F483404

General Info

Members Datasets Scaffolds Average Seq Length
849 444 1699 253

Family's Representative Sequence

Representative Sequence 3300041491|Ga0451833_0503407|Ga0451833_0503407_14_874
Length 286
Sequence MLAAEKSGTTPEAFIQPIQLSHERDFTDFGVDFDEYHTTHSEENRLLAESIYARLRDGGHIARRSIQQLFDPVKEMFLPTPDHVLRTTVNMAVDGTLWEHALSSLQVVLLGFVIGSSRMAYAAMYPLMTGFNALPKAAFVPILVVWFGIGVGPAVLTAFLISFFPITVNIATGLATLEPELEDVLRVLGAKRWDVLIKIGLPRSMPYFYASLKVAITLAFVGTTVSEMTAANEGIGYLLISAGSSMQMGLAFAGLLVVGAMAMAMYELFAVIEKRTTGWAHRGSNA

Samples

Sample ID Description Type Environment
1 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
123 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
124 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
139 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
140 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
200 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
208 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
209 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
210 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
211 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
212 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
218 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
241 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
242 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
243 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
244 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
245 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
246 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
249 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
250 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
251 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
252 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
253 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
254 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
255 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
256 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
257 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
258 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
259 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
260 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
261 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
262 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
263 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
264 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
270 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
271 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
280 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
281 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
282 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
283 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
284 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
297 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
298 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
299 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
300 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
301 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
304 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
321 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
322 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
330 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
331 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
332 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
333 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
334 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
335 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
336 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
337 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
340 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
341 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
342 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
343 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
344 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
345 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
346 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
347 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
348 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
349 2547132374 Acidovorax radicis N35 Isolate Unclassified
350 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
351 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
352 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
353 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
354 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
355 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
356 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
357 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
358 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
359 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
360 2643221570 Acidovorax sp. Root568 Isolate Unclassified
361 2643221585 Pelomonas sp. Root662 Isolate Unclassified
362 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
363 2643221596 Acidovorax sp. Root70 Isolate Unclassified
364 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
365 2643221609 Acidovorax sp. Root217 Isolate Unclassified
366 2643221611 Acidovorax sp. Root219 Isolate Unclassified
367 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
368 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
369 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
370 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
371 2643221652 Acidovorax sp. Root402 Isolate Unclassified
372 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
373 2643221656 Pelomonas sp. Root405 Isolate Unclassified
374 2643221658 Variovorax sp. Root411 Isolate Unclassified
375 2643221672 Variovorax sp. Root434 Isolate Unclassified
376 2643221683 Variovorax sp. Root473 Isolate Unclassified
377 2643221717 Acidovorax sp. Root267 Isolate Unclassified
378 2721755523 Delftia sp. HK171 Isolate Unclassified
379 2738541277 Variovorax sp. GV051 Isolate Unclassified
380 2738541307 Variovorax sp. GV008 Isolate Unclassified
381 2738543012 Acidovorax sp. CF301 Isolate Unclassified
382 2738543013 Variovorax sp. BT01 Isolate Unclassified
383 2738543019 Variovorax sp. GV040 Isolate Unclassified
384 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
385 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
386 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
387 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
388 2816332133 Acidovorax radicis 2721A Isolate Unclassified
389 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
390 2818991446 Variovorax sp. 1180 Isolate Unclassified
391 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
392 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
393 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
394 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
395 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
396 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
397 2842677519 Variovorax sp. R-72495 Isolate Unclassified
398 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
399 2842733646 Variovorax sp. R-72446 Isolate Unclassified
400 2842747753 Variovorax sp. R-72060 Isolate Unclassified
401 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
402 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
403 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
404 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
405 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
406 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
407 2885198086 Variovorax sp. 679 Isolate Unclassified
408 2885211737 Variovorax sp. 553 Isolate Unclassified
409 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
410 2899924645 Variovorax sp. 369 Isolate Unclassified
411 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
412 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
413 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
414 2904456579 Variovorax sp. 2002 Isolate Unclassified
415 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
416 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
417 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
418 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
419 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
420 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
421 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
422 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
423 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
424 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
425 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
426 2928037797 Variovorax sp. 1126 Isolate Unclassified
427 2928044640 Variovorax sp. 1128 Isolate Unclassified
428 2928051484 Variovorax sp. 1133 Isolate Unclassified
429 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
430 2928070936 Variovorax gossypii 1167 Isolate Unclassified
431 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
432 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
433 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
434 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
435 2929520902 Variovorax beijingensis 502 Isolate Unclassified
436 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
437 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
438 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
439 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
440 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
441 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
442 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
443 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
444 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.75
Metatranscriptomes 0.12
Isolates 12.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.56
Nodule 1.77
Rhizoplane 1.77
Rhizosphere 53.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451833_0503407 3300041491 Bacteria 1023
2 JGI24740J21852_10006051 3300001979 Bacteria 5058
3 JGI24739J22299_10007959 3300001989 Bacteria 3965
4 JGI25155J39150_1000373 3300002704 Bacteria 13361
5 JGI25155J39150_1000448 3300002704 Bacteria 10615
6 JGI25156J39149_1000117 3300002705 Bacteria 57700
7 JGI25162J39368_1003833 3300002737 Bacteria 3958
8 JGI25154J39366_1000107 3300002738 Bacteria 73482
9 JGI25154J39366_1000249 3300002738 Bacteria 34973
10 JGI25157J39369_1000512 3300002741 Bacteria 23821
11 JGI25152J39213_1001037 3300002773 Bacteria 13241
12 JGI25150J39212_1001492 3300002774 Bacteria 6498
13 JGI25150J39212_1003450 3300002774 Bacteria 3694
14 JGI25159J45721_1000938 3300002987 Bacteria 12728
15 JGI25159J45721_1019573 3300002987 Bacteria 1329
16 JGI25151J46595_10005990 3300003187 Bacteria 6191
17 JGI25151J46595_10006065 3300003187 Bacteria 6145
18 JGI25151J46595_10006915 3300003187 Bacteria 5631
19 JGI25151J46595_10008499 3300003187 Bacteria 4933
20 JGI25151J46595_10026498 3300003187 Bacteria 2338
21 JGI25151J46595_10037187 3300003187 Bacteria 1828
22 JGI25153J46596_10001796 3300003215 Bacteria 12728
23 JGI25153J46596_10006203 3300003215 Bacteria 6116
24 rootH1_10006961 3300003316 Bacteria 26234
25 rootH1_10006961 3300003323 Bacteria 2768
26 rootH2_10063583 3300003320 Bacteria 3986
27 rootL2_10008719 3300003322 Bacteria 24040
28 rootL2_10049725 3300003322 Bacteria 2974
29 JGI25160J50197_1000226 3300003354 Bacteria 44500
30 JGI25160J50197_1001281 3300003354 Bacteria 12758
31 JGI25160J50197_1016203 3300003354 Bacteria 2410
32 JGI25161J50226_1000037 3300003374 Bacteria 133331
33 JGI25161J50226_1002873 3300003374 Bacteria 4195
34 JGI25161J50226_1003897 3300003374 Bacteria 3252
35 Ga0006562J51391_1053388 3300003578 Bacteria 5620
36 Ga0055538_1000085 3300003751 Bacteria 81616
37 Ga0055539_1000126 3300003752 Bacteria 81616
38 Ga0055533_1000133 3300003756 Bacteria 81616
39 Ga0055532_1000044 3300003758 Bacteria 191110
40 Ga0055525_1000174 3300003759 Bacteria 81616
41 Ga0055535_1000075 3300003761 Bacteria 111667
42 Ga0055535_1004532 3300003761 Bacteria 3340
43 Ga0055542_1000059 3300003762 Bacteria 162670
44 Ga0055526_1002374 3300003771 Bacteria 12758
45 Ga0055526_1004721 3300003771 Bacteria 8077
46 Ga0055526_1009710 3300003771 Bacteria 4586
47 Ga0055526_1020944 3300003771 Bacteria 2298
48 Ga0055526_1024924 3300003771 Bacteria 1936
49 Ga0055537_1000209 3300003773 Bacteria 43625
50 Ga0055537_1001009 3300003773 Bacteria 12758
51 Ga0055537_1006249 3300003773 Bacteria 3055
52 Ga0055537_1015227 3300003773 Bacteria 1360
53 Ga0055524_1000233 3300003775 Bacteria 58967
54 Ga0055524_1001273 3300003775 Bacteria 14781
55 Ga0055524_1001585 3300003775 Bacteria 12758
56 Ga0055524_1008286 3300003775 Bacteria 4329
57 Ga0055536_1000110 3300003781 Bacteria 72378
58 Ga0055536_1005196 3300003781 Bacteria 6429
59 Ga0055536_1007740 3300003781 Bacteria 4751
60 Ga0055536_1012477 3300003781 Bacteria 3151
61 Ga0055536_1035477 3300003781 Bacteria 1247
62 Ga0055534_1000204 3300003784 Bacteria 43602
63 Ga0055534_1000762 3300003784 Bacteria 15292
64 Ga0055534_1000901 3300003784 Bacteria 13451
65 Ga0055534_1002032 3300003784 Bacteria 7332
66 Ga0055528_1001708 3300003790 Bacteria 12758
67 Ga0055528_1001972 3300003790 Bacteria 11584
68 Ga0055528_1031882 3300003790 Bacteria 1360
69 Ga0055530_10000758 3300003791 Bacteria 26817
70 Ga0055530_10001159 3300003791 Bacteria 20427
71 Ga0055530_10002021 3300003791 Bacteria 13714
72 Ga0055530_10002991 3300003791 Bacteria 10151
73 Ga0055540_1000080 3300003792 Bacteria 111063
74 Ga0055540_1000137 3300003792 Bacteria 73229
75 Ga0055540_1008445 3300003792 Bacteria 3709
76 Ga0055540_1015866 3300003792 Bacteria 2171
77 Ga0055540_1045518 3300003792 Bacteria 926
78 Ga0055531_10001920 3300003794 Bacteria 14541
79 Ga0055531_10002432 3300003794 Bacteria 12467
80 Ga0055531_10006303 3300003794 Bacteria 6758
81 Ga0055531_10014072 3300003794 Bacteria 3634
82 Ga0055531_10017034 3300003794 Bacteria 3093
83 Ga0055541_1000085 3300003841 Bacteria 81616
84 Ga0055543_1001262 3300004625 Bacteria 10444
85 Ga0065165_1002511 3300005262 Bacteria 15324
86 Ga0065165_1010738 3300005262 Bacteria 3913
87 Ga0065165_1011902 3300005262 Bacteria 3581
88 Ga0065165_1024021 3300005262 Bacteria 2056
89 Ga0065714_10018134 3300005288 Bacteria 1282
90 Ga0065704_10090130 3300005289 Bacteria 2810
91 Ga0065704_10095050 3300005289 Bacteria 2504
92 Ga0070683_100188826 3300005329 Bacteria 1956
93 Ga0070670_100001478 3300005331 Bacteria 18935
94 Ga0070677_10059413 3300005333 Bacteria 1572
95 Ga0070677_10062281 3300005333 Bacteria 1543
96 Ga0068869_100312709 3300005334 Bacteria 1272
97 Ga0070666_10074775 3300005335 Bacteria 2310
98 Ga0068868_100078023 3300005338 Bacteria 2650
99 Ga0068868_100105985 3300005338 Bacteria 2280
100 Ga0068868_100107238 3300005338 Bacteria 2267
101 Ga0068868_100419992 3300005338 Bacteria 1158
102 Ga0070689_100016515 3300005340 Bacteria 5402
103 Ga0070668_100052259 3300005347 Bacteria 3149
104 Ga0070668_100125281 3300005347 Bacteria 2057
105 Ga0070669_100024394 3300005353 Bacteria 4336
106 Ga0070669_100047396 3300005353 Bacteria 3135
107 Ga0070669_100258273 3300005353 Bacteria 1389
108 Ga0070675_100000072 3300005354 Bacteria 58324
109 Ga0070675_100001530 3300005354 Bacteria 17096
110 Ga0070671_100002032 3300005355 Bacteria 15587
111 Ga0070671_100008208 3300005355 Bacteria 8356
112 Ga0070671_100027427 3300005355 Bacteria 4689
113 Ga0070671_100139968 3300005355 Bacteria 2042
114 Ga0070674_100098177 3300005356 Bacteria 2129
115 Ga0070674_100274601 3300005356 Bacteria 1334
116 Ga0070673_100003979 3300005364 Bacteria 9298
117 Ga0070673_100068932 3300005364 Bacteria 2833
118 Ga0070673_100207365 3300005364 Bacteria 1691
119 Ga0070673_100292490 3300005364 Bacteria 1432
120 Ga0070673_100297708 3300005364 Bacteria 1419
121 Ga0070673_100345816 3300005364 Bacteria 1319
122 Ga0070673_100632013 3300005364 Bacteria 979
123 Ga0070688_100014106 3300005365 Bacteria 4521
124 Ga0070667_100016510 3300005367 Bacteria 6110
125 Ga0070667_100020627 3300005367 Bacteria 5471
126 Ga0070667_100529164 3300005367 Bacteria 1082
127 Ga0070667_100617186 3300005367 Bacteria 1000
128 Ga0070663_100337433 3300005455 Bacteria 1217
129 Ga0070678_100062379 3300005456 Bacteria 2752
130 Ga0070678_100344769 3300005456 Bacteria 1279
131 Ga0070678_100461159 3300005456 Bacteria 1115
132 Ga0070662_100192579 3300005457 Bacteria 1613
133 Ga0068867_100010282 3300005459 Bacteria 6602
134 Ga0068867_100393172 3300005459 Bacteria 1167
135 Ga0070706_100000815 3300005467 Bacteria 34516
136 Ga0068853_100086219 3300005539 Bacteria 2753
137 Ga0070672_100027211 3300005543 Bacteria 4263
138 Ga0070672_100039485 3300005543 Bacteria 3616
139 Ga0070672_100087689 3300005543 Bacteria 2504
140 Ga0070672_100182461 3300005543 Bacteria 1749
141 Ga0070672_100272449 3300005543 Bacteria 1430
142 Ga0070665_100059422 3300005548 Bacteria 3832
143 Ga0070665_100090744 3300005548 Bacteria 3061
144 Ga0068855_100008256 3300005563 Bacteria 12586
145 Ga0068855_100012665 3300005563 Bacteria 10178
146 Ga0068855_100084137 3300005563 Bacteria 3684
147 Ga0070664_100006488 3300005564 Bacteria 9430
148 Ga0070664_100138105 3300005564 Bacteria 2145
149 Ga0070664_100189648 3300005564 Bacteria 1831
150 Ga0068857_100113011 3300005577 Bacteria 2442
151 Ga0068857_100184535 3300005577 Bacteria 1899
152 Ga0068857_100214539 3300005577 Bacteria 1757
153 Ga0068854_100021162 3300005578 Bacteria 4411
154 Ga0068856_100060699 3300005614 Bacteria 3735
155 Ga0068852_100001472 3300005616 Bacteria 15936
156 Ga0068852_100259021 3300005616 Bacteria 1669
157 Ga0068852_100733270 3300005616 Bacteria 1000
158 Ga0068859_100009439 3300005617 Bacteria 9851
159 Ga0068859_100023760 3300005617 Bacteria 6152
160 Ga0068864_100000365 3300005618 Bacteria 39562
161 Ga0068864_100008762 3300005618 Bacteria 8341
162 Ga0068864_100015666 3300005618 Bacteria 6306
163 Ga0068864_100057120 3300005618 Bacteria 3372
164 Ga0068864_100102794 3300005618 Bacteria 2536
165 Ga0068861_100103488 3300005719 Bacteria 2269
166 Ga0068861_100517631 3300005719 Bacteria 1081
167 Ga0068851_10022301 3300005834 Bacteria 3083
168 Ga0068851_10064125 3300005834 Bacteria 1888
169 Ga0068863_100006233 3300005841 Bacteria 11712
170 Ga0068863_100058427 3300005841 Bacteria 3649
171 Ga0068863_100356237 3300005841 Bacteria 1426
172 Ga0068858_100002406 3300005842 Bacteria 18921
173 Ga0068860_100570550 3300005843 Bacteria 1135
174 Ga0068862_100048603 3300005844 Bacteria 3622
175 Ga0068862_100081207 3300005844 Bacteria 2812
176 Ga0075365_10030760 3300006038 Bacteria 3441
177 Ga0075363_100184638 3300006048 Bacteria 1188
178 Ga0075363_100201294 3300006048 Bacteria 1138
179 Ga0075363_100206388 3300006048 Bacteria 1124
180 Ga0075364_10013074 3300006051 Bacteria 5093
181 Ga0075364_10015271 3300006051 Bacteria 4761
182 Ga0075364_10078247 3300006051 Bacteria 2184
183 Ga0075364_10152916 3300006051 Bacteria 1555
184 Ga0075432_10005480 3300006058 Bacteria 4323
185 Ga0075362_10012457 3300006177 Bacteria 3379
186 Ga0075362_10031439 3300006177 Bacteria 2297
187 Ga0075366_10002800 3300006195 Bacteria 9018
188 Ga0075366_10011897 3300006195 Bacteria 4924
189 Ga0075366_10052784 3300006195 Bacteria 2415
190 Ga0075366_10071406 3300006195 Bacteria 2068
191 Ga0075366_10076715 3300006195 Bacteria 1994
192 Ga0075366_10091014 3300006195 Bacteria 1827
193 Ga0075366_10093324 3300006195 Bacteria 1804
194 Ga0075366_10097344 3300006195 Bacteria 1765
195 Ga0075366_10276744 3300006195 Bacteria 1025
196 Ga0097621_100026071 3300006237 Bacteria 4582
197 Ga0097621_100155085 3300006237 Bacteria 1965
198 Ga0097621_100206637 3300006237 Bacteria 1706
199 Ga0097621_100291159 3300006237 Bacteria 1440
200 Ga0075370_10001172 3300006353 Bacteria 11031
201 Ga0075370_10002892 3300006353 Bacteria 8057
202 Ga0075370_10027339 3300006353 Bacteria 3164
203 Ga0075370_10030647 3300006353 Bacteria 3002
204 Ga0075370_10035165 3300006353 Bacteria 2811
205 Ga0075370_10123168 3300006353 Bacteria 1510
206 Ga0075370_10181047 3300006353 Bacteria 1240
207 Ga0068871_100021764 3300006358 Bacteria 4934
208 Ga0068871_100157315 3300006358 Bacteria 1941
209 Ga0068871_100269311 3300006358 Bacteria 1488
210 Ga0097620_100009439 3300006931 Bacteria 9851
211 Ga0097620_100023761 3300006931 Bacteria 6152
212 Ga0079104_1000020 3300006946 Bacteria 256848
213 Ga0079104_1000267 3300006946 Bacteria 68733
214 Ga0079104_1016875 3300006946 Bacteria 2118
215 Ga0099826_10000014 3300006948 Bacteria 258520
216 Ga0105251_10008698 3300009011 Bacteria 6086
217 Ga0105244_10009554 3300009036 Bacteria 5950
218 Ga0105250_10001195 3300009092 Bacteria 14490
219 Ga0105240_10003351 3300009093 Bacteria 24930
220 Ga0105240_10418698 3300009093 Bacteria 1505
221 Ga0105240_10749569 3300009093 Bacteria 1062
222 Ga0105245_10057279 3300009098 Bacteria 3505
223 Ga0105243_10001263 3300009148 Bacteria 22726
224 Ga0105243_10009492 3300009148 Bacteria 7407
225 Ga0105243_10022596 3300009148 Bacteria 4782
226 Ga0105241_10186487 3300009174 Bacteria 1724
227 Ga0105242_10004100 3300009176 Bacteria 11330
228 Ga0105242_10012580 3300009176 Bacteria 6515
229 Ga0105248_10014023 3300009177 Bacteria 8818
230 Ga0105248_10222044 3300009177 Bacteria 2127
231 Ga0105248_10463392 3300009177 Bacteria 1429
232 Ga0105237_10022411 3300009545 Bacteria 6481
233 Ga0105237_10091950 3300009545 Bacteria 3024
234 Ga0105237_10138414 3300009545 Bacteria 2429
235 Ga0105237_10437499 3300009545 Bacteria 1313
236 Ga0105238_10000038 3300009551 Bacteria 162920
237 Ga0105238_10033619 3300009551 Bacteria 5219
238 Ga0105238_10387968 3300009551 Bacteria 1389
239 Ga0105249_10039063 3300009553 Bacteria 4308
240 Ga0105249_11036917 3300009553 Bacteria 889
241 Ga0105239_10010497 3300010375 Bacteria 10353
242 Ga0105239_10509832 3300010375 Bacteria 1368
243 Ga0105246_10024446 3300011119 Bacteria 3926
244 Ga0157373_10021391 3300013100 Bacteria 4699
245 Ga0157371_10170971 3300013102 Bacteria 1553
246 Ga0157370_10046759 3300013104 Bacteria 4149
247 Ga0157369_10009779 3300013105 Bacteria 10968
248 Ga0157374_10017623 3300013296 Bacteria 6292
249 Ga0157378_10262224 3300013297 Bacteria 1658
250 Ga0163162_10025495 3300013306 Bacteria 5842
251 Ga0163162_11139232 3300013306 Bacteria 884
252 Ga0157372_10636484 3300013307 Bacteria 1242
253 Ga0157375_10022777 3300013308 Bacteria 5768
254 Ga0157375_10057967 3300013308 Bacteria 3830
255 Ga0157375_10210614 3300013308 Bacteria 2101
256 Ga0157375_10277650 3300013308 Bacteria 1838
257 Ga0157375_10530793 3300013308 Bacteria 1339
258 Ga0163163_10001376 3300014325 Bacteria 20523
259 Ga0163163_10160807 3300014325 Bacteria 2291
260 Ga0157380_10944521 3300014326 Bacteria 892
261 Ga0182008_10002120 3300014497 Bacteria 12642
262 Ga0182008_10003759 3300014497 Bacteria 9042
263 Ga0182008_10110297 3300014497 Bacteria 1363
264 Ga0182008_10158269 3300014497 Bacteria 1139
265 Ga0157379_10025922 3300014968 Bacteria 5213
266 Ga0157379_10207554 3300014968 Bacteria 1773
267 Ga0157379_10305898 3300014968 Bacteria 1449
268 Ga0157376_10192263 3300014969 Bacteria 1872
269 Ga0157376_10305230 3300014969 Bacteria 1508
270 Ga0182006_1004394 3300015261 Bacteria 6967
271 Ga0182007_10000330 3300015262 Bacteria 29991
272 Ga0182007_10001131 3300015262 Bacteria 14464
273 Ga0182007_10112785 3300015262 Bacteria 905
274 Ga0183362_10003 3300015683 Bacteria 977584
275 Ga0163161_10000118 3300017792 Bacteria 75123
276 Ga0163161_10006973 3300017792 Bacteria 7811
277 Ga0163161_10053410 3300017792 Bacteria 2931
278 Ga0163161_10174796 3300017792 Bacteria 1644
279 Ga0213872_10107482 3300021361 Bacteria 1240
280 Ga0209435_100004 3300025206 Bacteria 633417
281 Ga0209435_100239 3300025206 Bacteria 14733
282 Ga0209436_113575 3300025208 Bacteria 1326
283 Ga0209784_100021 3300025224 Bacteria 408534
284 Ga0209566_100039 3300025225 Bacteria 303368
285 Ga0209674_100036 3300025226 Bacteria 408534
286 Ga0209672_101521 3300025228 Bacteria 8065
287 Ga0209147_100011 3300025229 Bacteria 702140
288 Ga0209147_104501 3300025229 Bacteria 2307
289 Ga0209563_100040 3300025230 Bacteria 408534
290 Ga0209437_100207 3300025233 Bacteria 112147
291 Ga0209258_100078 3300025242 Bacteria 263996
292 Ga0209258_100528 3300025242 Bacteria 36442
293 Ga0207425_1000191 3300025245 Bacteria 49767
294 Ga0207425_1023809 3300025245 Bacteria 1277
295 Ga0209646_1000141 3300025246 Bacteria 107030
296 Ga0209646_1000149 3300025246 Bacteria 100004
297 Ga0209646_1000233 3300025246 Bacteria 57776
298 Ga0209026_1000066 3300025250 Bacteria 207691
299 Ga0209026_1000931 3300025250 Bacteria 14755
300 Ga0209677_100023 3300025253 Bacteria 408534
301 Ga0209148_1000086 3300025254 Bacteria 263996
302 Ga0209759_1000072 3300025256 Bacteria 178206
303 Ga0209759_1000182 3300025256 Bacteria 102836
304 Ga0209129_1000116 3300025258 Bacteria 140716
305 Ga0209129_1001707 3300025258 Bacteria 11854
306 Ga0209129_1002001 3300025258 Bacteria 10585
307 Ga0209565_1000045 3300025263 Bacteria 226864
308 Ga0209565_1000067 3300025263 Bacteria 171247
309 Ga0209565_1000133 3300025263 Bacteria 104054
310 Ga0209565_1000987 3300025263 Bacteria 14624
311 Ga0207666_1010003 3300025271 Bacteria 1291
312 Ga0209673_1000190 3300025273 Bacteria 123411
313 Ga0209673_1000315 3300025273 Bacteria 89120
314 Ga0209673_1000813 3300025273 Bacteria 41247
315 Ga0209673_1002491 3300025273 Bacteria 12690
316 Ga0209673_1027509 3300025273 Bacteria 1848
317 Ga0209673_1031648 3300025273 Bacteria 1642
318 Ga0209673_1037781 3300025273 Bacteria 1414
319 Ga0209130_1000159 3300025284 Bacteria 101007
320 Ga0209130_1000202 3300025284 Bacteria 80333
321 Ga0209130_1000307 3300025284 Bacteria 58849
322 Ga0209130_1004923 3300025284 Bacteria 4844
323 Ga0209130_1014857 3300025284 Bacteria 1939
324 Ga0209130_1017200 3300025284 Bacteria 1730
325 Ga0209675_1000038 3300025291 Bacteria 250481
326 Ga0209675_1000247 3300025291 Bacteria 53629
327 Ga0209675_1000282 3300025291 Bacteria 48505
328 Ga0209675_1002196 3300025291 Bacteria 10238
329 Ga0209675_1002329 3300025291 Bacteria 9819
330 Ga0209675_1005053 3300025291 Bacteria 5643
331 Ga0209675_1013191 3300025291 Bacteria 2603
332 Ga0209676_1000013 3300025292 Bacteria 816080
333 Ga0209676_1000064 3300025292 Bacteria 321700
334 Ga0209676_1000125 3300025292 Bacteria 191565
335 Ga0209676_1000732 3300025292 Bacteria 44939
336 Ga0209676_1002481 3300025292 Bacteria 12987
337 Ga0209676_1005722 3300025292 Bacteria 6385
338 Ga0209676_1028562 3300025292 Bacteria 1734
339 Ga0209676_1061991 3300025292 Bacteria 926
340 Ga0209025_1000256 3300025294 Bacteria 125758
341 Ga0209025_1000293 3300025294 Bacteria 111845
342 Ga0209025_1000899 3300025294 Bacteria 46148
343 Ga0209025_1001146 3300025294 Bacteria 37744
344 Ga0209025_1001385 3300025294 Bacteria 32357
345 Ga0209025_1001957 3300025294 Bacteria 23748
346 Ga0209025_1010545 3300025294 Bacteria 6250
347 Ga0209025_1015359 3300025294 Bacteria 4625
348 Ga0209025_1043423 3300025294 Bacteria 1894
349 Ga0209564_1000201 3300025295 Bacteria 136907
350 Ga0209564_1000462 3300025295 Bacteria 68050
351 Ga0209564_1000918 3300025295 Bacteria 38443
352 Ga0209564_1001999 3300025295 Bacteria 17828
353 Ga0209564_1002274 3300025295 Bacteria 15712
354 Ga0209758_1000034 3300025297 Bacteria 467637
355 Ga0209758_1000126 3300025297 Bacteria 189761
356 Ga0209758_1010677 3300025297 Bacteria 5453
357 Ga0209758_1011684 3300025297 Bacteria 5044
358 Ga0209758_1032751 3300025297 Bacteria 2103
359 Ga0209050_1000008 3300025298 Bacteria 1144179
360 Ga0209050_1000012 3300025298 Bacteria 813717
361 Ga0209050_1002321 3300025298 Bacteria 16737
362 Ga0209050_1002676 3300025298 Bacteria 14535
363 Ga0209050_1014676 3300025298 Bacteria 3352
364 Ga0209050_1017651 3300025298 Bacteria 2827
365 Ga0209050_1046391 3300025298 Bacteria 1142
366 Ga0209256_1000066 3300025299 Bacteria 247534
367 Ga0209256_1000105 3300025299 Bacteria 188238
368 Ga0209256_1000193 3300025299 Bacteria 117486
369 Ga0209256_1000203 3300025299 Bacteria 112500
370 Ga0209256_1000270 3300025299 Bacteria 90996
371 Ga0207426_1000145 3300025302 Bacteria 191065
372 Ga0207426_1000244 3300025302 Bacteria 120371
373 Ga0207426_1000369 3300025302 Bacteria 79694
374 Ga0207426_1002799 3300025302 Bacteria 10459
375 Ga0209051_1000005 3300025303 Bacteria 1142353
376 Ga0209051_1000035 3300025303 Bacteria 346999
377 Ga0209051_1000134 3300025303 Bacteria 138380
378 Ga0209051_1000322 3300025303 Bacteria 72185
379 Ga0209051_1000344 3300025303 Bacteria 69935
380 Ga0209051_1000524 3300025303 Bacteria 47751
381 Ga0209051_1012706 3300025303 Bacteria 4055
382 Ga0209051_1040833 3300025303 Bacteria 1658
383 Ga0209051_1043998 3300025303 Bacteria 1561
384 Ga0209257_1000024 3300025304 Bacteria 726068
385 Ga0209257_1000048 3300025304 Bacteria 455536
386 Ga0209257_1000346 3300025304 Bacteria 95662
387 Ga0209257_1000849 3300025304 Bacteria 43669
388 Ga0209257_1001178 3300025304 Bacteria 33080
389 Ga0209257_1016979 3300025304 Bacteria 2900
390 Ga0209257_1018695 3300025304 Bacteria 2648
391 Ga0207656_10014447 3300025321 Bacteria 3042
392 Ga0207656_10044281 3300025321 Bacteria 1900
393 Ga0207696_1002283 3300025711 Bacteria 9527
394 Ga0207655_1002165 3300025728 Bacteria 16367
395 Ga0207713_1019388 3300025735 Bacteria 3328
396 Ga0207682_10005101 3300025893 Bacteria 5380
397 Ga0207682_10073804 3300025893 Bacteria 1450
398 Ga0207642_10200607 3300025899 Bacteria 1101
399 Ga0207688_10081355 3300025901 Bacteria 1850
400 Ga0207643_10037154 3300025908 Bacteria 2732
401 Ga0207643_10267740 3300025908 Bacteria 1056
402 Ga0207684_10001165 3300025910 Bacteria 29354
403 Ga0207695_10000748 3300025913 Bacteria 62583
404 Ga0207695_10000979 3300025913 Bacteria 50790
405 Ga0207695_10138986 3300025913 Bacteria 2380
406 Ga0207695_10156465 3300025913 Bacteria 2214
407 Ga0207671_10010004 3300025914 Bacteria 7871
408 Ga0207671_10087522 3300025914 Bacteria 2342
409 Ga0207649_10184320 3300025920 Bacteria 1463
410 Ga0207649_10206882 3300025920 Bacteria 1390
411 Ga0207649_10269994 3300025920 Bacteria 1232
412 Ga0207681_10016792 3300025923 Bacteria 4587
413 Ga0207694_10000069 3300025924 Bacteria 124500
414 Ga0207694_10117268 3300025924 Bacteria 2122
415 Ga0207650_10024897 3300025925 Bacteria 4260
416 Ga0207650_10112712 3300025925 Bacteria 2107
417 Ga0207650_10193708 3300025925 Bacteria 1625
418 Ga0207650_10420448 3300025925 Bacteria 1109
419 Ga0207650_10457438 3300025925 Bacteria 1063
420 Ga0207659_10001521 3300025926 Bacteria 13761
421 Ga0207659_10015117 3300025926 Bacteria 4993
422 Ga0207644_10003206 3300025931 Bacteria 10538
423 Ga0207644_10005562 3300025931 Bacteria 8203
424 Ga0207644_10008749 3300025931 Bacteria 6627
425 Ga0207706_10031489 3300025933 Bacteria 4725
426 Ga0207706_10141945 3300025933 Bacteria 2113
427 Ga0207686_10006431 3300025934 Bacteria 6322
428 Ga0207686_10021415 3300025934 Bacteria 3710
429 Ga0207709_10000055 3300025935 Bacteria 222373
430 Ga0207709_10000410 3300025935 Bacteria 41986
431 Ga0207709_10001314 3300025935 Bacteria 17672
432 Ga0207670_10019292 3300025936 Bacteria 4163
433 Ga0207669_10378592 3300025937 Bacteria 1102
434 Ga0207669_10464626 3300025937 Bacteria 1005
435 Ga0207704_10393562 3300025938 Bacteria 1091
436 Ga0207691_10011628 3300025940 Bacteria 8448
437 Ga0207691_10016757 3300025940 Bacteria 6953
438 Ga0207691_10019387 3300025940 Bacteria 6437
439 Ga0207691_10091541 3300025940 Bacteria 2725
440 Ga0207691_10130841 3300025940 Bacteria 2217
441 Ga0207691_10219990 3300025940 Bacteria 1647
442 Ga0207711_10015665 3300025941 Bacteria 6288
443 Ga0207711_10066801 3300025941 Bacteria 3110
444 Ga0207711_10178069 3300025941 Bacteria 1932
445 Ga0207661_10261559 3300025944 Bacteria 1541
446 Ga0207679_10004569 3300025945 Bacteria 8621
447 Ga0207679_10264253 3300025945 Bacteria 1469
448 Ga0207667_10000043 3300025949 Bacteria 261426
449 Ga0207667_10011296 3300025949 Bacteria 10385
450 Ga0207667_10020155 3300025949 Bacteria 7424
451 Ga0207667_10034212 3300025949 Bacteria 5459
452 Ga0207651_10008310 3300025960 Bacteria 5599
453 Ga0207651_10017232 3300025960 Bacteria 4261
454 Ga0207668_10028782 3300025972 Bacteria 3636
455 Ga0207668_10066281 3300025972 Bacteria 2559
456 Ga0207640_10006631 3300025981 Bacteria 6359
457 Ga0207658_10009364 3300025986 Bacteria 6644
458 Ga0207658_10021392 3300025986 Bacteria 4490
459 Ga0207658_10074457 3300025986 Bacteria 2580
460 Ga0207658_10499404 3300025986 Bacteria 1083
461 Ga0207677_10020400 3300026023 Bacteria 4024
462 Ga0207677_10040368 3300026023 Bacteria 3076
463 Ga0207677_10438947 3300026023 Bacteria 1116
464 Ga0207703_10003467 3300026035 Bacteria 13206
465 Ga0207639_10022031 3300026041 Bacteria 4585
466 Ga0207678_10030191 3300026067 Bacteria 4732
467 Ga0207678_10203779 3300026067 Bacteria 1692
468 Ga0207708_10138834 3300026075 Bacteria 1905
469 Ga0207702_10047328 3300026078 Bacteria 3624
470 Ga0207702_10229184 3300026078 Bacteria 1735
471 Ga0207641_10002637 3300026088 Bacteria 16416
472 Ga0207641_10149067 3300026088 Bacteria 2117
473 Ga0207641_10219612 3300026088 Bacteria 1762
474 Ga0207641_10288792 3300026088 Bacteria 1545
475 Ga0207641_10388443 3300026088 Bacteria 1338
476 Ga0207641_10507861 3300026088 Bacteria 1171
477 Ga0207648_10079881 3300026089 Bacteria 2853
478 Ga0207648_10112760 3300026089 Bacteria 2387
479 Ga0207648_10809765 3300026089 Bacteria 872
480 Ga0207676_10000935 3300026095 Bacteria 22554
481 Ga0207676_10068245 3300026095 Bacteria 2843
482 Ga0207674_10427760 3300026116 Bacteria 1279
483 Ga0207675_100017080 3300026118 Bacteria 6777
484 Ga0207675_100076322 3300026118 Bacteria 3138
485 Ga0207675_100297232 3300026118 Bacteria 1572
486 Ga0207683_10031853 3300026121 Bacteria 4578
487 Ga0207698_10002359 3300026142 Bacteria 11194
488 Ga0207698_10034235 3300026142 Bacteria 3701
489 Ga0207698_10105626 3300026142 Bacteria 2347
490 Ga0207698_10528739 3300026142 Bacteria 1152
491 Ga0209281_1000002 3300027111 Bacteria 1924012
492 Ga0209281_1000076 3300027111 Bacteria 263350
493 Ga0209970_1000439 3300027614 Bacteria 7099
494 Ga0209282_1000048 3300027666 Bacteria 111312
495 Ga0209282_1000783 3300027666 Bacteria 16121
496 Ga0268266_10465838 3300028379 Bacteria 1203
497 Ga0268265_10025855 3300028380 Bacteria 4172
498 Ga0268265_10035974 3300028380 Bacteria 3623
499 Ga0268265_10078795 3300028380 Bacteria 2592
500 Ga0268264_10329979 3300028381 Bacteria 1445
501 Ga0268264_10433089 3300028381 Bacteria 1270
502 Ga0307517_10176468 3300028786 Bacteria 1390
503 Ga0307515_10000104 3300028794 Bacteria 198238
504 Ga0307515_10001447 3300028794 Bacteria 53309
505 Ga0307515_10001910 3300028794 Bacteria 46279
506 Ga0307515_10007756 3300028794 Bacteria 21127
507 Ga0307515_10014992 3300028794 Bacteria 14317
508 Ga0307515_10030798 3300028794 Bacteria 8986
509 Ga0307515_10148686 3300028794 Bacteria 2463
510 Ga0307515_10254821 3300028794 Bacteria 1501
511 Ga0307512_10015937 3300030522 Bacteria 6950
512 Ga0316176_1160931 3300030732 Bacteria 1792
513 Ga0314311_1018871 3300030733 Bacteria 5580
514 Ga0316180_1072696 3300030736 Bacteria 1336
515 Ga0316183_1116903 3300030742 Bacteria 5351
516 Ga0316182_1114331 3300030745 Bacteria 1564
517 Ga0265327_10007552 3300031251 Bacteria 8358
518 Ga0265327_10120075 3300031251 Bacteria 1246
519 Ga0307513_10007505 3300031456 Bacteria 14118
520 Ga0307513_10013996 3300031456 Bacteria 9828
521 Ga0307513_10247073 3300031456 Bacteria 1584
522 Ga0307509_10228856 3300031507 Bacteria 1664
523 Ga0307408_100000425 3300031548 Bacteria 37508
524 Ga0307408_100249290 3300031548 Bacteria 1464
525 Ga0307408_100541879 3300031548 Bacteria 1025
526 Ga0307408_100654356 3300031548 Bacteria 940
527 Ga0307508_10000757 3300031616 Bacteria 38250
528 Ga0307514_10001999 3300031649 Bacteria 22153
529 Ga0307514_10005653 3300031649 Bacteria 11083
530 Ga0307514_10012237 3300031649 Bacteria 7141
531 Ga0307514_10154761 3300031649 Bacteria 1531
532 Ga0265314_10024093 3300031711 Bacteria 4623
533 Ga0265314_10219171 3300031711 Bacteria 1112
534 Ga0307516_10000879 3300031730 Bacteria 41327
535 Ga0307516_10009691 3300031730 Bacteria 10701
536 Ga0307405_10025478 3300031731 Bacteria 3397
537 Ga0307405_10058986 3300031731 Bacteria 2417
538 Ga0307405_10071422 3300031731 Bacteria 2233
539 Ga0307405_10082685 3300031731 Bacteria 2102
540 Ga0307405_10153675 3300031731 Bacteria 1621
541 Ga0307405_10427278 3300031731 Bacteria 1044
542 Ga0307413_10045463 3300031824 Bacteria 2603
543 Ga0307413_10096006 3300031824 Bacteria 1945
544 Ga0307413_10516354 3300031824 Bacteria 962
545 Ga0307410_10023794 3300031852 Bacteria 3816
546 Ga0307410_10359155 3300031852 Bacteria 1166
547 Ga0307406_10000849 3300031901 Bacteria 17191
548 Ga0307406_10014759 3300031901 Bacteria 4501
549 Ga0307406_10024450 3300031901 Bacteria 3608
550 Ga0307406_10092398 3300031901 Bacteria 2040
551 Ga0307412_10019864 3300031911 Bacteria 4078
552 Ga0307412_10048949 3300031911 Bacteria 2782
553 Ga0307412_10068525 3300031911 Bacteria 2413
554 Ga0307412_10212587 3300031911 Bacteria 1477
555 Ga0307412_10214207 3300031911 Bacteria 1472
556 Ga0307412_10345433 3300031911 Bacteria 1192
557 Ga0307409_100002108 3300031995 Bacteria 10241
558 Ga0307409_100016392 3300031995 Bacteria 4901
559 Ga0307409_100865692 3300031995 Bacteria 915
560 Ga0307416_100000974 3300032002 Bacteria 15139
561 Ga0307416_100039991 3300032002 Bacteria 3637
562 Ga0307416_100458218 3300032002 Bacteria 1329
563 Ga0307414_10200561 3300032004 Bacteria 1622
564 Ga0307411_10016597 3300032005 Bacteria 4171
565 Ga0307411_10028408 3300032005 Bacteria 3400
566 Ga0307411_10699883 3300032005 Bacteria 882
567 Ga0307415_100016196 3300032126 Bacteria 4437
568 Ga0395899_0001056 3300037312 Bacteria 24893
569 Ga0395900_0332891 3300037418 Bacteria 1496
570 Ga0395900_0760098 3300037418 Bacteria 899
571 Ga0395898_0004283 3300037466 Bacteria 15647
572 Ga0395898_0079618 3300037466 Bacteria 3161
573 Ga0395905_0001044 3300037471 Bacteria 35045
574 Ga0395905_0020660 3300037471 Bacteria 6234
575 Ga0395901_0000922 3300038443 Bacteria 32031
576 Ga0395901_0063696 3300038443 Bacteria 3838
577 Ga0436365_1028618 3300039437 Bacteria 913
578 Ga0436361_0335187 3300039447 Bacteria 21707
579 Ga0436361_0432344 3300039447 Bacteria 27994
580 Ga0436363_1708688 3300039450 Bacteria 3412
581 Ga0439436_0000115 3300041404 Bacteria 18475
582 Ga0439436_0010409 3300041404 Bacteria 2837
583 Ga0439439_0068671 3300041406 Bacteria 947
584 Ga0439439_0075406 3300041406 Bacteria 907
585 Ga0439447_022188 3300041407 Bacteria 1665
586 Ga0439465_0000808 3300041413 Bacteria 9836
587 Ga0439465_0023133 3300041413 Bacteria 1955
588 Ga0451789_0593619 3300041443 Bacteria 1372
589 Ga0451795_1233687 3300041456 Bacteria 1933
590 Ga0451800_0693667 3300041459 Bacteria 1532
591 Ga0451804_0092695 3300041463 Bacteria 860
592 Ga0451853_0033084 3300041512 Bacteria 1333
593 Ga0439433_0000104 3300041999 Bacteria 11856
594 Ga0439445_0002012 3300042004 Bacteria 4488
595 Ga0439448_0116250 3300042005 Bacteria 916
596 Ga0439432_001851 3300042006 Bacteria 7941
597 Ga0439449_0002196 3300042007 Bacteria 7682
598 Ga0439449_0004888 3300042007 Bacteria 5162
599 Ga0439449_0107901 3300042007 Bacteria 1030
600 Ga0439450_032827 3300042008 Bacteria 1174
601 Ga0439452_000603 3300042010 Bacteria 18494
602 Ga0439452_009911 3300042010 Bacteria 2792
603 Ga0450919_003171 3300042121 Bacteria 2085
604 Ga0450919_011728 3300042121 Bacteria 996
605 Ga0450920_007152 3300042122 Bacteria 2018
606 Ga0450920_017409 3300042122 Bacteria 1374
607 Ga0450890_007008 3300042127 Bacteria 1437
608 Ga0450896_027095 3300042133 Bacteria 856
609 Ga0450898_004259 3300042134 Bacteria 2105
610 Ga0450910_007614 3300042147 Bacteria 1512
611 Ga0439446_0077242 3300042156 Bacteria 1026
612 Ga0450908_016249 3300042184 Bacteria 1328
613 Ga0439434_0049774 3300042435 Bacteria 1297
614 Ga0450918_000692 3300042531 Bacteria 7127
615 Ga0450918_002503 3300042531 Bacteria 3469
616 Ga0451577_0000142 3300042876 Bacteria 160598
617 Ga0451577_0013160 3300042876 Bacteria 7753
618 Ga0453684_0000126 3300044712 Bacteria 336395
619 Ga0453684_0288399 3300044712 Bacteria 1869
620 Ga0466960_0046143 3300044901 Bacteria 2085
621 Ga0451576_0008009 3300045051 Bacteria 12485
622 Ga0451576_0012713 3300045051 Bacteria 9450
623 Ga0451576_0083681 3300045051 Bacteria 3319
624 Ga0451576_0425718 3300045051 Bacteria 1393
625 Ga0495590_0032979 3300046457 Bacteria 1811
626 Ga0495650_0000131 3300046471 Bacteria 174698
627 Ga0495650_0000189 3300046471 Bacteria 133931
628 Ga0495650_0002492 3300046471 Bacteria 14791
629 Ga0495605_0000003 3300046474 Bacteria 491502
630 Ga0495585_0143894 3300046492 Bacteria 1247
631 Ga0495596_0004647 3300046500 Bacteria 6641
632 Ga0495607_0011973 3300046501 Bacteria 5743
633 Ga0495610_0008515 3300046512 Bacteria 6625
634 Ga0495616_0007192 3300046513 Bacteria 6673
635 Ga0495616_0027530 3300046513 Bacteria 3015
636 Ga0495631_0008971 3300046518 Bacteria 5014
637 Ga0495632_0001209 3300046519 Bacteria 21930
638 Ga0495632_0005271 3300046519 Bacteria 8588
639 Ga0495637_0020430 3300046520 Bacteria 3047
640 Ga0495643_0000328 3300046522 Bacteria 65181
641 Ga0495643_0000702 3300046522 Bacteria 38476
642 Ga0495643_0002881 3300046522 Bacteria 13045
643 Ga0495642_0108684 3300046528 Bacteria 1185
644 Ga0495598_0076028 3300046537 Bacteria 1068
645 Ga0495609_0007705 3300046538 Bacteria 5341
646 Ga0495621_0046084 3300046539 Bacteria 1546
647 Ga0495597_0000024 3300046542 Bacteria 143948
648 Ga0495597_0144395 3300046542 Bacteria 980
649 Ga0495633_0120414 3300046558 Bacteria 1216
650 Ga0495656_0000287 3300046615 Bacteria 17572
651 Ga0495656_0079269 3300046615 Bacteria 1478
652 Ga0495656_0085465 3300046615 Bacteria 1433
653 Ga0495668_0017695 3300046616 Bacteria 4128
654 Ga0495625_0000317 3300046660 Bacteria 73568
655 Ga0495625_0000533 3300046660 Bacteria 55919
656 Ga0495625_0002445 3300046660 Bacteria 20069
657 Ga0495625_0014641 3300046660 Bacteria 6248
658 Ga0495635_0101961 3300046663 Bacteria 1962
659 Ga0495661_0003204 3300046665 Bacteria 12219
660 Ga0495661_0008066 3300046665 Bacteria 7309
661 Ga0495658_0210067 3300046683 Bacteria 1216
662 Ga0495669_0101159 3300046684 Bacteria 1339
663 Ga0495670_0214160 3300046691 Bacteria 1022
664 Ga0495671_0007159 3300046692 Bacteria 6386
665 Ga0495649_0017074 3300046694 Bacteria 4104
666 Ga0495660_0086594 3300046810 Bacteria 1635
667 Ga0495636_0039759 3300047318 Bacteria 1948
668 Ga0495672_0000165 3300047320 Bacteria 96215
669 Ga0495687_010378 3300047443 Bacteria 5112
670 Ga0495687_064799 3300047443 Bacteria 1490
671 Ga0495677_0004557 3300047445 Bacteria 5301
672 Ga0495685_076888 3300047447 Bacteria 1114
673 Ga0495615_0015184 3300048090 Bacteria 1641
674 Ga0495626_0003640 3300048091 Bacteria 9807
675 Ga0495626_0132217 3300048091 Bacteria 1064
676 Ga0496101_0171137 3300048904 Bacteria 1669
677 Ga0496104_0322680 3300048907 Bacteria 1457
678 Ga0496104_0868516 3300048907 Bacteria 807
679 Ga0496105_0165324 3300048908 Bacteria 1815
680 Ga0496108_0291770 3300048911 Bacteria 1420
681 Ga0496109_0069604 3300048912 Bacteria 3228
682 Ga0496109_0357466 3300048912 Bacteria 1380
683 Ga0496114_0043982 3300048917 Bacteria 3704
684 Ga0496116_0017337 3300048919 Bacteria 5592
685 Ga0496116_0043647 3300048919 Bacteria 3053
686 Ga0496117_0073408 3300048920 Bacteria 2282
687 Ga0496117_0209510 3300048920 Bacteria 1094
688 Ga0496118_0027309 3300048921 Bacteria 4835
689 Ga0496118_0147638 3300048921 Bacteria 1477
690 Ga0496121_0027569 3300048924 Bacteria 5313
691 Ga0496121_0034342 3300048924 Bacteria 4566
692 Ga0496121_0290683 3300048924 Bacteria 1113
693 Ga0496122_0001392 3300048925 Bacteria 39241
694 Ga0496122_0001678 3300048925 Bacteria 34323
695 Ga0496122_0019689 3300048925 Bacteria 6150
696 Ga0496122_0020671 3300048925 Bacteria 5931
697 Ga0496123_0000102 3300048926 Bacteria 169327
698 Ga0496123_0015355 3300048926 Bacteria 6285
699 Ga0496123_0019688 3300048926 Bacteria 5312
700 Ga0496123_0026399 3300048926 Bacteria 4350
701 Ga0496124_0000126 3300048927 Bacteria 159539
702 Ga0496124_0118206 3300048927 Bacteria 2122
703 Ga0496124_0146253 3300048927 Bacteria 1859
704 Ga0496125_0003314 3300048928 Bacteria 19714
705 Ga0496125_0005567 3300048928 Bacteria 13929
706 Ga0496125_0006122 3300048928 Bacteria 13124
707 Ga0496125_0008416 3300048928 Bacteria 10802
708 Ga0496125_0044650 3300048928 Bacteria 3743
709 Ga0496125_0079741 3300048928 Bacteria 2509
710 Ga0496126_0017829 3300048929 Bacteria 7065
711 Ga0495678_032313 3300049459 Bacteria 2172
712 Ga0501225_0005608 3300049705 Bacteria 3678
713 Ga0501262_000328 3300049759 Bacteria 5721
714 nmdc:mga03683_136909_c1 3300050489 Bacteria 1099
715 nmdc:mga03683_44530_c1 3300050489 Bacteria 1834
716 nmdc:mga00v17_135128_c1 3300050491 Bacteria 1578
717 nmdc:mga00v17_207639_c1 3300050491 Bacteria 1267
718 nmdc:mga00v17_65801_c1 3300050491 Bacteria 2237
719 nmdc:mga0yw44_97375_c1 3300050492 Bacteria 1869
720 nmdc:mga0k408_132862_c1 3300050493 Bacteria 1478
721 nmdc:mga0k408_256104_c1 3300050493 Bacteria 1045
722 nmdc:mga0k408_40364_c1 3300050493 Bacteria 2685
723 nmdc:mga0k408_60761_c1 3300050493 Bacteria 2196
724 nmdc:mga07m45_10975_c1 3300050496 Bacteria 4747
725 nmdc:mga07m45_28932_c1 3300050496 Bacteria 3060
726 nmdc:mga07m45_55894_c1 3300050496 Bacteria 2231
727 nmdc:mga07m45_717_c1 3300050496 Bacteria 14101
728 nmdc:mga07m45_789_c1 3300050496 Bacteria 13618
729 Ga0495612_0075512 3300053078 Bacteria 1411
730 Ga0500610_0002345 3300053079 Bacteria 6930
731 Ga0500610_0031775 3300053079 Bacteria 2684
732 Ga0500578_0000040 3300053086 Bacteria 133601
733 Ga0500651_0000028 3300053093 Bacteria 114592
734 Ga0500651_0126960 3300053093 Bacteria 1544
735 Ga0500571_000016 3300053110 Bacteria 64989
736 Ga0500607_002724 3300053121 Bacteria 13842
737 Ga0500642_0003186 3300053130 Bacteria 4923
738 Ga0500652_003243 3300053131 Bacteria 4922
739 Ga0500655_001317 3300053133 Bacteria 4705
740 Ga0500658_0000097 3300053134 Bacteria 39997
741 Ga0500658_0001213 3300053134 Bacteria 10478
742 Ga0500616_0052203 3300053153 Bacteria 2151
743 Ga0500616_0071872 3300053153 Bacteria 1760
744 Ga0500622_0000138 3300053156 Bacteria 77892
745 Ga0500634_0006895 3300053161 Bacteria 5543
746 Ga0500645_000326 3300053730 Bacteria 33814
747 Ga0500645_003804 3300053730 Bacteria 5994
748 2511245625 2511231002 Bacteria 5042903
749 2511249593 2511231003 Bacteria 5606035
750 2511384046 2511231026 Bacteria 5225445
751 2513230505 2513020051 Bacteria 6053213
752 2513953948 2513237150 Bacteria 6553639
753 2514040083 2513237165 Bacteria 6771773
754 2521560206 2521172590 Bacteria 5047645
755 2548498878 2547132374 Bacteria 5530232
756 2550695325 2548876994 Bacteria 4904866
757 2553005006 2551306416 Bacteria 6152985
758 2587725780 2585428057 Bacteria 6737412
759 2587735171 2585428058 Bacteria 6853932
760 2587758779 2585428062 Bacteria 6842168
761 2588290711 2588253510 Bacteria 6901809
762 2599623026 2599185214 Bacteria 8209958
763 2599674673 2599185226 Bacteria 8233575
764 2599680630 2599185227 Bacteria 8246414
765 2599692645 2599185229 Bacteria 8216126
766 2643867923 2643221570 Bacteria 5103772
767 2643936454 2643221585 Bacteria 5812563
768 2643972211 2643221592 Bacteria 6608788
769 2643991788 2643221596 Bacteria 5006805
770 2644026226 2643221603 Bacteria 6147767
771 2644058982 2643221609 Bacteria 6756331
772 2644071209 2643221611 Bacteria 6820941
773 2644141678 2643221625 Bacteria 6512927
774 2644162012 2643221628 Bacteria 5745828
775 2644248716 2643221644 Bacteria 6865017
776 2644275551 2643221648 Bacteria 6521465
777 2644293532 2643221652 Bacteria 5140275
778 2644302834 2643221654 Bacteria 5273570
779 2644317810 2643221656 Bacteria 5809961
780 2644325308 2643221658 Bacteria 6064537
781 2644399045 2643221672 Bacteria 6322190
782 2644467287 2643221683 Bacteria 5749203
783 2644648339 2643221717 Bacteria 5676132
784 2722886009 2721755523 Bacteria 6430384
785 2738720945 2738541277 Bacteria 7458140
786 2738886327 2738541307 Bacteria 8606193
787 2739246237 2738543012 Bacteria 7115078
788 2739252143 2738543013 Bacteria 5618633
789 2739280144 2738543019 Bacteria 7459457
790 2765571373 2765235838 Bacteria 5445269
791 2808982459 2808606386 Bacteria 4471946
792 2809129714 2808606415 Bacteria 4576710
793 2809149231 2808606419 Bacteria 4576925
794 2816471385 2816332133 Bacteria 7249298
795 2819592931 2818991445 Bacteria 4955017
796 2819602514 2818991446 Bacteria 7757362
797 2819616563 2818991449 Bacteria 5518009
798 2831272046 2831265667 Bacteria 7184833
799 2834641213 2834641062 Bacteria 5559922
800 2838059865 2838054893 Bacteria 7451788
801 2839099214 2839094727 Bacteria 5534556
802 2839142722 2839138175 Bacteria 6549354
803 2842677734 2842677519 Bacteria 5615038
804 2842718978 2842718218 Bacteria 4560148
805 2842736254 2842733646 Bacteria 5716726
806 2842748750 2842747753 Bacteria 5578255
807 2852619372 2852618963 Bacteria 4577824
808 2881102746 2881101125 Bacteria 4590519
809 2884812088 2884811622 Bacteria 5552861
810 2884838558 2884836552 Bacteria 5219991
811 2884854849 2884852848 Bacteria 5221161
812 2885194884 2885192300 Bacteria 5882526
813 2885198491 2885198086 Bacteria 7212419
814 2885212129 2885211737 Bacteria 7212420
815 2896156482 2896154374 Bacteria 5221518
816 2899928663 2899924645 Bacteria 7487985
817 2901312407 2901300506 Bacteria 8463898
818 2904440754 2904439833 Bacteria 5931679
819 2904451997 2904449895 Bacteria 6927402
820 2904458857 2904456579 Bacteria 6819253
821 2904481065 2904479285 Bacteria 5073931
822 2904535353 2904530477 Bacteria 5876334
823 2904547444 2904541872 Bacteria 8915136
824 2904589169 2904584206 Bacteria 6028872
825 2904594613 2904589729 Bacteria 6113573
826 2904605841 2904601388 Bacteria 5884906
827 2919048919 2919046199 Bacteria 5567169
828 2919084077 2919079590 Bacteria 5946433
829 2919467019 2919462493 Bacteria 5817112
830 2919707213 2919704043 Bacteria 5560311
831 2923513957 2923510766 Bacteria 5926163
832 2928043392 2928037797 Bacteria 7273642
833 2928050834 2928044640 Bacteria 7271509
834 2928056264 2928051484 Bacteria 7773759
835 2928066257 2928064002 Bacteria 7419480
836 2928075894 2928070936 Bacteria 8062541
837 2928090089 2928084124 Bacteria 7159212
838 2928115692 2928115317 Bacteria 6477646
839 2928134769 2928130867 Bacteria 5467269
840 2929165054 2929160207 Bacteria 9075316
841 2929523464 2929520902 Bacteria 6765052
842 2945910335 2945909444 Bacteria 7065066
843 2945946305 2945945610 Bacteria 5951079
844 2945975906 2945972063 Bacteria 6086495
845 2945987621 2945984333 Bacteria 7358892
846 2954768673 2954767861 Bacteria 5535784
847 2974320177 2974320154 Bacteria 4571377
848 2990713710 2990710928 Bacteria 5002431
849 644746743 644736347 Bacteria 6476522
850 8003401105 8003400568 Bacteria 5535898
851 Ga0451833_0503407
852 JGI24740J21852_10006051
853 JGI24739J22299_10007959
854 JGI25155J39150_1000373
855 JGI25155J39150_1000448
856 JGI25156J39149_1000117
857 JGI25162J39368_1003833
858 JGI25154J39366_1000107
859 JGI25154J39366_1000249
860 JGI25157J39369_1000512
861 JGI25152J39213_1001037
862 JGI25150J39212_1001492
863 JGI25150J39212_1003450
864 JGI25159J45721_1000938
865 JGI25159J45721_1019573
866 JGI25151J46595_10005990
867 JGI25151J46595_10006065
868 JGI25151J46595_10006915
869 JGI25151J46595_10008499
870 JGI25151J46595_10026498
871 JGI25151J46595_10037187
872 JGI25153J46596_10001796
873 JGI25153J46596_10006203
874 rootH1_10006961
875 rootH2_10063583
876 rootL2_10008719
877 rootL2_10049725
878 JGI25160J50197_1000226
879 JGI25160J50197_1001281
880 JGI25160J50197_1016203
881 JGI25161J50226_1000037
882 JGI25161J50226_1002873
883 JGI25161J50226_1003897
884 Ga0006562J51391_1053388
885 Ga0055538_1000085
886 Ga0055539_1000126
887 Ga0055533_1000133
888 Ga0055532_1000044
889 Ga0055525_1000174
890 Ga0055535_1000075
891 Ga0055535_1004532
892 Ga0055542_1000059
893 Ga0055526_1002374
894 Ga0055526_1004721
895 Ga0055526_1009710
896 Ga0055526_1020944
897 Ga0055526_1024924
898 Ga0055537_1000209
899 Ga0055537_1001009
900 Ga0055537_1006249
901 Ga0055537_1015227
902 Ga0055524_1000233
903 Ga0055524_1001273
904 Ga0055524_1001585
905 Ga0055524_1008286
906 Ga0055536_1000110
907 Ga0055536_1005196
908 Ga0055536_1007740
909 Ga0055536_1012477
910 Ga0055536_1035477
911 Ga0055534_1000204
912 Ga0055534_1000762
913 Ga0055534_1000901
914 Ga0055534_1002032
915 Ga0055528_1001708
916 Ga0055528_1001972
917 Ga0055528_1031882
918 Ga0055530_10000758
919 Ga0055530_10001159
920 Ga0055530_10002021
921 Ga0055530_10002991
922 Ga0055540_1000080
923 Ga0055540_1000137
924 Ga0055540_1008445
925 Ga0055540_1015866
926 Ga0055540_1045518
927 Ga0055531_10001920
928 Ga0055531_10002432
929 Ga0055531_10006303
930 Ga0055531_10014072
931 Ga0055531_10017034
932 Ga0055541_1000085
933 Ga0055543_1001262
934 Ga0065165_1002511
935 Ga0065165_1010738
936 Ga0065165_1011902
937 Ga0065165_1024021
938 Ga0065714_10018134
939 Ga0065704_10090130
940 Ga0065704_10095050
941 Ga0070683_100188826
942 Ga0070670_100001478
943 Ga0070677_10059413
944 Ga0070677_10062281
945 Ga0068869_100312709
946 Ga0070666_10074775
947 Ga0068868_100078023
948 Ga0068868_100105985
949 Ga0068868_100107238
950 Ga0068868_100419992
951 Ga0070689_100016515
952 Ga0070668_100052259
953 Ga0070668_100125281
954 Ga0070669_100024394
955 Ga0070669_100047396
956 Ga0070669_100258273
957 Ga0070675_100000072
958 Ga0070675_100001530
959 Ga0070671_100002032
960 Ga0070671_100008208
961 Ga0070671_100027427
962 Ga0070671_100139968
963 Ga0070674_100098177
964 Ga0070674_100274601
965 Ga0070673_100003979
966 Ga0070673_100068932
967 Ga0070673_100207365
968 Ga0070673_100292490
969 Ga0070673_100297708
970 Ga0070673_100345816
971 Ga0070673_100632013
972 Ga0070688_100014106
973 Ga0070667_100016510
974 Ga0070667_100020627
975 Ga0070667_100529164
976 Ga0070667_100617186
977 Ga0070663_100337433
978 Ga0070678_100062379
979 Ga0070678_100344769
980 Ga0070678_100461159
981 Ga0070662_100192579
982 Ga0068867_100010282
983 Ga0068867_100393172
984 Ga0070706_100000815
985 Ga0068853_100086219
986 Ga0070672_100027211
987 Ga0070672_100039485
988 Ga0070672_100087689
989 Ga0070672_100182461
990 Ga0070672_100272449
991 Ga0070665_100059422
992 Ga0070665_100090744
993 Ga0068855_100008256
994 Ga0068855_100012665
995 Ga0068855_100084137
996 Ga0070664_100006488
997 Ga0070664_100138105
998 Ga0070664_100189648
999 Ga0068857_100113011
1000 Ga0068857_100184535
1001 Ga0068857_100214539
1002 Ga0068854_100021162
1003 Ga0068856_100060699
1004 Ga0068852_100001472
1005 Ga0068852_100259021
1006 Ga0068852_100733270
1007 Ga0068859_100009439
1008 Ga0068859_100023760
1009 Ga0068864_100000365
1010 Ga0068864_100008762
1011 Ga0068864_100015666
1012 Ga0068864_100057120
1013 Ga0068864_100102794
1014 Ga0068861_100103488
1015 Ga0068861_100517631
1016 Ga0068851_10022301
1017 Ga0068851_10064125
1018 Ga0068863_100006233
1019 Ga0068863_100058427
1020 Ga0068863_100356237
1021 Ga0068858_100002406
1022 Ga0068860_100570550
1023 Ga0068862_100048603
1024 Ga0068862_100081207
1025 Ga0075365_10030760
1026 Ga0075363_100184638
1027 Ga0075363_100201294
1028 Ga0075363_100206388
1029 Ga0075364_10013074
1030 Ga0075364_10015271
1031 Ga0075364_10078247
1032 Ga0075364_10152916
1033 Ga0075432_10005480
1034 Ga0075362_10012457
1035 Ga0075362_10031439
1036 Ga0075366_10002800
1037 Ga0075366_10011897
1038 Ga0075366_10052784
1039 Ga0075366_10071406
1040 Ga0075366_10076715
1041 Ga0075366_10091014
1042 Ga0075366_10093324
1043 Ga0075366_10097344
1044 Ga0075366_10276744
1045 Ga0097621_100026071
1046 Ga0097621_100155085
1047 Ga0097621_100206637
1048 Ga0097621_100291159
1049 Ga0075370_10001172
1050 Ga0075370_10002892
1051 Ga0075370_10027339
1052 Ga0075370_10030647
1053 Ga0075370_10035165
1054 Ga0075370_10123168
1055 Ga0075370_10181047
1056 Ga0068871_100021764
1057 Ga0068871_100157315
1058 Ga0068871_100269311
1059 Ga0097620_100009439
1060 Ga0097620_100023761
1061 Ga0079104_1000020
1062 Ga0079104_1000267
1063 Ga0079104_1016875
1064 Ga0099826_10000014
1065 Ga0105251_10008698
1066 Ga0105244_10009554
1067 Ga0105250_10001195
1068 Ga0105240_10003351
1069 Ga0105240_10418698
1070 Ga0105240_10749569
1071 Ga0105245_10057279
1072 Ga0105243_10001263
1073 Ga0105243_10009492
1074 Ga0105243_10022596
1075 Ga0105241_10186487
1076 Ga0105242_10004100
1077 Ga0105242_10012580
1078 Ga0105248_10014023
1079 Ga0105248_10222044
1080 Ga0105248_10463392
1081 Ga0105237_10022411
1082 Ga0105237_10091950
1083 Ga0105237_10138414
1084 Ga0105237_10437499
1085 Ga0105238_10000038
1086 Ga0105238_10033619
1087 Ga0105238_10387968
1088 Ga0105249_10039063
1089 Ga0105249_11036917
1090 Ga0105239_10010497
1091 Ga0105239_10509832
1092 Ga0105246_10024446
1093 Ga0157373_10021391
1094 Ga0157371_10170971
1095 Ga0157370_10046759
1096 Ga0157369_10009779
1097 Ga0157374_10017623
1098 Ga0157378_10262224
1099 Ga0163162_10025495
1100 Ga0163162_11139232
1101 Ga0157372_10636484
1102 Ga0157375_10022777
1103 Ga0157375_10057967
1104 Ga0157375_10210614
1105 Ga0157375_10277650
1106 Ga0157375_10530793
1107 Ga0163163_10001376
1108 Ga0163163_10160807
1109 Ga0157380_10944521
1110 Ga0182008_10002120
1111 Ga0182008_10003759
1112 Ga0182008_10110297
1113 Ga0182008_10158269
1114 Ga0157379_10025922
1115 Ga0157379_10207554
1116 Ga0157379_10305898
1117 Ga0157376_10192263
1118 Ga0157376_10305230
1119 Ga0182006_1004394
1120 Ga0182007_10000330
1121 Ga0182007_10001131
1122 Ga0182007_10112785
1123 Ga0183362_10003
1124 Ga0163161_10000118
1125 Ga0163161_10006973
1126 Ga0163161_10053410
1127 Ga0163161_10174796
1128 Ga0213872_10107482
1129 Ga0209435_100004
1130 Ga0209435_100239
1131 Ga0209436_113575
1132 Ga0209784_100021
1133 Ga0209566_100039
1134 Ga0209674_100036
1135 Ga0209672_101521
1136 Ga0209147_100011
1137 Ga0209147_104501
1138 Ga0209563_100040
1139 Ga0209437_100207
1140 Ga0209258_100078
1141 Ga0209258_100528
1142 Ga0207425_1000191
1143 Ga0207425_1023809
1144 Ga0209646_1000141
1145 Ga0209646_1000149
1146 Ga0209646_1000233
1147 Ga0209026_1000066
1148 Ga0209026_1000931
1149 Ga0209677_100023
1150 Ga0209148_1000086
1151 Ga0209759_1000072
1152 Ga0209759_1000182
1153 Ga0209129_1000116
1154 Ga0209129_1001707
1155 Ga0209129_1002001
1156 Ga0209565_1000045
1157 Ga0209565_1000067
1158 Ga0209565_1000133
1159 Ga0209565_1000987
1160 Ga0207666_1010003
1161 Ga0209673_1000190
1162 Ga0209673_1000315
1163 Ga0209673_1000813
1164 Ga0209673_1002491
1165 Ga0209673_1027509
1166 Ga0209673_1031648
1167 Ga0209673_1037781
1168 Ga0209130_1000159
1169 Ga0209130_1000202
1170 Ga0209130_1000307
1171 Ga0209130_1004923
1172 Ga0209130_1014857
1173 Ga0209130_1017200
1174 Ga0209675_1000038
1175 Ga0209675_1000247
1176 Ga0209675_1000282
1177 Ga0209675_1002196
1178 Ga0209675_1002329
1179 Ga0209675_1005053
1180 Ga0209675_1013191
1181 Ga0209676_1000013
1182 Ga0209676_1000064
1183 Ga0209676_1000125
1184 Ga0209676_1000732
1185 Ga0209676_1002481
1186 Ga0209676_1005722
1187 Ga0209676_1028562
1188 Ga0209676_1061991
1189 Ga0209025_1000256
1190 Ga0209025_1000293
1191 Ga0209025_1000899
1192 Ga0209025_1001146
1193 Ga0209025_1001385
1194 Ga0209025_1001957
1195 Ga0209025_1010545
1196 Ga0209025_1015359
1197 Ga0209025_1043423
1198 Ga0209564_1000201
1199 Ga0209564_1000462
1200 Ga0209564_1000918
1201 Ga0209564_1001999
1202 Ga0209564_1002274
1203 Ga0209758_1000034
1204 Ga0209758_1000126
1205 Ga0209758_1010677
1206 Ga0209758_1011684
1207 Ga0209758_1032751
1208 Ga0209050_1000008
1209 Ga0209050_1000012
1210 Ga0209050_1002321
1211 Ga0209050_1002676
1212 Ga0209050_1014676
1213 Ga0209050_1017651
1214 Ga0209050_1046391
1215 Ga0209256_1000066
1216 Ga0209256_1000105
1217 Ga0209256_1000193
1218 Ga0209256_1000203
1219 Ga0209256_1000270
1220 Ga0207426_1000145
1221 Ga0207426_1000244
1222 Ga0207426_1000369
1223 Ga0207426_1002799
1224 Ga0209051_1000005
1225 Ga0209051_1000035
1226 Ga0209051_1000134
1227 Ga0209051_1000322
1228 Ga0209051_1000344
1229 Ga0209051_1000524
1230 Ga0209051_1012706
1231 Ga0209051_1040833
1232 Ga0209051_1043998
1233 Ga0209257_1000024
1234 Ga0209257_1000048
1235 Ga0209257_1000346
1236 Ga0209257_1000849
1237 Ga0209257_1001178
1238 Ga0209257_1016979
1239 Ga0209257_1018695
1240 Ga0207656_10014447
1241 Ga0207656_10044281
1242 Ga0207696_1002283
1243 Ga0207655_1002165
1244 Ga0207713_1019388
1245 Ga0207682_10005101
1246 Ga0207682_10073804
1247 Ga0207642_10200607
1248 Ga0207688_10081355
1249 Ga0207643_10037154
1250 Ga0207643_10267740
1251 Ga0207684_10001165
1252 Ga0207695_10000748
1253 Ga0207695_10000979
1254 Ga0207695_10138986
1255 Ga0207695_10156465
1256 Ga0207671_10010004
1257 Ga0207671_10087522
1258 Ga0207649_10184320
1259 Ga0207649_10206882
1260 Ga0207649_10269994
1261 Ga0207681_10016792
1262 Ga0207694_10000069
1263 Ga0207694_10117268
1264 Ga0207650_10024897
1265 Ga0207650_10112712
1266 Ga0207650_10193708
1267 Ga0207650_10420448
1268 Ga0207650_10457438
1269 Ga0207659_10001521
1270 Ga0207659_10015117
1271 Ga0207644_10003206
1272 Ga0207644_10005562
1273 Ga0207644_10008749
1274 Ga0207706_10031489
1275 Ga0207706_10141945
1276 Ga0207686_10006431
1277 Ga0207686_10021415
1278 Ga0207709_10000055
1279 Ga0207709_10000410
1280 Ga0207709_10001314
1281 Ga0207670_10019292
1282 Ga0207669_10378592
1283 Ga0207669_10464626
1284 Ga0207704_10393562
1285 Ga0207691_10011628
1286 Ga0207691_10016757
1287 Ga0207691_10019387
1288 Ga0207691_10091541
1289 Ga0207691_10130841
1290 Ga0207691_10219990
1291 Ga0207711_10015665
1292 Ga0207711_10066801
1293 Ga0207711_10178069
1294 Ga0207661_10261559
1295 Ga0207679_10004569
1296 Ga0207679_10264253
1297 Ga0207667_10000043
1298 Ga0207667_10011296
1299 Ga0207667_10020155
1300 Ga0207667_10034212
1301 Ga0207651_10008310
1302 Ga0207651_10017232
1303 Ga0207668_10028782
1304 Ga0207668_10066281
1305 Ga0207640_10006631
1306 Ga0207658_10009364
1307 Ga0207658_10021392
1308 Ga0207658_10074457
1309 Ga0207658_10499404
1310 Ga0207677_10020400
1311 Ga0207677_10040368
1312 Ga0207677_10438947
1313 Ga0207703_10003467
1314 Ga0207639_10022031
1315 Ga0207678_10030191
1316 Ga0207678_10203779
1317 Ga0207708_10138834
1318 Ga0207702_10047328
1319 Ga0207702_10229184
1320 Ga0207641_10002637
1321 Ga0207641_10149067
1322 Ga0207641_10219612
1323 Ga0207641_10288792
1324 Ga0207641_10388443
1325 Ga0207641_10507861
1326 Ga0207648_10079881
1327 Ga0207648_10112760
1328 Ga0207648_10809765
1329 Ga0207676_10000935
1330 Ga0207676_10068245
1331 Ga0207674_10427760
1332 Ga0207675_100017080
1333 Ga0207675_100076322
1334 Ga0207675_100297232
1335 Ga0207683_10031853
1336 Ga0207698_10002359
1337 Ga0207698_10034235
1338 Ga0207698_10105626
1339 Ga0207698_10528739
1340 Ga0209281_1000002
1341 Ga0209281_1000076
1342 Ga0209970_1000439
1343 Ga0209282_1000048
1344 Ga0209282_1000783
1345 Ga0268266_10465838
1346 Ga0268265_10025855
1347 Ga0268265_10035974
1348 Ga0268265_10078795
1349 Ga0268264_10329979
1350 Ga0268264_10433089
1351 Ga0307517_10176468
1352 Ga0307515_10000104
1353 Ga0307515_10001447
1354 Ga0307515_10001910
1355 Ga0307515_10007756
1356 Ga0307515_10014992
1357 Ga0307515_10030798
1358 Ga0307515_10148686
1359 Ga0307515_10254821
1360 Ga0307512_10015937
1361 Ga0316176_1160931
1362 Ga0314311_1018871
1363 Ga0316180_1072696
1364 Ga0316183_1116903
1365 Ga0316182_1114331
1366 Ga0265327_10007552
1367 Ga0265327_10120075
1368 Ga0307513_10007505
1369 Ga0307513_10013996
1370 Ga0307513_10247073
1371 Ga0307509_10228856
1372 Ga0307408_100000425
1373 Ga0307408_100249290
1374 Ga0307408_100541879
1375 Ga0307408_100654356
1376 Ga0307508_10000757
1377 Ga0307514_10001999
1378 Ga0307514_10005653
1379 Ga0307514_10012237
1380 Ga0307514_10154761
1381 Ga0265314_10024093
1382 Ga0265314_10219171
1383 Ga0307516_10000879
1384 Ga0307516_10009691
1385 Ga0307405_10025478
1386 Ga0307405_10058986
1387 Ga0307405_10071422
1388 Ga0307405_10082685
1389 Ga0307405_10153675
1390 Ga0307405_10427278
1391 Ga0307413_10045463
1392 Ga0307413_10096006
1393 Ga0307413_10516354
1394 Ga0307410_10023794
1395 Ga0307410_10359155
1396 Ga0307406_10000849
1397 Ga0307406_10014759
1398 Ga0307406_10024450
1399 Ga0307406_10092398
1400 Ga0307412_10019864
1401 Ga0307412_10048949
1402 Ga0307412_10068525
1403 Ga0307412_10212587
1404 Ga0307412_10214207
1405 Ga0307412_10345433
1406 Ga0307409_100002108
1407 Ga0307409_100016392
1408 Ga0307409_100865692
1409 Ga0307416_100000974
1410 Ga0307416_100039991
1411 Ga0307416_100458218
1412 Ga0307414_10200561
1413 Ga0307411_10016597
1414 Ga0307411_10028408
1415 Ga0307411_10699883
1416 Ga0307415_100016196
1417 Ga0395899_0001056
1418 Ga0395900_0332891
1419 Ga0395900_0760098
1420 Ga0395898_0004283
1421 Ga0395898_0079618
1422 Ga0395905_0001044
1423 Ga0395905_0020660
1424 Ga0395901_0000922
1425 Ga0395901_0063696
1426 Ga0436365_1028618
1427 Ga0436361_0335187
1428 Ga0436361_0432344
1429 Ga0436363_1708688
1430 Ga0439436_0000115
1431 Ga0439436_0010409
1432 Ga0439439_0068671
1433 Ga0439439_0075406
1434 Ga0439447_022188
1435 Ga0439465_0000808
1436 Ga0439465_0023133
1437 Ga0451789_0593619
1438 Ga0451795_1233687
1439 Ga0451800_0693667
1440 Ga0451804_0092695
1441 Ga0451853_0033084
1442 Ga0439433_0000104
1443 Ga0439445_0002012
1444 Ga0439448_0116250
1445 Ga0439432_001851
1446 Ga0439449_0002196
1447 Ga0439449_0004888
1448 Ga0439449_0107901
1449 Ga0439450_032827
1450 Ga0439452_000603
1451 Ga0439452_009911
1452 Ga0450919_003171
1453 Ga0450919_011728
1454 Ga0450920_007152
1455 Ga0450920_017409
1456 Ga0450890_007008
1457 Ga0450896_027095
1458 Ga0450898_004259
1459 Ga0450910_007614
1460 Ga0439446_0077242
1461 Ga0450908_016249
1462 Ga0439434_0049774
1463 Ga0450918_000692
1464 Ga0450918_002503
1465 Ga0451577_0000142
1466 Ga0451577_0013160
1467 Ga0453684_0000126
1468 Ga0453684_0288399
1469 Ga0466960_0046143
1470 Ga0451576_0008009
1471 Ga0451576_0012713
1472 Ga0451576_0083681
1473 Ga0451576_0425718
1474 Ga0495590_0032979
1475 Ga0495650_0000131
1476 Ga0495650_0000189
1477 Ga0495650_0002492
1478 Ga0495605_0000003
1479 Ga0495585_0143894
1480 Ga0495596_0004647
1481 Ga0495607_0011973
1482 Ga0495610_0008515
1483 Ga0495616_0007192
1484 Ga0495616_0027530
1485 Ga0495631_0008971
1486 Ga0495632_0001209
1487 Ga0495632_0005271
1488 Ga0495637_0020430
1489 Ga0495643_0000328
1490 Ga0495643_0000702
1491 Ga0495643_0002881
1492 Ga0495642_0108684
1493 Ga0495598_0076028
1494 Ga0495609_0007705
1495 Ga0495621_0046084
1496 Ga0495597_0000024
1497 Ga0495597_0144395
1498 Ga0495633_0120414
1499 Ga0495656_0000287
1500 Ga0495656_0079269
1501 Ga0495656_0085465
1502 Ga0495668_0017695
1503 Ga0495625_0000317
1504 Ga0495625_0000533
1505 Ga0495625_0002445
1506 Ga0495625_0014641
1507 Ga0495635_0101961
1508 Ga0495661_0003204
1509 Ga0495661_0008066
1510 Ga0495658_0210067
1511 Ga0495669_0101159
1512 Ga0495670_0214160
1513 Ga0495671_0007159
1514 Ga0495649_0017074
1515 Ga0495660_0086594
1516 Ga0495636_0039759
1517 Ga0495672_0000165
1518 Ga0495687_010378
1519 Ga0495687_064799
1520 Ga0495677_0004557
1521 Ga0495685_076888
1522 Ga0495615_0015184
1523 Ga0495626_0003640
1524 Ga0495626_0132217
1525 Ga0496101_0171137
1526 Ga0496104_0322680
1527 Ga0496104_0868516
1528 Ga0496105_0165324
1529 Ga0496108_0291770
1530 Ga0496109_0069604
1531 Ga0496109_0357466
1532 Ga0496114_0043982
1533 Ga0496116_0017337
1534 Ga0496116_0043647
1535 Ga0496117_0073408
1536 Ga0496117_0209510
1537 Ga0496118_0027309
1538 Ga0496118_0147638
1539 Ga0496121_0027569
1540 Ga0496121_0034342
1541 Ga0496121_0290683
1542 Ga0496122_0001392
1543 Ga0496122_0001678
1544 Ga0496122_0019689
1545 Ga0496122_0020671
1546 Ga0496123_0000102
1547 Ga0496123_0015355
1548 Ga0496123_0019688
1549 Ga0496123_0026399
1550 Ga0496124_0000126
1551 Ga0496124_0118206
1552 Ga0496124_0146253
1553 Ga0496125_0003314
1554 Ga0496125_0005567
1555 Ga0496125_0006122
1556 Ga0496125_0008416
1557 Ga0496125_0044650
1558 Ga0496125_0079741
1559 Ga0496126_0017829
1560 Ga0495678_032313
1561 Ga0501225_0005608
1562 Ga0501262_000328
1563 nmdc:mga03683_136909_c1
1564 nmdc:mga03683_44530_c1
1565 nmdc:mga00v17_135128_c1
1566 nmdc:mga00v17_207639_c1
1567 nmdc:mga00v17_65801_c1
1568 nmdc:mga0yw44_97375_c1
1569 nmdc:mga0k408_132862_c1
1570 nmdc:mga0k408_256104_c1
1571 nmdc:mga0k408_40364_c1
1572 nmdc:mga0k408_60761_c1
1573 nmdc:mga07m45_10975_c1
1574 nmdc:mga07m45_28932_c1
1575 nmdc:mga07m45_55894_c1
1576 nmdc:mga07m45_717_c1
1577 nmdc:mga07m45_789_c1
1578 Ga0495612_0075512
1579 Ga0500610_0002345
1580 Ga0500610_0031775
1581 Ga0500578_0000040
1582 Ga0500651_0000028
1583 Ga0500651_0126960
1584 Ga0500571_000016
1585 Ga0500607_002724
1586 Ga0500642_0003186
1587 Ga0500652_003243
1588 Ga0500655_001317
1589 Ga0500658_0000097
1590 Ga0500658_0001213
1591 Ga0500616_0052203
1592 Ga0500616_0071872
1593 Ga0500622_0000138
1594 Ga0500634_0006895
1595 Ga0500645_000326
1596 Ga0500645_003804
1597 2511245625
1598 2511249593
1599 2511384046
1600 2513230505
1601 2513953948
1602 2514040083
1603 2521560206
1604 2548498878
1605 2550695325
1606 2553005006
1607 2587725780
1608 2587735171
1609 2587758779
1610 2588290711
1611 2599623026
1612 2599674673
1613 2599680630
1614 2599692645
1615 2643867923
1616 2643936454
1617 2643972211
1618 2643991788
1619 2644026226
1620 2644058982
1621 2644071209
1622 2644141678
1623 2644162012
1624 2644248716
1625 2644275551
1626 2644293532
1627 2644302834
1628 2644317810
1629 2644325308
1630 2644399045
1631 2644467287
1632 2644648339
1633 2722886009
1634 2738720945
1635 2738886327
1636 2739246237
1637 2739252143
1638 2739280144
1639 2765571373
1640 2808982459
1641 2809129714
1642 2809149231
1643 2816471385
1644 2819592931
1645 2819602514
1646 2819616563
1647 2831272046
1648 2834641213
1649 2838059865
1650 2839099214
1651 2839142722
1652 2842677734
1653 2842718978
1654 2842736254
1655 2842748750
1656 2852619372
1657 2881102746
1658 2884812088
1659 2884838558
1660 2884854849
1661 2885194884
1662 2885198491
1663 2885212129
1664 2896156482
1665 2899928663
1666 2901312407
1667 2904440754
1668 2904451997
1669 2904458857
1670 2904481065
1671 2904535353
1672 2904547444
1673 2904589169
1674 2904594613
1675 2904605841
1676 2919048919
1677 2919084077
1678 2919467019
1679 2919707213
1680 2923513957
1681 2928043392
1682 2928050834
1683 2928056264
1684 2928066257
1685 2928075894
1686 2928090089
1687 2928115692
1688 2928134769
1689 2929165054
1690 2929523464
1691 2945910335
1692 2945946305
1693 2945975906
1694 2945987621
1695 2954768673
1696 2974320177
1697 2990713710
1698 644746743
1699 8003401105

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

107

278

0.96

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

1

90

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7738 14 242
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7624 53 241
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7529 48 237
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.7503 14 242
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.737 49 246
ID Description Score Start End Superfamily
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9262 61 243 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.925 51 242 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9137 57 243 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.913 53 245 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9085 56 244 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A6M1LJI3-F1-model_v4 ABC transporter permease 0.9898 2 254 GO:0005886
GO:0055085
AF-E0MTU7-F1-model_v4 ABC transporter, membrane spanning protein 0.9858 6 251 GO:0005886
GO:0055085
AF-A0A2D4RY88-F1-model_v4 ABC transporter permease 0.9854 2 249 GO:0005886
GO:0055085
AF-A0A1H4ZP04-F1-model_v4 NitT/TauT family transport system permease protein 0.985 3 254 GO:0005886
GO:0055085
AF-A0A4P8QRT2-F1-model_v4 ABC transporter permease 0.9848 5 250 GO:0005886
GO:0055085

Map