria | 9306 |
| 807 | Ga0500568_0000142 | 3300053139 | Bacteria | 64049 |
| 808 | Ga0500568_0003595 | 3300053139 | Bacteria | 8563 |
| 809 | Ga0500573_0093276 | 3300053140 | Bacteria | 1699 |
| 810 | Ga0500577_0006329 | 3300053142 | Bacteria | 3257 |
| 811 | Ga0500588_0008757 | 3300053146 | Bacteria | 2378 |
| 812 | Ga0500616_0002235 | 3300053153 | Bacteria | 16549 |
| 813 | Ga0500616_0008249 | 3300053153 | Bacteria | 6493 |
| 814 | Ga0500616_0015110 | 3300053153 | Bacteria | 4423 |
| 815 | Ga0500622_0000692 | 3300053156 | Bacteria | 29667 |
| 816 | Ga0500622_0005506 | 3300053156 | Bacteria | 7585 |
| 817 | Ga0500633_0000782 | 3300053160 | Bacteria | 5422 |
| 818 | Ga0500636_0005348 | 3300053177 | Bacteria | 7320 |
| 819 | Ga0500637_0027758 | 3300053178 | Bacteria | 3127 |
| 820 | Ga0500584_105703 | 3300053726 | Bacteria | 1149 |
| 821 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 822 | Ga0500645_056904 | 3300053730 | Bacteria | 1134 |
| 823 | Ga0501084_0041717 | 3300054114 | Bacteria | 3839 |
| 824 | Ga0500661_005321 | 3300055283 | Bacteria | 2407 |
| 825 | Ga0466962_0063789 | 3300061719 | Unclassified | 1759 |
| 826 | 2586207416 | 2585427687 | Bacteria | 5544917 |
| 827 | 2738725417 | 2738541278 | Bacteria | 9755573 |
| 828 | 2738854007 | 2738541302 | Bacteria | 5944758 |
| 829 | 2739588608 | 2739367651 | Bacteria | 6359826 |
| 830 | 2739615898 | 2739367656 | Bacteria | 5152243 |
| 831 | 2739644989 | 2739367663 | Bacteria | 5040914 |
| 832 | 2819548142 | 2818991437 | Bacteria | 5805520 |
| 833 | 2819574922 | 2818991442 | Bacteria | 8318214 |
| 834 | 2819676870 | 2818991460 | Bacteria | 7595395 |
| 835 | 2821141023 | 2821136567 | Bacteria | 8080116 |
| 836 | 2842723744 | 2842722452 | Bacteria | 6263924 |
| 837 | 2842910250 | 2842909656 | Bacteria | 6185908 |
| 838 | 2849284295 | 2849281842 | Bacteria | 6065644 |
| 839 | 2857628930 | 2857627736 | Bacteria | 5625397 |
| 840 | 2884637094 | 2884634485 | Bacteria | 3928637 |
| 841 | 2884796724 | 2884791551 | Bacteria | 8511252 |
| 842 | 2896086639 | 2896085136 | Bacteria | 6129793 |
| 843 | 2904445698 | 2904445276 | Bacteria | 5310396 |
| 844 | 2904471523 | 2904467357 | Bacteria | 8057758 |
| 845 | 2929177758 | 2929177148 | Bacteria | 7883697 |
| 846 | 2929240122 | 2929239360 | Bacteria | 7745570 |
| 847 | 2945980105 | 2945977869 | Bacteria | 7777518 |
| 848 | 2946000604 | 2945997725 | Bacteria | 6404843 |
| 849 | 2946014033 | 2946013367 | Bacteria | 7766675 |
| 850 | 2954017486 | 2954016120 | Bacteria | 6446024 |
| 851 | Ga0157380_10000018 | |||
| 852 | MRS1b_contig_4233568 | |||
| 853 | MRS1b_contig_448359 | |||
| 854 | MBSR1b_contig_1406278 | |||
| 855 | MBSR1b_contig_7589204 | |||
| 856 | JGI24744J21845_10003674 | |||
| 857 | JGI24751J29686_10000540 | |||
| 858 | JGI25152J39213_1000647 | |||
| 859 | JGI25150J39212_1000009 | |||
| 860 | JGI25151J46595_10000017 | |||
| 861 | JGI25153J46596_10000023 | |||
| 862 | JGI25153J46596_10023575 | |||
| 863 | rootH1_10004252 | |||
| 864 | rootH1_10013495 | |||
| 865 | rootH1_10013813 | |||
| 866 | rootH2_10019275 | |||
| 867 | rootH2_10039673 | |||
| 868 | rootH2_10075767 | |||
| 869 | rootH2_10135544 | |||
| 870 | rootH2_10166600 | |||
| 871 | rootH2_10213033 | |||
| 872 | rootH2_10232790 | |||
| 873 | rootL2_10000984 | |||
| 874 | rootL2_10001672 | |||
| 875 | rootL2_10023331 | |||
| 876 | rootL2_10041649 | |||
| 877 | rootL2_10062550 | |||
| 878 | rootL2_10082800 | |||
| 879 | rootH1_10003699 | |||
| 880 | rootH1_10011437 | |||
| 881 | rootH1_10044529 | |||
| 882 | rootH1_10064744 | |||
| 883 | rootH1_10175021 | |||
| 884 | rootH1_10311342 | |||
| 885 | JGI25160J50197_1001239 | |||
| 886 | Ga0055535_1003210 | |||
| 887 | Ga0055542_1004148 | |||
| 888 | Ga0055536_1000011 | |||
| 889 | Ga0055528_1001011 | |||
| 890 | Ga0055530_10000880 | |||
| 891 | Ga0055530_10002755 | |||
| 892 | Ga0055531_10000054 | |||
| 893 | Ga0055543_1014584 | |||
| 894 | Ga0065165_1000027 | |||
| 895 | Ga0065714_10004769 | |||
| 896 | Ga0065714_10073672 | |||
| 897 | Ga0065704_10101212 | |||
| 898 | Ga0065712_10072246 | |||
| 899 | Ga0065712_10080579 | |||
| 900 | Ga0065712_10084814 | |||
| 901 | Ga0065712_10109904 | |||
| 902 | Ga0065715_10113921 | |||
| 903 | Ga0070658_10051009 | |||
| 904 | Ga0070658_10121863 | |||
| 905 | Ga0070683_100000327 | |||
| 906 | Ga0070683_100015832 | |||
| 907 | Ga0070683_100047014 | |||
| 908 | Ga0070683_100069592 | |||
| 909 | Ga0070683_100160628 | |||
| 910 | Ga0070683_100192250 | |||
| 911 | Ga0070683_100208963 | |||
| 912 | Ga0070690_100006021 | |||
| 913 | Ga0070670_100002147 | |||
| 914 | Ga0070670_100026886 | |||
| 915 | Ga0070670_100088497 | |||
| 916 | Ga0070670_100193003 | |||
| 917 | Ga0070677_10105904 | |||
| 918 | Ga0068869_100004838 | |||
| 919 | Ga0068869_100007443 | |||
| 920 | Ga0068869_100009710 | |||
| 921 | Ga0068869_100033079 | |||
| 922 | Ga0068869_100135103 | |||
| 923 | Ga0070666_10010282 | |||
| 924 | Ga0070666_10015901 | |||
| 925 | Ga0070666_10057022 | |||
| 926 | Ga0070680_100030529 | |||
| 927 | Ga0070680_100039686 | |||
| 928 | Ga0070682_100036209 | |||
| 929 | Ga0068868_100001123 | |||
| 930 | Ga0068868_100009009 | |||
| 931 | Ga0068868_100155187 | |||
| 932 | Ga0068868_100237886 | |||
| 933 | Ga0070660_100000435 | |||
| 934 | Ga0070660_100243923 | |||
| 935 | Ga0070689_100013812 | |||
| 936 | Ga0070689_100014333 | |||
| 937 | Ga0070689_100014980 | |||
| 938 | Ga0070691_10087870 | |||
| 939 | Ga0070661_100003284 | |||
| 940 | Ga0070661_100011988 | |||
| 941 | Ga0070661_100120125 | |||
| 942 | Ga0070668_100165525 | |||
| 943 | Ga0070669_100006429 | |||
| 944 | Ga0070669_100014257 | |||
| 945 | Ga0070669_100024594 | |||
| 946 | Ga0070669_100038623 | |||
| 947 | Ga0070675_100055992 | |||
| 948 | Ga0070675_100117262 | |||
| 949 | Ga0070671_100053038 | |||
| 950 | Ga0070671_100144493 | |||
| 951 | Ga0070671_100268721 | |||
| 952 | Ga0070674_100020838 | |||
| 953 | Ga0070673_100040106 | |||
| 954 | Ga0070673_100042302 | |||
| 955 | Ga0070673_100118290 | |||
| 956 | Ga0070673_100149021 | |||
| 957 | Ga0070673_100293831 | |||
| 958 | Ga0070688_100084798 | |||
| 959 | Ga0070659_100008871 | |||
| 960 | Ga0070659_100009567 | |||
| 961 | Ga0070659_100019255 | |||
| 962 | Ga0070667_100018912 | |||
| 963 | Ga0070667_100050896 | |||
| 964 | Ga0070667_100222256 | |||
| 965 | Ga0070700_100035240 | |||
| 966 | Ga0070663_100209846 | |||
| 967 | Ga0070663_100428230 | |||
| 968 | Ga0070678_100011344 | |||
| 969 | Ga0070678_100119505 | |||
| 970 | Ga0070662_100000209 | |||
| 971 | Ga0070662_100046050 | |||
| 972 | Ga0070681_10012536 | |||
| 973 | Ga0070681_10051031 | |||
| 974 | Ga0070681_10102633 | |||
| 975 | Ga0068867_100003103 | |||
| 976 | Ga0068867_100039779 | |||
| 977 | Ga0068867_100257655 | |||
| 978 | Ga0068867_100274327 | |||
| 979 | Ga0070685_10004060 | |||
| 980 | Ga0070685_10123337 | |||
| 981 | Ga0070685_10262349 | |||
| 982 | Ga0070698_100000282 | |||
| 983 | Ga0070698_100002541 | |||
| 984 | Ga0070698_100006847 | |||
| 985 | Ga0070679_100094063 | |||
| 986 | Ga0070684_100000290 | |||
| 987 | Ga0070684_100001419 | |||
| 988 | Ga0070684_100080123 | |||
| 989 | Ga0070684_100094748 | |||
| 990 | Ga0068853_100009821 | |||
| 991 | Ga0068853_100010194 | |||
| 992 | Ga0068853_100029290 | |||
| 993 | Ga0068853_100041203 | |||
| 994 | Ga0068853_100087689 | |||
| 995 | Ga0068853_100417602 | |||
| 996 | Ga0070672_100008190 | |||
| 997 | Ga0070672_100079570 | |||
| 998 | Ga0070672_100147053 | |||
| 999 | Ga0070686_100042729 | |||
| 1000 | Ga0070686_100072943 | |||
| 1001 | Ga0070665_100000014 | |||
| 1002 | Ga0070665_100229319 | |||
| 1003 | Ga0068855_100000081 | |||
| 1004 | Ga0068855_100013609 | |||
| 1005 | Ga0068855_100023253 | |||
| 1006 | Ga0068855_100024021 | |||
| 1007 | Ga0068855_100059131 | |||
| 1008 | Ga0068855_100062546 | |||
| 1009 | Ga0068855_100198910 | |||
| 1010 | Ga0068855_100680977 | |||
| 1011 | Ga0070664_100000509 | |||
| 1012 | Ga0070664_100005422 | |||
| 1013 | Ga0070664_100008601 | |||
| 1014 | Ga0070664_100391241 | |||
| 1015 | Ga0068857_100000579 | |||
| 1016 | Ga0068857_100002654 | |||
| 1017 | Ga0068857_100008029 | |||
| 1018 | Ga0068857_100073334 | |||
| 1019 | Ga0068857_100160766 | |||
| 1020 | Ga0068857_100164503 | |||
| 1021 | Ga0068854_100032309 | |||
| 1022 | Ga0068854_100046669 | |||
| 1023 | Ga0068854_100071526 | |||
| 1024 | Ga0068854_100093732 | |||
| 1025 | Ga0068856_100024646 | |||
| 1026 | Ga0068856_100054252 | |||
| 1027 | Ga0068856_100067961 | |||
| 1028 | Ga0068856_100077785 | |||
| 1029 | Ga0068852_100014577 | |||
| 1030 | Ga0068852_100035186 | |||
| 1031 | Ga0068852_100075342 | |||
| 1032 | Ga0068852_100090210 | |||
| 1033 | Ga0068852_100197709 | |||
| 1034 | Ga0068852_100366226 | |||
| 1035 | Ga0068852_100368481 | |||
| 1036 | Ga0068859_100000289 | |||
| 1037 | Ga0068859_100017809 | |||
| 1038 | Ga0068859_100086698 | |||
| 1039 | Ga0068864_100002659 | |||
| 1040 | Ga0068864_100004779 | |||
| 1041 | Ga0068864_100043128 | |||
| 1042 | Ga0068864_100088090 | |||
| 1043 | Ga0068864_100127278 | |||
| 1044 | Ga0068864_100257686 | |||
| 1045 | Ga0068864_100303098 | |||
| 1046 | Ga0068864_100644796 | |||
| 1047 | Ga0068866_10014018 | |||
| 1048 | Ga0068866_10031820 | |||
| 1049 | Ga0068861_100001502 | |||
| 1050 | Ga0068861_100020793 | |||
| 1051 | Ga0068861_100049553 | |||
| 1052 | Ga0068861_100164123 | |||
| 1053 | Ga0068861_100462228 | |||
| 1054 | Ga0068851_10008435 | |||
| 1055 | Ga0068870_10002263 | |||
| 1056 | Ga0068870_10095513 | |||
| 1057 | Ga0068863_100026959 | |||
| 1058 | Ga0068863_100405149 | |||
| 1059 | Ga0068863_100481938 | |||
| 1060 | Ga0068858_100104708 | |||
| 1061 | Ga0068858_100119796 | |||
| 1062 | Ga0068858_100527839 | |||
| 1063 | Ga0068860_100008699 | |||
| 1064 | Ga0068860_100054588 | |||
| 1065 | Ga0068860_100343310 | |||
| 1066 | Ga0068862_100011939 | |||
| 1067 | Ga0068862_100027366 | |||
| 1068 | Ga0068862_100058506 | |||
| 1069 | Ga0068862_100132285 | |||
| 1070 | Ga0068862_100306494 | |||
| 1071 | Ga0075366_10096980 | |||
| 1072 | Ga0097621_100000036 | |||
| 1073 | Ga0097621_100070027 | |||
| 1074 | Ga0097621_100215805 | |||
| 1075 | Ga0097621_100225479 | |||
| 1076 | Ga0068871_100005055 | |||
| 1077 | Ga0068871_100033550 | |||
| 1078 | Ga0068871_100326025 | |||
| 1079 | Ga0068871_100343538 | |||
| 1080 | Ga0075428_100006607 | |||
| 1081 | Ga0075428_100093975 | |||
| 1082 | Ga0075428_100152663 | |||
| 1083 | Ga0075428_100294134 | |||
| 1084 | Ga0075430_100104237 | |||
| 1085 | Ga0075430_100175362 | |||
| 1086 | Ga0075431_100055523 | |||
| 1087 | Ga0075431_100110345 | |||
| 1088 | Ga0075431_100127855 | |||
| 1089 | Ga0075431_100147598 | |||
| 1090 | Ga0075429_100000136 | |||
| 1091 | Ga0075429_100001725 | |||
| 1092 | Ga0068865_100095874 | |||
| 1093 | Ga0097620_100000289 | |||
| 1094 | Ga0097620_100017809 | |||
| 1095 | Ga0097620_100086694 | |||
| 1096 | Ga0097620_100446771 | |||
| 1097 | Ga0105240_10000106 | |||
| 1098 | Ga0105240_10000606 | |||
| 1099 | Ga0105240_10002298 | |||
| 1100 | Ga0105240_10003660 | |||
| 1101 | Ga0105240_10006503 | |||
| 1102 | Ga0105240_10062121 | |||
| 1103 | Ga0105240_10067774 | |||
| 1104 | Ga0105240_10085981 | |||
| 1105 | Ga0105240_10363012 | |||
| 1106 | Ga0111539_10000601 | |||
| 1107 | Ga0111539_10033061 | |||
| 1108 | Ga0111539_10077796 | |||
| 1109 | Ga0111539_10157727 | |||
| 1110 | Ga0111539_10571069 | |||
| 1111 | Ga0111539_10632485 | |||
| 1112 | Ga0105247_10001391 | |||
| 1113 | Ga0114129_10004956 | |||
| 1114 | Ga0114129_10007484 | |||
| 1115 | Ga0114129_10039792 | |||
| 1116 | Ga0114129_10138808 | |||
| 1117 | Ga0105243_10120919 | |||
| 1118 | Ga0105241_10004142 | |||
| 1119 | Ga0105241_10033823 | |||
| 1120 | Ga0105241_10034973 | |||
| 1121 | Ga0105241_10169024 | |||
| 1122 | Ga0105242_10078638 | |||
| 1123 | Ga0105242_10084012 | |||
| 1124 | Ga0105237_10003013 | |||
| 1125 | Ga0105237_10014210 | |||
| 1126 | Ga0105237_10016066 | |||
| 1127 | Ga0105237_10036411 | |||
| 1128 | Ga0105237_10137911 | |||
| 1129 | Ga0105237_10186331 | |||
| 1130 | Ga0105238_10002205 | |||
| 1131 | Ga0105238_10080747 | |||
| 1132 | Ga0105249_10000635 | |||
| 1133 | Ga0105249_10001404 | |||
| 1134 | Ga0105249_10044696 | |||
| 1135 | Ga0105249_10054284 | |||
| 1136 | Ga0105249_10144835 | |||
| 1137 | Ga0105249_10175047 | |||
| 1138 | Ga0105249_10455591 | |||
| 1139 | Ga0105239_10000404 | |||
| 1140 | Ga0105239_10006097 | |||
| 1141 | Ga0105239_10006227 | |||
| 1142 | Ga0105239_10015063 | |||
| 1143 | Ga0105239_10205164 | |||
| 1144 | Ga0105239_10347541 | |||
| 1145 | Ga0105246_10024851 | |||
| 1146 | Ga0105246_10039983 | |||
| 1147 | Ga0157373_10002753 | |||
| 1148 | Ga0157373_10026532 | |||
| 1149 | Ga0157371_10000009 | |||
| 1150 | Ga0157371_10000518 | |||
| 1151 | Ga0157371_10002698 | |||
| 1152 | Ga0157371_10004536 | |||
| 1153 | Ga0157371_10012494 | |||
| 1154 | Ga0157371_10036915 | |||
| 1155 | Ga0157371_10203478 | |||
| 1156 | Ga0157370_10000408 | |||
| 1157 | Ga0157370_10016291 | |||
| 1158 | Ga0157370_10018111 | |||
| 1159 | Ga0157370_10055556 | |||
| 1160 | Ga0157370_10061782 | |||
| 1161 | Ga0157370_10070626 | |||
| 1162 | Ga0157370_10087246 | |||
| 1163 | Ga0157370_10434281 | |||
| 1164 | Ga0157369_10000006 | |||
| 1165 | Ga0157369_10075403 | |||
| 1166 | Ga0157369_10182337 | |||
| 1167 | Ga0157369_10252579 | |||
| 1168 | Ga0157374_10000027 | |||
| 1169 | Ga0157374_10000587 | |||
| 1170 | Ga0157374_10000745 | |||
| 1171 | Ga0157374_10028707 | |||
| 1172 | Ga0157374_10062246 | |||
| 1173 | Ga0157374_10125984 | |||
| 1174 | Ga0157374_10184131 | |||
| 1175 | Ga0157378_10015554 | |||
| 1176 | Ga0157378_10035720 | |||
| 1177 | Ga0157378_10150092 | |||
| 1178 | Ga0157378_10330464 | |||
| 1179 | Ga0163162_10000177 | |||
| 1180 | Ga0163162_10002271 | |||
| 1181 | Ga0163162_10002571 | |||
| 1182 | Ga0163162_10002830 | |||
| 1183 | Ga0163162_10010645 | |||
| 1184 | Ga0163162_10023096 | |||
| 1185 | Ga0163162_10068630 | |||
| 1186 | Ga0163162_10077356 | |||
| 1187 | Ga0163162_10138178 | |||
| 1188 | Ga0163162_10172929 | |||
| 1189 | Ga0163162_10201986 | |||
| 1190 | Ga0163162_10434663 | |||
| 1191 | Ga0157372_10002627 | |||
| 1192 | Ga0157372_10018986 | |||
| 1193 | Ga0157372_10022449 | |||
| 1194 | Ga0157372_10026460 | |||
| 1195 | Ga0157372_10029218 | |||
| 1196 | Ga0157372_10052938 | |||
| 1197 | Ga0157372_10078140 | |||
| 1198 | Ga0157372_10080014 | |||
| 1199 | Ga0157372_10117112 | |||
| 1200 | Ga0157372_10190194 | |||
| 1201 | Ga0157372_10197822 | |||
| 1202 | Ga0157375_10000067 | |||
| 1203 | Ga0157375_10011638 | |||
| 1204 | Ga0157375_10085934 | |||
| 1205 | Ga0163163_10000432 | |||
| 1206 | Ga0163163_10014374 | |||
| 1207 | Ga0163163_10040694 | |||
| 1208 | Ga0163163_10107022 | |||
| 1209 | Ga0163163_10128193 | |||
| 1210 | Ga0163163_10172155 | |||
| 1211 | Ga0157380_10028507 | |||
| 1212 | Ga0157380_10050708 | |||
| 1213 | Ga0157380_10069798 | |||
| 1214 | Ga0157380_10102592 | |||
| 1215 | Ga0157380_10370164 | |||
| 1216 | Ga0157379_10008380 | |||
| 1217 | Ga0157379_10028680 | |||
| 1218 | Ga0157379_10059561 | |||
| 1219 | Ga0157376_10000341 | |||
| 1220 | Ga0157376_10115471 | |||
| 1221 | Ga0157376_10154924 | |||
| 1222 | Ga0157376_10213854 | |||
| 1223 | Ga0157376_10419471 | |||
| 1224 | Ga0182006_1000322 | |||
| 1225 | Ga0182006_1000622 | |||
| 1226 | Ga0182007_10000001 | |||
| 1227 | Ga0182005_1000097 | |||
| 1228 | Ga0183373_1006 | |||
| 1229 | Ga0163161_10001724 | |||
| 1230 | Ga0163161_10002308 | |||
| 1231 | Ga0163161_10059225 | |||
| 1232 | Ga0163161_10060984 | |||
| 1233 | Ga0163161_10072665 | |||
| 1234 | Ga0163161_10267700 | |||
| 1235 | Ga0213876_10001574 | |||
| 1236 | Ga0209436_100324 | |||
| 1237 | Ga0209436_114708 | |||
| 1238 | Ga0209258_100302 | |||
| 1239 | Ga0209258_108334 | |||
| 1240 | Ga0207425_1000007 | |||
| 1241 | Ga0209148_1000131 | |||
| 1242 | Ga0209129_1000006 | |||
| 1243 | Ga0209673_1000203 | |||
| 1244 | Ga0209130_1001297 | |||
| 1245 | Ga0209676_1000001 | |||
| 1246 | Ga0209025_1000025 | |||
| 1247 | Ga0209564_1022859 | |||
| 1248 | Ga0209564_1022867 | |||
| 1249 | Ga0209758_1000016 | |||
| 1250 | Ga0209050_1000016 | |||
| 1251 | Ga0209050_1000888 | |||
| 1252 | Ga0209050_1037458 | |||
| 1253 | Ga0207426_1000024 | |||
| 1254 | Ga0207426_1000806 | |||
| 1255 | Ga0207426_1017306 | |||
| 1256 | Ga0209257_1000070 | |||
| 1257 | Ga0209257_1002474 | |||
| 1258 | Ga0207697_10028263 | |||
| 1259 | Ga0207697_10051444 | |||
| 1260 | Ga0207682_10107132 | |||
| 1261 | Ga0207710_10000673 | |||
| 1262 | Ga0207710_10102145 | |||
| 1263 | Ga0207688_10002217 | |||
| 1264 | Ga0207680_10036735 | |||
| 1265 | Ga0207680_10043288 | |||
| 1266 | Ga0207680_10190488 | |||
| 1267 | Ga0207647_10000210 | |||
| 1268 | Ga0207647_10006574 | |||
| 1269 | Ga0207647_10044652 | |||
| 1270 | Ga0207685_10012593 | |||
| 1271 | Ga0207645_10002084 | |||
| 1272 | Ga0207645_10012266 | |||
| 1273 | Ga0207645_10077695 | |||
| 1274 | Ga0207645_10142380 | |||
| 1275 | Ga0207645_10155718 | |||
| 1276 | Ga0207643_10106547 | |||
| 1277 | Ga0207643_10179534 | |||
| 1278 | Ga0207654_10017862 | |||
| 1279 | Ga0207654_10062096 | |||
| 1280 | Ga0207707_10096103 | |||
| 1281 | Ga0207707_10285942 | |||
| 1282 | Ga0207695_10000087 | |||
| 1283 | Ga0207695_10000685 | |||
| 1284 | Ga0207695_10000917 | |||
| 1285 | Ga0207695_10001873 | |||
| 1286 | Ga0207695_10028845 | |||
| 1287 | Ga0207695_10038240 | |||
| 1288 | Ga0207695_10118885 | |||
| 1289 | Ga0207671_10000637 | |||
| 1290 | Ga0207671_10004496 | |||
| 1291 | Ga0207671_10011235 | |||
| 1292 | Ga0207671_10051595 | |||
| 1293 | Ga0207671_10053268 | |||
| 1294 | Ga0207660_10021719 | |||
| 1295 | Ga0207662_10064031 | |||
| 1296 | Ga0207657_10004066 | |||
| 1297 | Ga0207657_10105987 | |||
| 1298 | Ga0207649_10000567 | |||
| 1299 | Ga0207649_10007810 | |||
| 1300 | Ga0207649_10021250 | |||
| 1301 | Ga0207652_10000771 | |||
| 1302 | Ga0207652_10007027 | |||
| 1303 | Ga0207681_10010977 | |||
| 1304 | Ga0207681_10034340 | |||
| 1305 | Ga0207681_10034444 | |||
| 1306 | Ga0207681_10119055 | |||
| 1307 | Ga0207681_10282478 | |||
| 1308 | Ga0207694_10004594 | |||
| 1309 | Ga0207694_10016687 | |||
| 1310 | Ga0207650_10001513 | |||
| 1311 | Ga0207650_10061492 | |||
| 1312 | Ga0207650_10232685 | |||
| 1313 | Ga0207650_10273390 | |||
| 1314 | Ga0207659_10032388 | |||
| 1315 | Ga0207659_10049585 | |||
| 1316 | Ga0207659_10065881 | |||
| 1317 | Ga0207687_10123453 | |||
| 1318 | Ga0207644_10131582 | |||
| 1319 | Ga0207644_10157076 | |||
| 1320 | Ga0207644_10384966 | |||
| 1321 | Ga0207690_10003267 | |||
| 1322 | Ga0207690_10010426 | |||
| 1323 | Ga0207690_10087329 | |||
| 1324 | Ga0207690_10276472 | |||
| 1325 | Ga0207706_10003474 | |||
| 1326 | Ga0207706_10010648 | |||
| 1327 | Ga0207706_10012403 | |||
| 1328 | Ga0207706_10017700 | |||
| 1329 | Ga0207706_10052797 | |||
| 1330 | Ga0207670_10039676 | |||
| 1331 | Ga0207670_10042328 | |||
| 1332 | Ga0207669_10023300 | |||
| 1333 | Ga0207669_10024850 | |||
| 1334 | Ga0207704_10006232 | |||
| 1335 | Ga0207704_10009596 | |||
| 1336 | Ga0207704_10112509 | |||
| 1337 | Ga0207704_10194021 | |||
| 1338 | Ga0207691_10063280 | |||
| 1339 | Ga0207689_10000843 | |||
| 1340 | Ga0207689_10007268 | |||
| 1341 | Ga0207689_10008486 | |||
| 1342 | Ga0207689_10031074 | |||
| 1343 | Ga0207689_10043750 | |||
| 1344 | Ga0207689_10058060 | |||
| 1345 | Ga0207689_10065028 | |||
| 1346 | Ga0207689_10201162 | |||
| 1347 | Ga0207661_10000411 | |||
| 1348 | Ga0207661_10007500 | |||
| 1349 | Ga0207661_10045221 | |||
| 1350 | Ga0207679_10000297 | |||
| 1351 | Ga0207679_10000800 | |||
| 1352 | Ga0207679_10069473 | |||
| 1353 | Ga0207667_10000172 | |||
| 1354 | Ga0207667_10008374 | |||
| 1355 | Ga0207667_10031326 | |||
| 1356 | Ga0207667_10055066 | |||
| 1357 | Ga0207667_10602907 | |||
| 1358 | Ga0207667_10638672 | |||
| 1359 | Ga0207651_10009901 | |||
| 1360 | Ga0207651_10017040 | |||
| 1361 | Ga0207651_10020151 | |||
| 1362 | Ga0207651_10027456 | |||
| 1363 | Ga0207651_10098862 | |||
| 1364 | Ga0207651_10317908 | |||
| 1365 | Ga0207712_10001470 | |||
| 1366 | Ga0207712_10002610 | |||
| 1367 | Ga0207712_10017162 | |||
| 1368 | Ga0207712_10315442 | |||
| 1369 | Ga0207668_10130649 | |||
| 1370 | Ga0207668_10330547 | |||
| 1371 | Ga0207640_10035190 | |||
| 1372 | Ga0207640_10197708 | |||
| 1373 | Ga0207640_10201479 | |||
| 1374 | Ga0207658_10192703 | |||
| 1375 | Ga0207677_10000816 | |||
| 1376 | Ga0207677_10039609 | |||
| 1377 | Ga0207677_10103563 | |||
| 1378 | Ga0207677_10174711 | |||
| 1379 | Ga0207703_10027443 | |||
| 1380 | Ga0207703_10222294 | |||
| 1381 | Ga0207703_10335913 | |||
| 1382 | Ga0207639_10001395 | |||
| 1383 | Ga0207639_10002886 | |||
| 1384 | Ga0207639_10055557 | |||
| 1385 | Ga0207639_10074264 | |||
| 1386 | Ga0207678_10033889 | |||
| 1387 | Ga0207708_10020703 | |||
| 1388 | Ga0207708_10231220 | |||
| 1389 | Ga0207702_10085938 | |||
| 1390 | Ga0207702_10145534 | |||
| 1391 | Ga0207702_10189987 | |||
| 1392 | Ga0207641_10128901 | |||
| 1393 | Ga0207648_10000384 | |||
| 1394 | Ga0207648_10010983 | |||
| 1395 | Ga0207648_10026353 | |||
| 1396 | Ga0207648_10057208 | |||
| 1397 | Ga0207648_10057945 | |||
| 1398 | Ga0207648_10350676 | |||
| 1399 | Ga0207676_10009634 | |||
| 1400 | Ga0207676_10012634 | |||
| 1401 | Ga0207676_10054242 | |||
| 1402 | Ga0207676_10084359 | |||
| 1403 | Ga0207676_10336798 | |||
| 1404 | Ga0207674_10004626 | |||
| 1405 | Ga0207674_10012404 | |||
| 1406 | Ga0207674_10025239 | |||
| 1407 | Ga0207674_10090545 | |||
| 1408 | Ga0207674_10128342 | |||
| 1409 | Ga0207674_10208408 | |||
| 1410 | Ga0207674_10249965 | |||
| 1411 | Ga0207674_10325876 | |||
| 1412 | Ga0207674_10460949 | |||
| 1413 | Ga0207675_100009007 | |||
| 1414 | Ga0207675_100012296 | |||
| 1415 | Ga0207675_100055186 | |||
| 1416 | Ga0207675_100139269 | |||
| 1417 | Ga0207683_10004211 | |||
| 1418 | Ga0207683_10007595 | |||
| 1419 | Ga0207698_10018321 | |||
| 1420 | Ga0207698_10032497 | |||
| 1421 | Ga0207698_10037614 | |||
| 1422 | Ga0207698_10080910 | |||
| 1423 | Ga0207698_10087442 | |||
| 1424 | Ga0207698_10302729 | |||
| 1425 | Ga0207428_10047103 | |||
| 1426 | Ga0268266_10000048 | |||
| 1427 | Ga0268265_10009060 | |||
| 1428 | Ga0268265_10073620 | |||
| 1429 | Ga0268265_10102517 | |||
| 1430 | Ga0268265_10292943 | |||
| 1431 | Ga0268264_10001761 | |||
| 1432 | Ga0268264_10006470 | |||
| 1433 | Ga0268264_10006760 | |||
| 1434 | Ga0268264_10010034 | |||
| 1435 | Ga0268264_10028275 | |||
| 1436 | Ga0268264_10037291 | |||
| 1437 | Ga0268264_10086516 | |||
| 1438 | Ga0268264_10353553 | |||
| 1439 | Ga0307517_10099816 | |||
| 1440 | Ga0307515_10000001 | |||
| 1441 | Ga0307515_10104701 | |||
| 1442 | Ga0265338_10000651 | |||
| 1443 | Ga0265324_10016585 | |||
| 1444 | Ga0307511_10000002 | |||
| 1445 | Ga0265327_10000024 | |||
| 1446 | Ga0265327_10000611 | |||
| 1447 | Ga0265327_10023609 | |||
| 1448 | Ga0307513_10104373 | |||
| 1449 | Ga0307513_10178269 | |||
| 1450 | Ga0307513_10279393 | |||
| 1451 | Ga0307408_100035930 | |||
| 1452 | Ga0307408_100047911 | |||
| 1453 | Ga0307516_10000159 | |||
| 1454 | Ga0307405_10000010 | |||
| 1455 | Ga0307405_10011620 | |||
| 1456 | Ga0307413_10084608 | |||
| 1457 | Ga0307413_10415306 | |||
| 1458 | Ga0307410_10038701 | |||
| 1459 | Ga0307410_10047385 | |||
| 1460 | Ga0307406_10042856 | |||
| 1461 | Ga0307407_10000042 | |||
| 1462 | Ga0307407_10016140 | |||
| 1463 | Ga0307412_10007998 | |||
| 1464 | Ga0307412_10047391 | |||
| 1465 | Ga0307416_100000019 | |||
| 1466 | Ga0307416_100000227 | |||
| 1467 | Ga0307414_10000306 | |||
| 1468 | Ga0307414_10002825 | |||
| 1469 | Ga0307414_10032781 | |||
| 1470 | Ga0307414_10082052 | |||
| 1471 | Ga0307414_10122685 | |||
| 1472 | Ga0307411_10012364 | |||
| 1473 | Ga0307411_10373447 | |||
| 1474 | Ga0307415_100001349 | |||
| 1475 | Ga0373923_0089517 | |||
| 1476 | Ga0373957_0061332 | |||
| 1477 | Ga0373943_0010590 | |||
| 1478 | Ga0373955_0025009 | |||
| 1479 | Ga0373924_0107162 | |||
| 1480 | Ga0373935_0056690 | |||
| 1481 | Ga0373933_0036103 | |||
| 1482 | Ga0373947_0166463 | |||
| 1483 | Ga0373937_0023277 | |||
| 1484 | Ga0395899_0176928 | |||
| 1485 | Ga0395900_0156079 | |||
| 1486 | Ga0395900_0287650 | |||
| 1487 | Ga0395898_0010318 | |||
| 1488 | Ga0395898_0059676 | |||
| 1489 | Ga0395898_0126493 | |||
| 1490 | Ga0395905_0021187 | |||
| 1491 | Ga0395905_0163871 | |||
| 1492 | Ga0395901_0063597 | |||
| 1493 | Ga0395901_0192630 | |||
| 1494 | Ga0395901_0595718 | |||
| 1495 | Ga0395901_0605526 | |||
| 1496 | Ga0436365_1249677 | |||
| 1497 | Ga0439436_0002706 | |||
| 1498 | Ga0439461_0012376 | |||
| 1499 | Ga0451793_1329962 | |||
| 1500 | Ga0451804_1149675 | |||
| 1501 | Ga0451843_0703108 | |||
| 1502 | Ga0439449_0002729 | |||
| 1503 | Ga0439449_0024418 | |||
| 1504 | Ga0439457_002111 | |||
| 1505 | Ga0439462_0004635 | |||
| 1506 | Ga0439462_0008387 | |||
| 1507 | Ga0450923_000505 | |||
| 1508 | Ga0451577_0006113 | |||
| 1509 | Ga0451577_0123920 | |||
| 1510 | Ga0451577_0345943 | |||
| 1511 | Ga0466969_0000127 | |||
| 1512 | Ga0466969_0061212 | |||
| 1513 | Ga0466972_0000080 | |||
| 1514 | Ga0453683_0259989 | |||
| 1515 | Ga0466965_0102220 | |||
| 1516 | Ga0466966_0000120 | |||
| 1517 | Ga0466961_0064528 | |||
| 1518 | Ga0466964_0041728 | |||
| 1519 | Ga0453684_0108162 | |||
| 1520 | Ga0453684_0147752 | |||
| 1521 | Ga0466970_0136481 | |||
| 1522 | Ga0466957_0000380 | |||
| 1523 | Ga0466957_0010728 | |||
| 1524 | Ga0466957_0022142 | |||
| 1525 | Ga0466957_0105888 | |||
| 1526 | Ga0466959_0000014 | |||
| 1527 | Ga0466959_0024738 | |||
| 1528 | Ga0451576_0544710 | |||
| 1529 | Ga0495627_044497 | |||
| 1530 | Ga0495592_0129451 | |||
| 1531 | Ga0495638_0000040 | |||
| 1532 | Ga0495638_0220178 | |||
| 1533 | Ga0495653_0064121 | |||
| 1534 | Ga0495650_0031064 | |||
| 1535 | Ga0495580_0341116 | |||
| 1536 | Ga0495664_0202465 | |||
| 1537 | Ga0495606_0005804 | |||
| 1538 | Ga0495610_0000035 | |||
| 1539 | Ga0495610_0015914 | |||
| 1540 | Ga0495628_0027888 | |||
| 1541 | Ga0495630_0063686 | |||
| 1542 | Ga0495587_0066048 | |||
| 1543 | Ga0495621_0036727 | |||
| 1544 | Ga0495633_0000125 | |||
| 1545 | Ga0495633_0133656 | |||
| 1546 | Ga0495668_0002554 | |||
| 1547 | Ga0495634_0009802 | |||
| 1548 | Ga0495611_0000354 | |||
| 1549 | Ga0495611_0102676 | |||
| 1550 | Ga0495635_0104075 | |||
| 1551 | Ga0495658_0046740 | |||
| 1552 | Ga0495636_0000060 | |||
| 1553 | Ga0495672_0010446 | |||
| 1554 | Ga0495672_0021009 | |||
| 1555 | Ga0495672_0028859 | |||
| 1556 | Ga0495680_0273032 | |||
| 1557 | Ga0495687_000261 | |||
| 1558 | Ga0495686_0000005 | |||
| 1559 | Ga0495686_0007643 | |||
| 1560 | Ga0495686_0056486 | |||
| 1561 | Ga0496106_0348409 | |||
| 1562 | Ga0496110_0055506 | |||
| 1563 | Ga0496111_0098458 | |||
| 1564 | Ga0496114_0094838 | |||
| 1565 | Ga0496121_0000081 | |||
| 1566 | Ga0496126_0042525 | |||
| 1567 | Ga0501031_0143800 | |||
| 1568 | Ga0501032_0004132 | |||
| 1569 | Ga0501032_0086164 | |||
| 1570 | Ga0501032_0148383 | |||
| 1571 | Ga0501033_0017643 | |||
| 1572 | Ga0501033_0113556 | |||
| 1573 | Ga0501034_0007421 | |||
| 1574 | Ga0501034_0213240 | |||
| 1575 | Ga0501034_0241907 | |||
| 1576 | Ga0501036_0034595 | |||
| 1577 | Ga0501036_0124345 | |||
| 1578 | Ga0501037_0031925 | |||
| 1579 | Ga0501037_0033161 | |||
| 1580 | Ga0501038_0017313 | |||
| 1581 | Ga0501038_0030627 | |||
| 1582 | Ga0501038_0104439 | |||
| 1583 | Ga0501038_0161412 | |||
| 1584 | Ga0501043_0003893 | |||
| 1585 | Ga0501043_0030664 | |||
| 1586 | Ga0501043_0068367 | |||
| 1587 | Ga0501046_0089336 | |||
| 1588 | Ga0501046_0220574 | |||
| 1589 | Ga0501047_0013596 | |||
| 1590 | Ga0501047_0082793 | |||
| 1591 | Ga0501047_0169887 | |||
| 1592 | Ga0501047_0348637 | |||
| 1593 | Ga0501048_0006258 | |||
| 1594 | Ga0501067_0036099 | |||
| 1595 | Ga0501070_0078985 | |||
| 1596 | Ga0501070_0082958 | |||
| 1597 | Ga0501073_0006651 | |||
| 1598 | Ga0501074_0002599 | |||
| 1599 | Ga0501202_004033 | |||
| 1600 | Ga0501207_003749 | |||
| 1601 | Ga0501216_011083 | |||
| 1602 | Ga0501217_000586 | |||
| 1603 | Ga0501217_004764 | |||
| 1604 | Ga0501222_001557 | |||
| 1605 | Ga0501240_000977 | |||
| 1606 | Ga0501243_007387 | |||
| 1607 | Ga0501257_026722 | |||
| 1608 | Ga0501219_000133 | |||
| 1609 | Ga0501221_002892 | |||
| 1610 | Ga0501225_0000505 | |||
| 1611 | Ga0501225_0012912 | |||
| 1612 | Ga0501225_0030894 | |||
| 1613 | Ga0501079_0049322 | |||
| 1614 | Ga0501080_0030856 | |||
| 1615 | Ga0501083_0015427 | |||
| 1616 | Ga0501083_0205002 | |||
| 1617 | Ga0501241_003764 | |||
| 1618 | Ga0501264_000116 | |||
| 1619 | Ga0501035_0002433 | |||
| 1620 | Ga0501035_0007289 | |||
| 1621 | Ga0501035_0261765 | |||
| 1622 | Ga0501044_0013650 | |||
| 1623 | Ga0501044_0016689 | |||
| 1624 | Ga0501044_0021227 | |||
| 1625 | Ga0501044_0158829 | |||
| 1626 | Ga0501044_0447847 | |||
| 1627 | Ga0501044_0538019 | |||
| 1628 | Ga0501045_0135871 | |||
| 1629 | Ga0501284_00007 | |||
| 1630 | nmdc:mga0k408_54752_c1 | |||
| 1631 | nmdc:mga05p37_827_c1 | |||
| 1632 | nmdc:mga09592_5573_c1 | |||
| 1633 | nmdc:mga0qj67_115904_c1 | |||
| 1634 | nmdc:mga0qj67_154999_c1 | |||
| 1635 | nmdc:mga06r32_338867_c1 | |||
| 1636 | nmdc:mga08y16_110978_c1 | |||
| 1637 | nmdc:mga08y16_143375_c1 | |||
| 1638 | nmdc:mga08y16_198399_c1 | |||
| 1639 | nmdc:mga08y16_33793_c1 | |||
| 1640 | nmdc:mga08y16_57703_c1 | |||
| 1641 | Ga0495619_0207720 | |||
| 1642 | Ga0500578_0000836 | |||
| 1643 | Ga0500644_0000026 | |||
| 1644 | Ga0500644_0002655 | |||
| 1645 | Ga0500646_0013350 | |||
| 1646 | Ga0500583_0000001 | |||
| 1647 | Ga0500583_0002299 | |||
| 1648 | Ga0500651_0079068 | |||
| 1649 | Ga0500641_0004524 | |||
| 1650 | Ga0500556_0003125 | |||
| 1651 | Ga0500569_000047 | |||
| 1652 | Ga0500607_046686 | |||
| 1653 | Ga0500642_0001746 | |||
| 1654 | Ga0500658_0003491 | |||
| 1655 | Ga0500559_0002568 | |||
| 1656 | Ga0500568_0000142 | |||
| 1657 | Ga0500568_0003595 | |||
| 1658 | Ga0500573_0093276 | |||
| 1659 | Ga0500577_0006329 | |||
| 1660 | Ga0500588_0008757 | |||
| 1661 | Ga0500616_0002235 | |||
| 1662 | Ga0500616_0008249 | |||
| 1663 | Ga0500616_0015110 | |||
| 1664 | Ga0500622_0000692 | |||
| 1665 | Ga0500622_0005506 | |||
| 1666 | Ga0500633_0000782 | |||
| 1667 | Ga0500636_0005348 | |||
| 1668 | Ga0500637_0027758 | |||
| 1669 | Ga0500584_105703 | |||
| 1670 | Ga0500611_000003 | |||
| 1671 | Ga0500645_056904 | |||
| 1672 | Ga0501084_0041717 | |||
| 1673 | Ga0500661_005321 | |||
| 1674 | Ga0466962_0063789 | |||
| 1675 | 2586207416 | |||
| 1676 | 2738725417 | |||
| 1677 | 2738854007 | |||
| 1678 | 2739588608 | |||
| 1679 | 2739615898 | |||
| 1680 | 2739644989 | |||
| 1681 | 2819548142 | |||
| 1682 | 2819574922 | |||
| 1683 | 2819676870 | |||
| 1684 | 2821141023 | |||
| 1685 | 2842723744 | |||
| 1686 | 2842910250 | |||
| 1687 | 2849284295 | |||
| 1688 | 2857628930 | |||
| 1689 | 2884637094 | |||
| 1690 | 2884796724 | |||
| 1691 | 2896086639 | |||
| 1692 | 2904445698 | |||
| 1693 | 2904471523 | |||
| 1694 | 2929177758 | |||
| 1695 | 2929240122 | |||
| 1696 | 2945980105 | |||
| 1697 | 2946000604 | |||
| 1698 | 2946014033 | |||
| 1699 | 2954017486 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xhz-assembly1.cif.gz_B | probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography | 0.9778 | 2 | 170 |
| 5uqi-assembly1.cif.gz_A | e. coli cft073 c3406 in complex with a5p | 0.9532 | 6 | 182 |
| 3fxa-assembly1.cif.gz_D | crystal structure of a putative sugar-phosphate isomerase (lmof2365_0531) from listeria monocytogenes str. 4b f2365 at 1.60 a resolution | 0.9527 | 2 | 182 |
| 3etn-assembly1.cif.gz_C | crystal structure of putative phosphosugar isomerase involved in capsule formation (yp_209877.1) from bacteroides fragilis nctc 9343 at 1.70 a resolution | 0.95 | 8 | 181 |
| 2xhz-assembly1.cif.gz_B | probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography | 0.9448 | 2 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45395_11_201_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9774 | 2 | 189 | 3.40.50.10490 |
| af_P45395_11_201_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9574 | 2 | 189 | 3.40.50.10490 |
| 5vhuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9538 | 6 | 182 | 3.40.50.10490 |
| af_I1N9R7_21_211_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9476 | 7 | 187 | 3.40.50.10490 |
| 3kpbA00 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9379 | 193 | 311 | 3.10.580.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V2AMI0-F1-model_v4 | SIS domain-containing protein | 0.9993 | 10 | 156 |
GO:0097367
GO:1901135 |
| AF-A0A7X7FZ27-F1-model_v4 | SIS domain-containing protein | 0.9879 | 2 | 182 |
GO:0097367
GO:1901135 |
| AF-A0A4V2AMI0-F1-model_v4 | SIS domain-containing protein | 0.9859 | 10 | 156 |
GO:0097367
GO:1901135 |
| AF-A0A7G3ELT6-F1-model_v4 | deleted | 0.9828 | 2 | 182 |
|
| AF-A0A5C9ADZ1-F1-model_v4 | KpsF/GutQ family sugar-phosphate isomerase | 0.9811 | 2 | 184 |
GO:0005975
GO:0016853 GO:0097367 GO:1901135 |