F483404
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 849 | 444 | 1699 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300041491|Ga0451833_0503407|Ga0451833_0503407_14_874 |
| Length | 286 |
| Sequence | MLAAEKSGTTPEAFIQPIQLSHERDFTDFGVDFDEYHTTHSEENRLLAESIYARLRDGGHIARRSIQQLFDPVKEMFLPTPDHVLRTTVNMAVDGTLWEHALSSLQVVLLGFVIGSSRMAYAAMYPLMTGFNALPKAAFVPILVVWFGIGVGPAVLTAFLISFFPITVNIATGLATLEPELEDVLRVLGAKRWDVLIKIGLPRSMPYFYASLKVAITLAFVGTTVSEMTAANEGIGYLLISAGSSMQMGLAFAGLLVVGAMAMAMYELFAVIEKRTTGWAHRGSNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 89 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 123 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 208 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 209 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 210 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 211 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 212 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 218 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 240 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 241 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 248 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 249 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 250 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 251 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 252 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 253 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 254 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 255 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 256 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 257 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 258 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 259 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 260 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 261 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 262 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 263 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 264 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 267 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 316 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 317 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 318 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 319 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 320 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 323 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 327 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 331 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 332 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 334 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 335 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 336 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 337 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 340 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 342 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 343 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 344 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 345 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 346 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 347 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 348 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 349 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 350 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 351 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 352 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 353 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 354 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 355 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 356 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 357 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 358 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 359 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 360 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 361 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 362 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 363 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 364 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 365 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 366 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 367 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 368 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 369 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 370 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 371 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 372 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 373 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 374 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 375 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 376 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 377 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 378 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 379 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 380 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 381 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 382 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 383 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 384 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 385 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 386 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 387 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 388 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 389 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 390 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 391 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 392 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 393 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 394 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 395 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 396 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 397 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 398 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 399 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 400 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 401 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 402 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 403 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 404 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 405 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 406 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 407 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 408 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 409 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 410 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 411 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 412 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 413 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 414 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 415 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 416 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 417 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 418 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 419 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 420 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 421 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 422 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 423 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 424 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 425 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 426 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 427 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 428 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 429 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 430 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 431 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 432 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 433 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 434 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 435 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 436 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 437 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 438 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 439 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 440 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 441 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 442 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 443 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 444 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.75 |
| Metatranscriptomes | 0.12 |
| Isolates | 12.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.56 |
| Nodule | 1.77 |
| Rhizoplane | 1.77 |
| Rhizosphere | 53.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451833_0503407 | 3300041491 | Bacteria | 1023 |
| 2 | JGI24740J21852_10006051 | 3300001979 | Bacteria | 5058 |
| 3 | JGI24739J22299_10007959 | 3300001989 | Bacteria | 3965 |
| 4 | JGI25155J39150_1000373 | 3300002704 | Bacteria | 13361 |
| 5 | JGI25155J39150_1000448 | 3300002704 | Bacteria | 10615 |
| 6 | JGI25156J39149_1000117 | 3300002705 | Bacteria | 57700 |
| 7 | JGI25162J39368_1003833 | 3300002737 | Bacteria | 3958 |
| 8 | JGI25154J39366_1000107 | 3300002738 | Bacteria | 73482 |
| 9 | JGI25154J39366_1000249 | 3300002738 | Bacteria | 34973 |
| 10 | JGI25157J39369_1000512 | 3300002741 | Bacteria | 23821 |
| 11 | JGI25152J39213_1001037 | 3300002773 | Bacteria | 13241 |
| 12 | JGI25150J39212_1001492 | 3300002774 | Bacteria | 6498 |
| 13 | JGI25150J39212_1003450 | 3300002774 | Bacteria | 3694 |
| 14 | JGI25159J45721_1000938 | 3300002987 | Bacteria | 12728 |
| 15 | JGI25159J45721_1019573 | 3300002987 | Bacteria | 1329 |
| 16 | JGI25151J46595_10005990 | 3300003187 | Bacteria | 6191 |
| 17 | JGI25151J46595_10006065 | 3300003187 | Bacteria | 6145 |
| 18 | JGI25151J46595_10006915 | 3300003187 | Bacteria | 5631 |
| 19 | JGI25151J46595_10008499 | 3300003187 | Bacteria | 4933 |
| 20 | JGI25151J46595_10026498 | 3300003187 | Bacteria | 2338 |
| 21 | JGI25151J46595_10037187 | 3300003187 | Bacteria | 1828 |
| 22 | JGI25153J46596_10001796 | 3300003215 | Bacteria | 12728 |
| 23 | JGI25153J46596_10006203 | 3300003215 | Bacteria | 6116 |
| 24 | rootH1_10006961 | 3300003316 | Bacteria | 26234 |
| 25 | rootH1_10006961 | 3300003323 | Bacteria | 2768 |
| 26 | rootH2_10063583 | 3300003320 | Bacteria | 3986 |
| 27 | rootL2_10008719 | 3300003322 | Bacteria | 24040 |
| 28 | rootL2_10049725 | 3300003322 | Bacteria | 2974 |
| 29 | JGI25160J50197_1000226 | 3300003354 | Bacteria | 44500 |
| 30 | JGI25160J50197_1001281 | 3300003354 | Bacteria | 12758 |
| 31 | JGI25160J50197_1016203 | 3300003354 | Bacteria | 2410 |
| 32 | JGI25161J50226_1000037 | 3300003374 | Bacteria | 133331 |
| 33 | JGI25161J50226_1002873 | 3300003374 | Bacteria | 4195 |
| 34 | JGI25161J50226_1003897 | 3300003374 | Bacteria | 3252 |
| 35 | Ga0006562J51391_1053388 | 3300003578 | Bacteria | 5620 |
| 36 | Ga0055538_1000085 | 3300003751 | Bacteria | 81616 |
| 37 | Ga0055539_1000126 | 3300003752 | Bacteria | 81616 |
| 38 | Ga0055533_1000133 | 3300003756 | Bacteria | 81616 |
| 39 | Ga0055532_1000044 | 3300003758 | Bacteria | 191110 |
| 40 | Ga0055525_1000174 | 3300003759 | Bacteria | 81616 |
| 41 | Ga0055535_1000075 | 3300003761 | Bacteria | 111667 |
| 42 | Ga0055535_1004532 | 3300003761 | Bacteria | 3340 |
| 43 | Ga0055542_1000059 | 3300003762 | Bacteria | 162670 |
| 44 | Ga0055526_1002374 | 3300003771 | Bacteria | 12758 |
| 45 | Ga0055526_1004721 | 3300003771 | Bacteria | 8077 |
| 46 | Ga0055526_1009710 | 3300003771 | Bacteria | 4586 |
| 47 | Ga0055526_1020944 | 3300003771 | Bacteria | 2298 |
| 48 | Ga0055526_1024924 | 3300003771 | Bacteria | 1936 |
| 49 | Ga0055537_1000209 | 3300003773 | Bacteria | 43625 |
| 50 | Ga0055537_1001009 | 3300003773 | Bacteria | 12758 |
| 51 | Ga0055537_1006249 | 3300003773 | Bacteria | 3055 |
| 52 | Ga0055537_1015227 | 3300003773 | Bacteria | 1360 |
| 53 | Ga0055524_1000233 | 3300003775 | Bacteria | 58967 |
| 54 | Ga0055524_1001273 | 3300003775 | Bacteria | 14781 |
| 55 | Ga0055524_1001585 | 3300003775 | Bacteria | 12758 |
| 56 | Ga0055524_1008286 | 3300003775 | Bacteria | 4329 |
| 57 | Ga0055536_1000110 | 3300003781 | Bacteria | 72378 |
| 58 | Ga0055536_1005196 | 3300003781 | Bacteria | 6429 |
| 59 | Ga0055536_1007740 | 3300003781 | Bacteria | 4751 |
| 60 | Ga0055536_1012477 | 3300003781 | Bacteria | 3151 |
| 61 | Ga0055536_1035477 | 3300003781 | Bacteria | 1247 |
| 62 | Ga0055534_1000204 | 3300003784 | Bacteria | 43602 |
| 63 | Ga0055534_1000762 | 3300003784 | Bacteria | 15292 |
| 64 | Ga0055534_1000901 | 3300003784 | Bacteria | 13451 |
| 65 | Ga0055534_1002032 | 3300003784 | Bacteria | 7332 |
| 66 | Ga0055528_1001708 | 3300003790 | Bacteria | 12758 |
| 67 | Ga0055528_1001972 | 3300003790 | Bacteria | 11584 |
| 68 | Ga0055528_1031882 | 3300003790 | Bacteria | 1360 |
| 69 | Ga0055530_10000758 | 3300003791 | Bacteria | 26817 |
| 70 | Ga0055530_10001159 | 3300003791 | Bacteria | 20427 |
| 71 | Ga0055530_10002021 | 3300003791 | Bacteria | 13714 |
| 72 | Ga0055530_10002991 | 3300003791 | Bacteria | 10151 |
| 73 | Ga0055540_1000080 | 3300003792 | Bacteria | 111063 |
| 74 | Ga0055540_1000137 | 3300003792 | Bacteria | 73229 |
| 75 | Ga0055540_1008445 | 3300003792 | Bacteria | 3709 |
| 76 | Ga0055540_1015866 | 3300003792 | Bacteria | 2171 |
| 77 | Ga0055540_1045518 | 3300003792 | Bacteria | 926 |
| 78 | Ga0055531_10001920 | 3300003794 | Bacteria | 14541 |
| 79 | Ga0055531_10002432 | 3300003794 | Bacteria | 12467 |
| 80 | Ga0055531_10006303 | 3300003794 | Bacteria | 6758 |
| 81 | Ga0055531_10014072 | 3300003794 | Bacteria | 3634 |
| 82 | Ga0055531_10017034 | 3300003794 | Bacteria | 3093 |
| 83 | Ga0055541_1000085 | 3300003841 | Bacteria | 81616 |
| 84 | Ga0055543_1001262 | 3300004625 | Bacteria | 10444 |
| 85 | Ga0065165_1002511 | 3300005262 | Bacteria | 15324 |
| 86 | Ga0065165_1010738 | 3300005262 | Bacteria | 3913 |
| 87 | Ga0065165_1011902 | 3300005262 | Bacteria | 3581 |
| 88 | Ga0065165_1024021 | 3300005262 | Bacteria | 2056 |
| 89 | Ga0065714_10018134 | 3300005288 | Bacteria | 1282 |
| 90 | Ga0065704_10090130 | 3300005289 | Bacteria | 2810 |
| 91 | Ga0065704_10095050 | 3300005289 | Bacteria | 2504 |
| 92 | Ga0070683_100188826 | 3300005329 | Bacteria | 1956 |
| 93 | Ga0070670_100001478 | 3300005331 | Bacteria | 18935 |
| 94 | Ga0070677_10059413 | 3300005333 | Bacteria | 1572 |
| 95 | Ga0070677_10062281 | 3300005333 | Bacteria | 1543 |
| 96 | Ga0068869_100312709 | 3300005334 | Bacteria | 1272 |
| 97 | Ga0070666_10074775 | 3300005335 | Bacteria | 2310 |
| 98 | Ga0068868_100078023 | 3300005338 | Bacteria | 2650 |
| 99 | Ga0068868_100105985 | 3300005338 | Bacteria | 2280 |
| 100 | Ga0068868_100107238 | 3300005338 | Bacteria | 2267 |
| 101 | Ga0068868_100419992 | 3300005338 | Bacteria | 1158 |
| 102 | Ga0070689_100016515 | 3300005340 | Bacteria | 5402 |
| 103 | Ga0070668_100052259 | 3300005347 | Bacteria | 3149 |
| 104 | Ga0070668_100125281 | 3300005347 | Bacteria | 2057 |
| 105 | Ga0070669_100024394 | 3300005353 | Bacteria | 4336 |
| 106 | Ga0070669_100047396 | 3300005353 | Bacteria | 3135 |
| 107 | Ga0070669_100258273 | 3300005353 | Bacteria | 1389 |
| 108 | Ga0070675_100000072 | 3300005354 | Bacteria | 58324 |
| 109 | Ga0070675_100001530 | 3300005354 | Bacteria | 17096 |
| 110 | Ga0070671_100002032 | 3300005355 | Bacteria | 15587 |
| 111 | Ga0070671_100008208 | 3300005355 | Bacteria | 8356 |
| 112 | Ga0070671_100027427 | 3300005355 | Bacteria | 4689 |
| 113 | Ga0070671_100139968 | 3300005355 | Bacteria | 2042 |
| 114 | Ga0070674_100098177 | 3300005356 | Bacteria | 2129 |
| 115 | Ga0070674_100274601 | 3300005356 | Bacteria | 1334 |
| 116 | Ga0070673_100003979 | 3300005364 | Bacteria | 9298 |
| 117 | Ga0070673_100068932 | 3300005364 | Bacteria | 2833 |
| 118 | Ga0070673_100207365 | 3300005364 | Bacteria | 1691 |
| 119 | Ga0070673_100292490 | 3300005364 | Bacteria | 1432 |
| 120 | Ga0070673_100297708 | 3300005364 | Bacteria | 1419 |
| 121 | Ga0070673_100345816 | 3300005364 | Bacteria | 1319 |
| 122 | Ga0070673_100632013 | 3300005364 | Bacteria | 979 |
| 123 | Ga0070688_100014106 | 3300005365 | Bacteria | 4521 |
| 124 | Ga0070667_100016510 | 3300005367 | Bacteria | 6110 |
| 125 | Ga0070667_100020627 | 3300005367 | Bacteria | 5471 |
| 126 | Ga0070667_100529164 | 3300005367 | Bacteria | 1082 |
| 127 | Ga0070667_100617186 | 3300005367 | Bacteria | 1000 |
| 128 | Ga0070663_100337433 | 3300005455 | Bacteria | 1217 |
| 129 | Ga0070678_100062379 | 3300005456 | Bacteria | 2752 |
| 130 | Ga0070678_100344769 | 3300005456 | Bacteria | 1279 |
| 131 | Ga0070678_100461159 | 3300005456 | Bacteria | 1115 |
| 132 | Ga0070662_100192579 | 3300005457 | Bacteria | 1613 |
| 133 | Ga0068867_100010282 | 3300005459 | Bacteria | 6602 |
| 134 | Ga0068867_100393172 | 3300005459 | Bacteria | 1167 |
| 135 | Ga0070706_100000815 | 3300005467 | Bacteria | 34516 |
| 136 | Ga0068853_100086219 | 3300005539 | Bacteria | 2753 |
| 137 | Ga0070672_100027211 | 3300005543 | Bacteria | 4263 |
| 138 | Ga0070672_100039485 | 3300005543 | Bacteria | 3616 |
| 139 | Ga0070672_100087689 | 3300005543 | Bacteria | 2504 |
| 140 | Ga0070672_100182461 | 3300005543 | Bacteria | 1749 |
| 141 | Ga0070672_100272449 | 3300005543 | Bacteria | 1430 |
| 142 | Ga0070665_100059422 | 3300005548 | Bacteria | 3832 |
| 143 | Ga0070665_100090744 | 3300005548 | Bacteria | 3061 |
| 144 | Ga0068855_100008256 | 3300005563 | Bacteria | 12586 |
| 145 | Ga0068855_100012665 | 3300005563 | Bacteria | 10178 |
| 146 | Ga0068855_100084137 | 3300005563 | Bacteria | 3684 |
| 147 | Ga0070664_100006488 | 3300005564 | Bacteria | 9430 |
| 148 | Ga0070664_100138105 | 3300005564 | Bacteria | 2145 |
| 149 | Ga0070664_100189648 | 3300005564 | Bacteria | 1831 |
| 150 | Ga0068857_100113011 | 3300005577 | Bacteria | 2442 |
| 151 | Ga0068857_100184535 | 3300005577 | Bacteria | 1899 |
| 152 | Ga0068857_100214539 | 3300005577 | Bacteria | 1757 |
| 153 | Ga0068854_100021162 | 3300005578 | Bacteria | 4411 |
| 154 | Ga0068856_100060699 | 3300005614 | Bacteria | 3735 |
| 155 | Ga0068852_100001472 | 3300005616 | Bacteria | 15936 |
| 156 | Ga0068852_100259021 | 3300005616 | Bacteria | 1669 |
| 157 | Ga0068852_100733270 | 3300005616 | Bacteria | 1000 |
| 158 | Ga0068859_100009439 | 3300005617 | Bacteria | 9851 |
| 159 | Ga0068859_100023760 | 3300005617 | Bacteria | 6152 |
| 160 | Ga0068864_100000365 | 3300005618 | Bacteria | 39562 |
| 161 | Ga0068864_100008762 | 3300005618 | Bacteria | 8341 |
| 162 | Ga0068864_100015666 | 3300005618 | Bacteria | 6306 |
| 163 | Ga0068864_100057120 | 3300005618 | Bacteria | 3372 |
| 164 | Ga0068864_100102794 | 3300005618 | Bacteria | 2536 |
| 165 | Ga0068861_100103488 | 3300005719 | Bacteria | 2269 |
| 166 | Ga0068861_100517631 | 3300005719 | Bacteria | 1081 |
| 167 | Ga0068851_10022301 | 3300005834 | Bacteria | 3083 |
| 168 | Ga0068851_10064125 | 3300005834 | Bacteria | 1888 |
| 169 | Ga0068863_100006233 | 3300005841 | Bacteria | 11712 |
| 170 | Ga0068863_100058427 | 3300005841 | Bacteria | 3649 |
| 171 | Ga0068863_100356237 | 3300005841 | Bacteria | 1426 |
| 172 | Ga0068858_100002406 | 3300005842 | Bacteria | 18921 |
| 173 | Ga0068860_100570550 | 3300005843 | Bacteria | 1135 |
| 174 | Ga0068862_100048603 | 3300005844 | Bacteria | 3622 |
| 175 | Ga0068862_100081207 | 3300005844 | Bacteria | 2812 |
| 176 | Ga0075365_10030760 | 3300006038 | Bacteria | 3441 |
| 177 | Ga0075363_100184638 | 3300006048 | Bacteria | 1188 |
| 178 | Ga0075363_100201294 | 3300006048 | Bacteria | 1138 |
| 179 | Ga0075363_100206388 | 3300006048 | Bacteria | 1124 |
| 180 | Ga0075364_10013074 | 3300006051 | Bacteria | 5093 |
| 181 | Ga0075364_10015271 | 3300006051 | Bacteria | 4761 |
| 182 | Ga0075364_10078247 | 3300006051 | Bacteria | 2184 |
| 183 | Ga0075364_10152916 | 3300006051 | Bacteria | 1555 |
| 184 | Ga0075432_10005480 | 3300006058 | Bacteria | 4323 |
| 185 | Ga0075362_10012457 | 3300006177 | Bacteria | 3379 |
| 186 | Ga0075362_10031439 | 3300006177 | Bacteria | 2297 |
| 187 | Ga0075366_10002800 | 3300006195 | Bacteria | 9018 |
| 188 | Ga0075366_10011897 | 3300006195 | Bacteria | 4924 |
| 189 | Ga0075366_10052784 | 3300006195 | Bacteria | 2415 |
| 190 | Ga0075366_10071406 | 3300006195 | Bacteria | 2068 |
| 191 | Ga0075366_10076715 | 3300006195 | Bacteria | 1994 |
| 192 | Ga0075366_10091014 | 3300006195 | Bacteria | 1827 |
| 193 | Ga0075366_10093324 | 3300006195 | Bacteria | 1804 |
| 194 | Ga0075366_10097344 | 3300006195 | Bacteria | 1765 |
| 195 | Ga0075366_10276744 | 3300006195 | Bacteria | 1025 |
| 196 | Ga0097621_100026071 | 3300006237 | Bacteria | 4582 |
| 197 | Ga0097621_100155085 | 3300006237 | Bacteria | 1965 |
| 198 | Ga0097621_100206637 | 3300006237 | Bacteria | 1706 |
| 199 | Ga0097621_100291159 | 3300006237 | Bacteria | 1440 |
| 200 | Ga0075370_10001172 | 3300006353 | Bacteria | 11031 |
| 201 | Ga0075370_10002892 | 3300006353 | Bacteria | 8057 |
| 202 | Ga0075370_10027339 | 3300006353 | Bacteria | 3164 |
| 203 | Ga0075370_10030647 | 3300006353 | Bacteria | 3002 |
| 204 | Ga0075370_10035165 | 3300006353 | Bacteria | 2811 |
| 205 | Ga0075370_10123168 | 3300006353 | Bacteria | 1510 |
| 206 | Ga0075370_10181047 | 3300006353 | Bacteria | 1240 |
| 207 | Ga0068871_100021764 | 3300006358 | Bacteria | 4934 |
| 208 | Ga0068871_100157315 | 3300006358 | Bacteria | 1941 |
| 209 | Ga0068871_100269311 | 3300006358 | Bacteria | 1488 |
| 210 | Ga0097620_100009439 | 3300006931 | Bacteria | 9851 |
| 211 | Ga0097620_100023761 | 3300006931 | Bacteria | 6152 |
| 212 | Ga0079104_1000020 | 3300006946 | Bacteria | 256848 |
| 213 | Ga0079104_1000267 | 3300006946 | Bacteria | 68733 |
| 214 | Ga0079104_1016875 | 3300006946 | Bacteria | 2118 |
| 215 | Ga0099826_10000014 | 3300006948 | Bacteria | 258520 |
| 216 | Ga0105251_10008698 | 3300009011 | Bacteria | 6086 |
| 217 | Ga0105244_10009554 | 3300009036 | Bacteria | 5950 |
| 218 | Ga0105250_10001195 | 3300009092 | Bacteria | 14490 |
| 219 | Ga0105240_10003351 | 3300009093 | Bacteria | 24930 |
| 220 | Ga0105240_10418698 | 3300009093 | Bacteria | 1505 |
| 221 | Ga0105240_10749569 | 3300009093 | Bacteria | 1062 |
| 222 | Ga0105245_10057279 | 3300009098 | Bacteria | 3505 |
| 223 | Ga0105243_10001263 | 3300009148 | Bacteria | 22726 |
| 224 | Ga0105243_10009492 | 3300009148 | Bacteria | 7407 |
| 225 | Ga0105243_10022596 | 3300009148 | Bacteria | 4782 |
| 226 | Ga0105241_10186487 | 3300009174 | Bacteria | 1724 |
| 227 | Ga0105242_10004100 | 3300009176 | Bacteria | 11330 |
| 228 | Ga0105242_10012580 | 3300009176 | Bacteria | 6515 |
| 229 | Ga0105248_10014023 | 3300009177 | Bacteria | 8818 |
| 230 | Ga0105248_10222044 | 3300009177 | Bacteria | 2127 |
| 231 | Ga0105248_10463392 | 3300009177 | Bacteria | 1429 |
| 232 | Ga0105237_10022411 | 3300009545 | Bacteria | 6481 |
| 233 | Ga0105237_10091950 | 3300009545 | Bacteria | 3024 |
| 234 | Ga0105237_10138414 | 3300009545 | Bacteria | 2429 |
| 235 | Ga0105237_10437499 | 3300009545 | Bacteria | 1313 |
| 236 | Ga0105238_10000038 | 3300009551 | Bacteria | 162920 |
| 237 | Ga0105238_10033619 | 3300009551 | Bacteria | 5219 |
| 238 | Ga0105238_10387968 | 3300009551 | Bacteria | 1389 |
| 239 | Ga0105249_10039063 | 3300009553 | Bacteria | 4308 |
| 240 | Ga0105249_11036917 | 3300009553 | Bacteria | 889 |
| 241 | Ga0105239_10010497 | 3300010375 | Bacteria | 10353 |
| 242 | Ga0105239_10509832 | 3300010375 | Bacteria | 1368 |
| 243 | Ga0105246_10024446 | 3300011119 | Bacteria | 3926 |
| 244 | Ga0157373_10021391 | 3300013100 | Bacteria | 4699 |
| 245 | Ga0157371_10170971 | 3300013102 | Bacteria | 1553 |
| 246 | Ga0157370_10046759 | 3300013104 | Bacteria | 4149 |
| 247 | Ga0157369_10009779 | 3300013105 | Bacteria | 10968 |
| 248 | Ga0157374_10017623 | 3300013296 | Bacteria | 6292 |
| 249 | Ga0157378_10262224 | 3300013297 | Bacteria | 1658 |
| 250 | Ga0163162_10025495 | 3300013306 | Bacteria | 5842 |
| 251 | Ga0163162_11139232 | 3300013306 | Bacteria | 884 |
| 252 | Ga0157372_10636484 | 3300013307 | Bacteria | 1242 |
| 253 | Ga0157375_10022777 | 3300013308 | Bacteria | 5768 |
| 254 | Ga0157375_10057967 | 3300013308 | Bacteria | 3830 |
| 255 | Ga0157375_10210614 | 3300013308 | Bacteria | 2101 |
| 256 | Ga0157375_10277650 | 3300013308 | Bacteria | 1838 |
| 257 | Ga0157375_10530793 | 3300013308 | Bacteria | 1339 |
| 258 | Ga0163163_10001376 | 3300014325 | Bacteria | 20523 |
| 259 | Ga0163163_10160807 | 3300014325 | Bacteria | 2291 |
| 260 | Ga0157380_10944521 | 3300014326 | Bacteria | 892 |
| 261 | Ga0182008_10002120 | 3300014497 | Bacteria | 12642 |
| 262 | Ga0182008_10003759 | 3300014497 | Bacteria | 9042 |
| 263 | Ga0182008_10110297 | 3300014497 | Bacteria | 1363 |
| 264 | Ga0182008_10158269 | 3300014497 | Bacteria | 1139 |
| 265 | Ga0157379_10025922 | 3300014968 | Bacteria | 5213 |
| 266 | Ga0157379_10207554 | 3300014968 | Bacteria | 1773 |
| 267 | Ga0157379_10305898 | 3300014968 | Bacteria | 1449 |
| 268 | Ga0157376_10192263 | 3300014969 | Bacteria | 1872 |
| 269 | Ga0157376_10305230 | 3300014969 | Bacteria | 1508 |
| 270 | Ga0182006_1004394 | 3300015261 | Bacteria | 6967 |
| 271 | Ga0182007_10000330 | 3300015262 | Bacteria | 29991 |
| 272 | Ga0182007_10001131 | 3300015262 | Bacteria | 14464 |
| 273 | Ga0182007_10112785 | 3300015262 | Bacteria | 905 |
| 274 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 275 | Ga0163161_10000118 | 3300017792 | Bacteria | 75123 |
| 276 | Ga0163161_10006973 | 3300017792 | Bacteria | 7811 |
| 277 | Ga0163161_10053410 | 3300017792 | Bacteria | 2931 |
| 278 | Ga0163161_10174796 | 3300017792 | Bacteria | 1644 |
| 279 | Ga0213872_10107482 | 3300021361 | Bacteria | 1240 |
| 280 | Ga0209435_100004 | 3300025206 | Bacteria | 633417 |
| 281 | Ga0209435_100239 | 3300025206 | Bacteria | 14733 |
| 282 | Ga0209436_113575 | 3300025208 | Bacteria | 1326 |
| 283 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 284 | Ga0209566_100039 | 3300025225 | Bacteria | 303368 |
| 285 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 286 | Ga0209672_101521 | 3300025228 | Bacteria | 8065 |
| 287 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 288 | Ga0209147_104501 | 3300025229 | Bacteria | 2307 |
| 289 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 290 | Ga0209437_100207 | 3300025233 | Bacteria | 112147 |
| 291 | Ga0209258_100078 | 3300025242 | Bacteria | 263996 |
| 292 | Ga0209258_100528 | 3300025242 | Bacteria | 36442 |
| 293 | Ga0207425_1000191 | 3300025245 | Bacteria | 49767 |
| 294 | Ga0207425_1023809 | 3300025245 | Bacteria | 1277 |
| 295 | Ga0209646_1000141 | 3300025246 | Bacteria | 107030 |
| 296 | Ga0209646_1000149 | 3300025246 | Bacteria | 100004 |
| 297 | Ga0209646_1000233 | 3300025246 | Bacteria | 57776 |
| 298 | Ga0209026_1000066 | 3300025250 | Bacteria | 207691 |
| 299 | Ga0209026_1000931 | 3300025250 | Bacteria | 14755 |
| 300 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 301 | Ga0209148_1000086 | 3300025254 | Bacteria | 263996 |
| 302 | Ga0209759_1000072 | 3300025256 | Bacteria | 178206 |
| 303 | Ga0209759_1000182 | 3300025256 | Bacteria | 102836 |
| 304 | Ga0209129_1000116 | 3300025258 | Bacteria | 140716 |
| 305 | Ga0209129_1001707 | 3300025258 | Bacteria | 11854 |
| 306 | Ga0209129_1002001 | 3300025258 | Bacteria | 10585 |
| 307 | Ga0209565_1000045 | 3300025263 | Bacteria | 226864 |
| 308 | Ga0209565_1000067 | 3300025263 | Bacteria | 171247 |
| 309 | Ga0209565_1000133 | 3300025263 | Bacteria | 104054 |
| 310 | Ga0209565_1000987 | 3300025263 | Bacteria | 14624 |
| 311 | Ga0207666_1010003 | 3300025271 | Bacteria | 1291 |
| 312 | Ga0209673_1000190 | 3300025273 | Bacteria | 123411 |
| 313 | Ga0209673_1000315 | 3300025273 | Bacteria | 89120 |
| 314 | Ga0209673_1000813 | 3300025273 | Bacteria | 41247 |
| 315 | Ga0209673_1002491 | 3300025273 | Bacteria | 12690 |
| 316 | Ga0209673_1027509 | 3300025273 | Bacteria | 1848 |
| 317 | Ga0209673_1031648 | 3300025273 | Bacteria | 1642 |
| 318 | Ga0209673_1037781 | 3300025273 | Bacteria | 1414 |
| 319 | Ga0209130_1000159 | 3300025284 | Bacteria | 101007 |
| 320 | Ga0209130_1000202 | 3300025284 | Bacteria | 80333 |
| 321 | Ga0209130_1000307 | 3300025284 | Bacteria | 58849 |
| 322 | Ga0209130_1004923 | 3300025284 | Bacteria | 4844 |
| 323 | Ga0209130_1014857 | 3300025284 | Bacteria | 1939 |
| 324 | Ga0209130_1017200 | 3300025284 | Bacteria | 1730 |
| 325 | Ga0209675_1000038 | 3300025291 | Bacteria | 250481 |
| 326 | Ga0209675_1000247 | 3300025291 | Bacteria | 53629 |
| 327 | Ga0209675_1000282 | 3300025291 | Bacteria | 48505 |
| 328 | Ga0209675_1002196 | 3300025291 | Bacteria | 10238 |
| 329 | Ga0209675_1002329 | 3300025291 | Bacteria | 9819 |
| 330 | Ga0209675_1005053 | 3300025291 | Bacteria | 5643 |
| 331 | Ga0209675_1013191 | 3300025291 | Bacteria | 2603 |
| 332 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 333 | Ga0209676_1000064 | 3300025292 | Bacteria | 321700 |
| 334 | Ga0209676_1000125 | 3300025292 | Bacteria | 191565 |
| 335 | Ga0209676_1000732 | 3300025292 | Bacteria | 44939 |
| 336 | Ga0209676_1002481 | 3300025292 | Bacteria | 12987 |
| 337 | Ga0209676_1005722 | 3300025292 | Bacteria | 6385 |
| 338 | Ga0209676_1028562 | 3300025292 | Bacteria | 1734 |
| 339 | Ga0209676_1061991 | 3300025292 | Bacteria | 926 |
| 340 | Ga0209025_1000256 | 3300025294 | Bacteria | 125758 |
| 341 | Ga0209025_1000293 | 3300025294 | Bacteria | 111845 |
| 342 | Ga0209025_1000899 | 3300025294 | Bacteria | 46148 |
| 343 | Ga0209025_1001146 | 3300025294 | Bacteria | 37744 |
| 344 | Ga0209025_1001385 | 3300025294 | Bacteria | 32357 |
| 345 | Ga0209025_1001957 | 3300025294 | Bacteria | 23748 |
| 346 | Ga0209025_1010545 | 3300025294 | Bacteria | 6250 |
| 347 | Ga0209025_1015359 | 3300025294 | Bacteria | 4625 |
| 348 | Ga0209025_1043423 | 3300025294 | Bacteria | 1894 |
| 349 | Ga0209564_1000201 | 3300025295 | Bacteria | 136907 |
| 350 | Ga0209564_1000462 | 3300025295 | Bacteria | 68050 |
| 351 | Ga0209564_1000918 | 3300025295 | Bacteria | 38443 |
| 352 | Ga0209564_1001999 | 3300025295 | Bacteria | 17828 |
| 353 | Ga0209564_1002274 | 3300025295 | Bacteria | 15712 |
| 354 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 355 | Ga0209758_1000126 | 3300025297 | Bacteria | 189761 |
| 356 | Ga0209758_1010677 | 3300025297 | Bacteria | 5453 |
| 357 | Ga0209758_1011684 | 3300025297 | Bacteria | 5044 |
| 358 | Ga0209758_1032751 | 3300025297 | Bacteria | 2103 |
| 359 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 360 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 361 | Ga0209050_1002321 | 3300025298 | Bacteria | 16737 |
| 362 | Ga0209050_1002676 | 3300025298 | Bacteria | 14535 |
| 363 | Ga0209050_1014676 | 3300025298 | Bacteria | 3352 |
| 364 | Ga0209050_1017651 | 3300025298 | Bacteria | 2827 |
| 365 | Ga0209050_1046391 | 3300025298 | Bacteria | 1142 |
| 366 | Ga0209256_1000066 | 3300025299 | Bacteria | 247534 |
| 367 | Ga0209256_1000105 | 3300025299 | Bacteria | 188238 |
| 368 | Ga0209256_1000193 | 3300025299 | Bacteria | 117486 |
| 369 | Ga0209256_1000203 | 3300025299 | Bacteria | 112500 |
| 370 | Ga0209256_1000270 | 3300025299 | Bacteria | 90996 |
| 371 | Ga0207426_1000145 | 3300025302 | Bacteria | 191065 |
| 372 | Ga0207426_1000244 | 3300025302 | Bacteria | 120371 |
| 373 | Ga0207426_1000369 | 3300025302 | Bacteria | 79694 |
| 374 | Ga0207426_1002799 | 3300025302 | Bacteria | 10459 |
| 375 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 376 | Ga0209051_1000035 | 3300025303 | Bacteria | 346999 |
| 377 | Ga0209051_1000134 | 3300025303 | Bacteria | 138380 |
| 378 | Ga0209051_1000322 | 3300025303 | Bacteria | 72185 |
| 379 | Ga0209051_1000344 | 3300025303 | Bacteria | 69935 |
| 380 | Ga0209051_1000524 | 3300025303 | Bacteria | 47751 |
| 381 | Ga0209051_1012706 | 3300025303 | Bacteria | 4055 |
| 382 | Ga0209051_1040833 | 3300025303 | Bacteria | 1658 |
| 383 | Ga0209051_1043998 | 3300025303 | Bacteria | 1561 |
| 384 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 385 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 386 | Ga0209257_1000346 | 3300025304 | Bacteria | 95662 |
| 387 | Ga0209257_1000849 | 3300025304 | Bacteria | 43669 |
| 388 | Ga0209257_1001178 | 3300025304 | Bacteria | 33080 |
| 389 | Ga0209257_1016979 | 3300025304 | Bacteria | 2900 |
| 390 | Ga0209257_1018695 | 3300025304 | Bacteria | 2648 |
| 391 | Ga0207656_10014447 | 3300025321 | Bacteria | 3042 |
| 392 | Ga0207656_10044281 | 3300025321 | Bacteria | 1900 |
| 393 | Ga0207696_1002283 | 3300025711 | Bacteria | 9527 |
| 394 | Ga0207655_1002165 | 3300025728 | Bacteria | 16367 |
| 395 | Ga0207713_1019388 | 3300025735 | Bacteria | 3328 |
| 396 | Ga0207682_10005101 | 3300025893 | Bacteria | 5380 |
| 397 | Ga0207682_10073804 | 3300025893 | Bacteria | 1450 |
| 398 | Ga0207642_10200607 | 3300025899 | Bacteria | 1101 |
| 399 | Ga0207688_10081355 | 3300025901 | Bacteria | 1850 |
| 400 | Ga0207643_10037154 | 3300025908 | Bacteria | 2732 |
| 401 | Ga0207643_10267740 | 3300025908 | Bacteria | 1056 |
| 402 | Ga0207684_10001165 | 3300025910 | Bacteria | 29354 |
| 403 | Ga0207695_10000748 | 3300025913 | Bacteria | 62583 |
| 404 | Ga0207695_10000979 | 3300025913 | Bacteria | 50790 |
| 405 | Ga0207695_10138986 | 3300025913 | Bacteria | 2380 |
| 406 | Ga0207695_10156465 | 3300025913 | Bacteria | 2214 |
| 407 | Ga0207671_10010004 | 3300025914 | Bacteria | 7871 |
| 408 | Ga0207671_10087522 | 3300025914 | Bacteria | 2342 |
| 409 | Ga0207649_10184320 | 3300025920 | Bacteria | 1463 |
| 410 | Ga0207649_10206882 | 3300025920 | Bacteria | 1390 |
| 411 | Ga0207649_10269994 | 3300025920 | Bacteria | 1232 |
| 412 | Ga0207681_10016792 | 3300025923 | Bacteria | 4587 |
| 413 | Ga0207694_10000069 | 3300025924 | Bacteria | 124500 |
| 414 | Ga0207694_10117268 | 3300025924 | Bacteria | 2122 |
| 415 | Ga0207650_10024897 | 3300025925 | Bacteria | 4260 |
| 416 | Ga0207650_10112712 | 3300025925 | Bacteria | 2107 |
| 417 | Ga0207650_10193708 | 3300025925 | Bacteria | 1625 |
| 418 | Ga0207650_10420448 | 3300025925 | Bacteria | 1109 |
| 419 | Ga0207650_10457438 | 3300025925 | Bacteria | 1063 |
| 420 | Ga0207659_10001521 | 3300025926 | Bacteria | 13761 |
| 421 | Ga0207659_10015117 | 3300025926 | Bacteria | 4993 |
| 422 | Ga0207644_10003206 | 3300025931 | Bacteria | 10538 |
| 423 | Ga0207644_10005562 | 3300025931 | Bacteria | 8203 |
| 424 | Ga0207644_10008749 | 3300025931 | Bacteria | 6627 |
| 425 | Ga0207706_10031489 | 3300025933 | Bacteria | 4725 |
| 426 | Ga0207706_10141945 | 3300025933 | Bacteria | 2113 |
| 427 | Ga0207686_10006431 | 3300025934 | Bacteria | 6322 |
| 428 | Ga0207686_10021415 | 3300025934 | Bacteria | 3710 |
| 429 | Ga0207709_10000055 | 3300025935 | Bacteria | 222373 |
| 430 | Ga0207709_10000410 | 3300025935 | Bacteria | 41986 |
| 431 | Ga0207709_10001314 | 3300025935 | Bacteria | 17672 |
| 432 | Ga0207670_10019292 | 3300025936 | Bacteria | 4163 |
| 433 | Ga0207669_10378592 | 3300025937 | Bacteria | 1102 |
| 434 | Ga0207669_10464626 | 3300025937 | Bacteria | 1005 |
| 435 | Ga0207704_10393562 | 3300025938 | Bacteria | 1091 |
| 436 | Ga0207691_10011628 | 3300025940 | Bacteria | 8448 |
| 437 | Ga0207691_10016757 | 3300025940 | Bacteria | 6953 |
| 438 | Ga0207691_10019387 | 3300025940 | Bacteria | 6437 |
| 439 | Ga0207691_10091541 | 3300025940 | Bacteria | 2725 |
| 440 | Ga0207691_10130841 | 3300025940 | Bacteria | 2217 |
| 441 | Ga0207691_10219990 | 3300025940 | Bacteria | 1647 |
| 442 | Ga0207711_10015665 | 3300025941 | Bacteria | 6288 |
| 443 | Ga0207711_10066801 | 3300025941 | Bacteria | 3110 |
| 444 | Ga0207711_10178069 | 3300025941 | Bacteria | 1932 |
| 445 | Ga0207661_10261559 | 3300025944 | Bacteria | 1541 |
| 446 | Ga0207679_10004569 | 3300025945 | Bacteria | 8621 |
| 447 | Ga0207679_10264253 | 3300025945 | Bacteria | 1469 |
| 448 | Ga0207667_10000043 | 3300025949 | Bacteria | 261426 |
| 449 | Ga0207667_10011296 | 3300025949 | Bacteria | 10385 |
| 450 | Ga0207667_10020155 | 3300025949 | Bacteria | 7424 |
| 451 | Ga0207667_10034212 | 3300025949 | Bacteria | 5459 |
| 452 | Ga0207651_10008310 | 3300025960 | Bacteria | 5599 |
| 453 | Ga0207651_10017232 | 3300025960 | Bacteria | 4261 |
| 454 | Ga0207668_10028782 | 3300025972 | Bacteria | 3636 |
| 455 | Ga0207668_10066281 | 3300025972 | Bacteria | 2559 |
| 456 | Ga0207640_10006631 | 3300025981 | Bacteria | 6359 |
| 457 | Ga0207658_10009364 | 3300025986 | Bacteria | 6644 |
| 458 | Ga0207658_10021392 | 3300025986 | Bacteria | 4490 |
| 459 | Ga0207658_10074457 | 3300025986 | Bacteria | 2580 |
| 460 | Ga0207658_10499404 | 3300025986 | Bacteria | 1083 |
| 461 | Ga0207677_10020400 | 3300026023 | Bacteria | 4024 |
| 462 | Ga0207677_10040368 | 3300026023 | Bacteria | 3076 |
| 463 | Ga0207677_10438947 | 3300026023 | Bacteria | 1116 |
| 464 | Ga0207703_10003467 | 3300026035 | Bacteria | 13206 |
| 465 | Ga0207639_10022031 | 3300026041 | Bacteria | 4585 |
| 466 | Ga0207678_10030191 | 3300026067 | Bacteria | 4732 |
| 467 | Ga0207678_10203779 | 3300026067 | Bacteria | 1692 |
| 468 | Ga0207708_10138834 | 3300026075 | Bacteria | 1905 |
| 469 | Ga0207702_10047328 | 3300026078 | Bacteria | 3624 |
| 470 | Ga0207702_10229184 | 3300026078 | Bacteria | 1735 |
| 471 | Ga0207641_10002637 | 3300026088 | Bacteria | 16416 |
| 472 | Ga0207641_10149067 | 3300026088 | Bacteria | 2117 |
| 473 | Ga0207641_10219612 | 3300026088 | Bacteria | 1762 |
| 474 | Ga0207641_10288792 | 3300026088 | Bacteria | 1545 |
| 475 | Ga0207641_10388443 | 3300026088 | Bacteria | 1338 |
| 476 | Ga0207641_10507861 | 3300026088 | Bacteria | 1171 |
| 477 | Ga0207648_10079881 | 3300026089 | Bacteria | 2853 |
| 478 | Ga0207648_10112760 | 3300026089 | Bacteria | 2387 |
| 479 | Ga0207648_10809765 | 3300026089 | Bacteria | 872 |
| 480 | Ga0207676_10000935 | 3300026095 | Bacteria | 22554 |
| 481 | Ga0207676_10068245 | 3300026095 | Bacteria | 2843 |
| 482 | Ga0207674_10427760 | 3300026116 | Bacteria | 1279 |
| 483 | Ga0207675_100017080 | 3300026118 | Bacteria | 6777 |
| 484 | Ga0207675_100076322 | 3300026118 | Bacteria | 3138 |
| 485 | Ga0207675_100297232 | 3300026118 | Bacteria | 1572 |
| 486 | Ga0207683_10031853 | 3300026121 | Bacteria | 4578 |
| 487 | Ga0207698_10002359 | 3300026142 | Bacteria | 11194 |
| 488 | Ga0207698_10034235 | 3300026142 | Bacteria | 3701 |
| 489 | Ga0207698_10105626 | 3300026142 | Bacteria | 2347 |
| 490 | Ga0207698_10528739 | 3300026142 | Bacteria | 1152 |
| 491 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 492 | Ga0209281_1000076 | 3300027111 | Bacteria | 263350 |
| 493 | Ga0209970_1000439 | 3300027614 | Bacteria | 7099 |
| 494 | Ga0209282_1000048 | 3300027666 | Bacteria | 111312 |
| 495 | Ga0209282_1000783 | 3300027666 | Bacteria | 16121 |
| 496 | Ga0268266_10465838 | 3300028379 | Bacteria | 1203 |
| 497 | Ga0268265_10025855 | 3300028380 | Bacteria | 4172 |
| 498 | Ga0268265_10035974 | 3300028380 | Bacteria | 3623 |
| 499 | Ga0268265_10078795 | 3300028380 | Bacteria | 2592 |
| 500 | Ga0268264_10329979 | 3300028381 | Bacteria | 1445 |
| 501 | Ga0268264_10433089 | 3300028381 | Bacteria | 1270 |
| 502 | Ga0307517_10176468 | 3300028786 | Bacteria | 1390 |
| 503 | Ga0307515_10000104 | 3300028794 | Bacteria | 198238 |
| 504 | Ga0307515_10001447 | 3300028794 | Bacteria | 53309 |
| 505 | Ga0307515_10001910 | 3300028794 | Bacteria | 46279 |
| 506 | Ga0307515_10007756 | 3300028794 | Bacteria | 21127 |
| 507 | Ga0307515_10014992 | 3300028794 | Bacteria | 14317 |
| 508 | Ga0307515_10030798 | 3300028794 | Bacteria | 8986 |
| 509 | Ga0307515_10148686 | 3300028794 | Bacteria | 2463 |
| 510 | Ga0307515_10254821 | 3300028794 | Bacteria | 1501 |
| 511 | Ga0307512_10015937 | 3300030522 | Bacteria | 6950 |
| 512 | Ga0316176_1160931 | 3300030732 | Bacteria | 1792 |
| 513 | Ga0314311_1018871 | 3300030733 | Bacteria | 5580 |
| 514 | Ga0316180_1072696 | 3300030736 | Bacteria | 1336 |
| 515 | Ga0316183_1116903 | 3300030742 | Bacteria | 5351 |
| 516 | Ga0316182_1114331 | 3300030745 | Bacteria | 1564 |
| 517 | Ga0265327_10007552 | 3300031251 | Bacteria | 8358 |
| 518 | Ga0265327_10120075 | 3300031251 | Bacteria | 1246 |
| 519 | Ga0307513_10007505 | 3300031456 | Bacteria | 14118 |
| 520 | Ga0307513_10013996 | 3300031456 | Bacteria | 9828 |
| 521 | Ga0307513_10247073 | 3300031456 | Bacteria | 1584 |
| 522 | Ga0307509_10228856 | 3300031507 | Bacteria | 1664 |
| 523 | Ga0307408_100000425 | 3300031548 | Bacteria | 37508 |
| 524 | Ga0307408_100249290 | 3300031548 | Bacteria | 1464 |
| 525 | Ga0307408_100541879 | 3300031548 | Bacteria | 1025 |
| 526 | Ga0307408_100654356 | 3300031548 | Bacteria | 940 |
| 527 | Ga0307508_10000757 | 3300031616 | Bacteria | 38250 |
| 528 | Ga0307514_10001999 | 3300031649 | Bacteria | 22153 |
| 529 | Ga0307514_10005653 | 3300031649 | Bacteria | 11083 |
| 530 | Ga0307514_10012237 | 3300031649 | Bacteria | 7141 |
| 531 | Ga0307514_10154761 | 3300031649 | Bacteria | 1531 |
| 532 | Ga0265314_10024093 | 3300031711 | Bacteria | 4623 |
| 533 | Ga0265314_10219171 | 3300031711 | Bacteria | 1112 |
| 534 | Ga0307516_10000879 | 3300031730 | Bacteria | 41327 |
| 535 | Ga0307516_10009691 | 3300031730 | Bacteria | 10701 |
| 536 | Ga0307405_10025478 | 3300031731 | Bacteria | 3397 |
| 537 | Ga0307405_10058986 | 3300031731 | Bacteria | 2417 |
| 538 | Ga0307405_10071422 | 3300031731 | Bacteria | 2233 |
| 539 | Ga0307405_10082685 | 3300031731 | Bacteria | 2102 |
| 540 | Ga0307405_10153675 | 3300031731 | Bacteria | 1621 |
| 541 | Ga0307405_10427278 | 3300031731 | Bacteria | 1044 |
| 542 | Ga0307413_10045463 | 3300031824 | Bacteria | 2603 |
| 543 | Ga0307413_10096006 | 3300031824 | Bacteria | 1945 |
| 544 | Ga0307413_10516354 | 3300031824 | Bacteria | 962 |
| 545 | Ga0307410_10023794 | 3300031852 | Bacteria | 3816 |
| 546 | Ga0307410_10359155 | 3300031852 | Bacteria | 1166 |
| 547 | Ga0307406_10000849 | 3300031901 | Bacteria | 17191 |
| 548 | Ga0307406_10014759 | 3300031901 | Bacteria | 4501 |
| 549 | Ga0307406_10024450 | 3300031901 | Bacteria | 3608 |
| 550 | Ga0307406_10092398 | 3300031901 | Bacteria | 2040 |
| 551 | Ga0307412_10019864 | 3300031911 | Bacteria | 4078 |
| 552 | Ga0307412_10048949 | 3300031911 | Bacteria | 2782 |
| 553 | Ga0307412_10068525 | 3300031911 | Bacteria | 2413 |
| 554 | Ga0307412_10212587 | 3300031911 | Bacteria | 1477 |
| 555 | Ga0307412_10214207 | 3300031911 | Bacteria | 1472 |
| 556 | Ga0307412_10345433 | 3300031911 | Bacteria | 1192 |
| 557 | Ga0307409_100002108 | 3300031995 | Bacteria | 10241 |
| 558 | Ga0307409_100016392 | 3300031995 | Bacteria | 4901 |
| 559 | Ga0307409_100865692 | 3300031995 | Bacteria | 915 |
| 560 | Ga0307416_100000974 | 3300032002 | Bacteria | 15139 |
| 561 | Ga0307416_100039991 | 3300032002 | Bacteria | 3637 |
| 562 | Ga0307416_100458218 | 3300032002 | Bacteria | 1329 |
| 563 | Ga0307414_10200561 | 3300032004 | Bacteria | 1622 |
| 564 | Ga0307411_10016597 | 3300032005 | Bacteria | 4171 |
| 565 | Ga0307411_10028408 | 3300032005 | Bacteria | 3400 |
| 566 | Ga0307411_10699883 | 3300032005 | Bacteria | 882 |
| 567 | Ga0307415_100016196 | 3300032126 | Bacteria | 4437 |
| 568 | Ga0395899_0001056 | 3300037312 | Bacteria | 24893 |
| 569 | Ga0395900_0332891 | 3300037418 | Bacteria | 1496 |
| 570 | Ga0395900_0760098 | 3300037418 | Bacteria | 899 |
| 571 | Ga0395898_0004283 | 3300037466 | Bacteria | 15647 |
| 572 | Ga0395898_0079618 | 3300037466 | Bacteria | 3161 |
| 573 | Ga0395905_0001044 | 3300037471 | Bacteria | 35045 |
| 574 | Ga0395905_0020660 | 3300037471 | Bacteria | 6234 |
| 575 | Ga0395901_0000922 | 3300038443 | Bacteria | 32031 |
| 576 | Ga0395901_0063696 | 3300038443 | Bacteria | 3838 |
| 577 | Ga0436365_1028618 | 3300039437 | Bacteria | 913 |
| 578 | Ga0436361_0335187 | 3300039447 | Bacteria | 21707 |
| 579 | Ga0436361_0432344 | 3300039447 | Bacteria | 27994 |
| 580 | Ga0436363_1708688 | 3300039450 | Bacteria | 3412 |
| 581 | Ga0439436_0000115 | 3300041404 | Bacteria | 18475 |
| 582 | Ga0439436_0010409 | 3300041404 | Bacteria | 2837 |
| 583 | Ga0439439_0068671 | 3300041406 | Bacteria | 947 |
| 584 | Ga0439439_0075406 | 3300041406 | Bacteria | 907 |
| 585 | Ga0439447_022188 | 3300041407 | Bacteria | 1665 |
| 586 | Ga0439465_0000808 | 3300041413 | Bacteria | 9836 |
| 587 | Ga0439465_0023133 | 3300041413 | Bacteria | 1955 |
| 588 | Ga0451789_0593619 | 3300041443 | Bacteria | 1372 |
| 589 | Ga0451795_1233687 | 3300041456 | Bacteria | 1933 |
| 590 | Ga0451800_0693667 | 3300041459 | Bacteria | 1532 |
| 591 | Ga0451804_0092695 | 3300041463 | Bacteria | 860 |
| 592 | Ga0451853_0033084 | 3300041512 | Bacteria | 1333 |
| 593 | Ga0439433_0000104 | 3300041999 | Bacteria | 11856 |
| 594 | Ga0439445_0002012 | 3300042004 | Bacteria | 4488 |
| 595 | Ga0439448_0116250 | 3300042005 | Bacteria | 916 |
| 596 | Ga0439432_001851 | 3300042006 | Bacteria | 7941 |
| 597 | Ga0439449_0002196 | 3300042007 | Bacteria | 7682 |
| 598 | Ga0439449_0004888 | 3300042007 | Bacteria | 5162 |
| 599 | Ga0439449_0107901 | 3300042007 | Bacteria | 1030 |
| 600 | Ga0439450_032827 | 3300042008 | Bacteria | 1174 |
| 601 | Ga0439452_000603 | 3300042010 | Bacteria | 18494 |
| 602 | Ga0439452_009911 | 3300042010 | Bacteria | 2792 |
| 603 | Ga0450919_003171 | 3300042121 | Bacteria | 2085 |
| 604 | Ga0450919_011728 | 3300042121 | Bacteria | 996 |
| 605 | Ga0450920_007152 | 3300042122 | Bacteria | 2018 |
| 606 | Ga0450920_017409 | 3300042122 | Bacteria | 1374 |
| 607 | Ga0450890_007008 | 3300042127 | Bacteria | 1437 |
| 608 | Ga0450896_027095 | 3300042133 | Bacteria | 856 |
| 609 | Ga0450898_004259 | 3300042134 | Bacteria | 2105 |
| 610 | Ga0450910_007614 | 3300042147 | Bacteria | 1512 |
| 611 | Ga0439446_0077242 | 3300042156 | Bacteria | 1026 |
| 612 | Ga0450908_016249 | 3300042184 | Bacteria | 1328 |
| 613 | Ga0439434_0049774 | 3300042435 | Bacteria | 1297 |
| 614 | Ga0450918_000692 | 3300042531 | Bacteria | 7127 |
| 615 | Ga0450918_002503 | 3300042531 | Bacteria | 3469 |
| 616 | Ga0451577_0000142 | 3300042876 | Bacteria | 160598 |
| 617 | Ga0451577_0013160 | 3300042876 | Bacteria | 7753 |
| 618 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 619 | Ga0453684_0288399 | 3300044712 | Bacteria | 1869 |
| 620 | Ga0466960_0046143 | 3300044901 | Bacteria | 2085 |
| 621 | Ga0451576_0008009 | 3300045051 | Bacteria | 12485 |
| 622 | Ga0451576_0012713 | 3300045051 | Bacteria | 9450 |
| 623 | Ga0451576_0083681 | 3300045051 | Bacteria | 3319 |
| 624 | Ga0451576_0425718 | 3300045051 | Bacteria | 1393 |
| 625 | Ga0495590_0032979 | 3300046457 | Bacteria | 1811 |
| 626 | Ga0495650_0000131 | 3300046471 | Bacteria | 174698 |
| 627 | Ga0495650_0000189 | 3300046471 | Bacteria | 133931 |
| 628 | Ga0495650_0002492 | 3300046471 | Bacteria | 14791 |
| 629 | Ga0495605_0000003 | 3300046474 | Bacteria | 491502 |
| 630 | Ga0495585_0143894 | 3300046492 | Bacteria | 1247 |
| 631 | Ga0495596_0004647 | 3300046500 | Bacteria | 6641 |
| 632 | Ga0495607_0011973 | 3300046501 | Bacteria | 5743 |
| 633 | Ga0495610_0008515 | 3300046512 | Bacteria | 6625 |
| 634 | Ga0495616_0007192 | 3300046513 | Bacteria | 6673 |
| 635 | Ga0495616_0027530 | 3300046513 | Bacteria | 3015 |
| 636 | Ga0495631_0008971 | 3300046518 | Bacteria | 5014 |
| 637 | Ga0495632_0001209 | 3300046519 | Bacteria | 21930 |
| 638 | Ga0495632_0005271 | 3300046519 | Bacteria | 8588 |
| 639 | Ga0495637_0020430 | 3300046520 | Bacteria | 3047 |
| 640 | Ga0495643_0000328 | 3300046522 | Bacteria | 65181 |
| 641 | Ga0495643_0000702 | 3300046522 | Bacteria | 38476 |
| 642 | Ga0495643_0002881 | 3300046522 | Bacteria | 13045 |
| 643 | Ga0495642_0108684 | 3300046528 | Bacteria | 1185 |
| 644 | Ga0495598_0076028 | 3300046537 | Bacteria | 1068 |
| 645 | Ga0495609_0007705 | 3300046538 | Bacteria | 5341 |
| 646 | Ga0495621_0046084 | 3300046539 | Bacteria | 1546 |
| 647 | Ga0495597_0000024 | 3300046542 | Bacteria | 143948 |
| 648 | Ga0495597_0144395 | 3300046542 | Bacteria | 980 |
| 649 | Ga0495633_0120414 | 3300046558 | Bacteria | 1216 |
| 650 | Ga0495656_0000287 | 3300046615 | Bacteria | 17572 |
| 651 | Ga0495656_0079269 | 3300046615 | Bacteria | 1478 |
| 652 | Ga0495656_0085465 | 3300046615 | Bacteria | 1433 |
| 653 | Ga0495668_0017695 | 3300046616 | Bacteria | 4128 |
| 654 | Ga0495625_0000317 | 3300046660 | Bacteria | 73568 |
| 655 | Ga0495625_0000533 | 3300046660 | Bacteria | 55919 |
| 656 | Ga0495625_0002445 | 3300046660 | Bacteria | 20069 |
| 657 | Ga0495625_0014641 | 3300046660 | Bacteria | 6248 |
| 658 | Ga0495635_0101961 | 3300046663 | Bacteria | 1962 |
| 659 | Ga0495661_0003204 | 3300046665 | Bacteria | 12219 |
| 660 | Ga0495661_0008066 | 3300046665 | Bacteria | 7309 |
| 661 | Ga0495658_0210067 | 3300046683 | Bacteria | 1216 |
| 662 | Ga0495669_0101159 | 3300046684 | Bacteria | 1339 |
| 663 | Ga0495670_0214160 | 3300046691 | Bacteria | 1022 |
| 664 | Ga0495671_0007159 | 3300046692 | Bacteria | 6386 |
| 665 | Ga0495649_0017074 | 3300046694 | Bacteria | 4104 |
| 666 | Ga0495660_0086594 | 3300046810 | Bacteria | 1635 |
| 667 | Ga0495636_0039759 | 3300047318 | Bacteria | 1948 |
| 668 | Ga0495672_0000165 | 3300047320 | Bacteria | 96215 |
| 669 | Ga0495687_010378 | 3300047443 | Bacteria | 5112 |
| 670 | Ga0495687_064799 | 3300047443 | Bacteria | 1490 |
| 671 | Ga0495677_0004557 | 3300047445 | Bacteria | 5301 |
| 672 | Ga0495685_076888 | 3300047447 | Bacteria | 1114 |
| 673 | Ga0495615_0015184 | 3300048090 | Bacteria | 1641 |
| 674 | Ga0495626_0003640 | 3300048091 | Bacteria | 9807 |
| 675 | Ga0495626_0132217 | 3300048091 | Bacteria | 1064 |
| 676 | Ga0496101_0171137 | 3300048904 | Bacteria | 1669 |
| 677 | Ga0496104_0322680 | 3300048907 | Bacteria | 1457 |
| 678 | Ga0496104_0868516 | 3300048907 | Bacteria | 807 |
| 679 | Ga0496105_0165324 | 3300048908 | Bacteria | 1815 |
| 680 | Ga0496108_0291770 | 3300048911 | Bacteria | 1420 |
| 681 | Ga0496109_0069604 | 3300048912 | Bacteria | 3228 |
| 682 | Ga0496109_0357466 | 3300048912 | Bacteria | 1380 |
| 683 | Ga0496114_0043982 | 3300048917 | Bacteria | 3704 |
| 684 | Ga0496116_0017337 | 3300048919 | Bacteria | 5592 |
| 685 | Ga0496116_0043647 | 3300048919 | Bacteria | 3053 |
| 686 | Ga0496117_0073408 | 3300048920 | Bacteria | 2282 |
| 687 | Ga0496117_0209510 | 3300048920 | Bacteria | 1094 |
| 688 | Ga0496118_0027309 | 3300048921 | Bacteria | 4835 |
| 689 | Ga0496118_0147638 | 3300048921 | Bacteria | 1477 |
| 690 | Ga0496121_0027569 | 3300048924 | Bacteria | 5313 |
| 691 | Ga0496121_0034342 | 3300048924 | Bacteria | 4566 |
| 692 | Ga0496121_0290683 | 3300048924 | Bacteria | 1113 |
| 693 | Ga0496122_0001392 | 3300048925 | Bacteria | 39241 |
| 694 | Ga0496122_0001678 | 3300048925 | Bacteria | 34323 |
| 695 | Ga0496122_0019689 | 3300048925 | Bacteria | 6150 |
| 696 | Ga0496122_0020671 | 3300048925 | Bacteria | 5931 |
| 697 | Ga0496123_0000102 | 3300048926 | Bacteria | 169327 |
| 698 | Ga0496123_0015355 | 3300048926 | Bacteria | 6285 |
| 699 | Ga0496123_0019688 | 3300048926 | Bacteria | 5312 |
| 700 | Ga0496123_0026399 | 3300048926 | Bacteria | 4350 |
| 701 | Ga0496124_0000126 | 3300048927 | Bacteria | 159539 |
| 702 | Ga0496124_0118206 | 3300048927 | Bacteria | 2122 |
| 703 | Ga0496124_0146253 | 3300048927 | Bacteria | 1859 |
| 704 | Ga0496125_0003314 | 3300048928 | Bacteria | 19714 |
| 705 | Ga0496125_0005567 | 3300048928 | Bacteria | 13929 |
| 706 | Ga0496125_0006122 | 3300048928 | Bacteria | 13124 |
| 707 | Ga0496125_0008416 | 3300048928 | Bacteria | 10802 |
| 708 | Ga0496125_0044650 | 3300048928 | Bacteria | 3743 |
| 709 | Ga0496125_0079741 | 3300048928 | Bacteria | 2509 |
| 710 | Ga0496126_0017829 | 3300048929 | Bacteria | 7065 |
| 711 | Ga0495678_032313 | 3300049459 | Bacteria | 2172 |
| 712 | Ga0501225_0005608 | 3300049705 | Bacteria | 3678 |
| 713 | Ga0501262_000328 | 3300049759 | Bacteria | 5721 |
| 714 | nmdc:mga03683_136909_c1 | 3300050489 | Bacteria | 1099 |
| 715 | nmdc:mga03683_44530_c1 | 3300050489 | Bacteria | 1834 |
| 716 | nmdc:mga00v17_135128_c1 | 3300050491 | Bacteria | 1578 |
| 717 | nmdc:mga00v17_207639_c1 | 3300050491 | Bacteria | 1267 |
| 718 | nmdc:mga00v17_65801_c1 | 3300050491 | Bacteria | 2237 |
| 719 | nmdc:mga0yw44_97375_c1 | 3300050492 | Bacteria | 1869 |
| 720 | nmdc:mga0k408_132862_c1 | 3300050493 | Bacteria | 1478 |
| 721 | nmdc:mga0k408_256104_c1 | 3300050493 | Bacteria | 1045 |
| 722 | nmdc:mga0k408_40364_c1 | 3300050493 | Bacteria | 2685 |
| 723 | nmdc:mga0k408_60761_c1 | 3300050493 | Bacteria | 2196 |
| 724 | nmdc:mga07m45_10975_c1 | 3300050496 | Bacteria | 4747 |
| 725 | nmdc:mga07m45_28932_c1 | 3300050496 | Bacteria | 3060 |
| 726 | nmdc:mga07m45_55894_c1 | 3300050496 | Bacteria | 2231 |
| 727 | nmdc:mga07m45_717_c1 | 3300050496 | Bacteria | 14101 |
| 728 | nmdc:mga07m45_789_c1 | 3300050496 | Bacteria | 13618 |
| 729 | Ga0495612_0075512 | 3300053078 | Bacteria | 1411 |
| 730 | Ga0500610_0002345 | 3300053079 | Bacteria | 6930 |
| 731 | Ga0500610_0031775 | 3300053079 | Bacteria | 2684 |
| 732 | Ga0500578_0000040 | 3300053086 | Bacteria | 133601 |
| 733 | Ga0500651_0000028 | 3300053093 | Bacteria | 114592 |
| 734 | Ga0500651_0126960 | 3300053093 | Bacteria | 1544 |
| 735 | Ga0500571_000016 | 3300053110 | Bacteria | 64989 |
| 736 | Ga0500607_002724 | 3300053121 | Bacteria | 13842 |
| 737 | Ga0500642_0003186 | 3300053130 | Bacteria | 4923 |
| 738 | Ga0500652_003243 | 3300053131 | Bacteria | 4922 |
| 739 | Ga0500655_001317 | 3300053133 | Bacteria | 4705 |
| 740 | Ga0500658_0000097 | 3300053134 | Bacteria | 39997 |
| 741 | Ga0500658_0001213 | 3300053134 | Bacteria | 10478 |
| 742 | Ga0500616_0052203 | 3300053153 | Bacteria | 2151 |
| 743 | Ga0500616_0071872 | 3300053153 | Bacteria | 1760 |
| 744 | Ga0500622_0000138 | 3300053156 | Bacteria | 77892 |
| 745 | Ga0500634_0006895 | 3300053161 | Bacteria | 5543 |
| 746 | Ga0500645_000326 | 3300053730 | Bacteria | 33814 |
| 747 | Ga0500645_003804 | 3300053730 | Bacteria | 5994 |
| 748 | 2511245625 | 2511231002 | Bacteria | 5042903 |
| 749 | 2511249593 | 2511231003 | Bacteria | 5606035 |
| 750 | 2511384046 | 2511231026 | Bacteria | 5225445 |
| 751 | 2513230505 | 2513020051 | Bacteria | 6053213 |
| 752 | 2513953948 | 2513237150 | Bacteria | 6553639 |
| 753 | 2514040083 | 2513237165 | Bacteria | 6771773 |
| 754 | 2521560206 | 2521172590 | Bacteria | 5047645 |
| 755 | 2548498878 | 2547132374 | Bacteria | 5530232 |
| 756 | 2550695325 | 2548876994 | Bacteria | 4904866 |
| 757 | 2553005006 | 2551306416 | Bacteria | 6152985 |
| 758 | 2587725780 | 2585428057 | Bacteria | 6737412 |
| 759 | 2587735171 | 2585428058 | Bacteria | 6853932 |
| 760 | 2587758779 | 2585428062 | Bacteria | 6842168 |
| 761 | 2588290711 | 2588253510 | Bacteria | 6901809 |
| 762 | 2599623026 | 2599185214 | Bacteria | 8209958 |
| 763 | 2599674673 | 2599185226 | Bacteria | 8233575 |
| 764 | 2599680630 | 2599185227 | Bacteria | 8246414 |
| 765 | 2599692645 | 2599185229 | Bacteria | 8216126 |
| 766 | 2643867923 | 2643221570 | Bacteria | 5103772 |
| 767 | 2643936454 | 2643221585 | Bacteria | 5812563 |
| 768 | 2643972211 | 2643221592 | Bacteria | 6608788 |
| 769 | 2643991788 | 2643221596 | Bacteria | 5006805 |
| 770 | 2644026226 | 2643221603 | Bacteria | 6147767 |
| 771 | 2644058982 | 2643221609 | Bacteria | 6756331 |
| 772 | 2644071209 | 2643221611 | Bacteria | 6820941 |
| 773 | 2644141678 | 2643221625 | Bacteria | 6512927 |
| 774 | 2644162012 | 2643221628 | Bacteria | 5745828 |
| 775 | 2644248716 | 2643221644 | Bacteria | 6865017 |
| 776 | 2644275551 | 2643221648 | Bacteria | 6521465 |
| 777 | 2644293532 | 2643221652 | Bacteria | 5140275 |
| 778 | 2644302834 | 2643221654 | Bacteria | 5273570 |
| 779 | 2644317810 | 2643221656 | Bacteria | 5809961 |
| 780 | 2644325308 | 2643221658 | Bacteria | 6064537 |
| 781 | 2644399045 | 2643221672 | Bacteria | 6322190 |
| 782 | 2644467287 | 2643221683 | Bacteria | 5749203 |
| 783 | 2644648339 | 2643221717 | Bacteria | 5676132 |
| 784 | 2722886009 | 2721755523 | Bacteria | 6430384 |
| 785 | 2738720945 | 2738541277 | Bacteria | 7458140 |
| 786 | 2738886327 | 2738541307 | Bacteria | 8606193 |
| 787 | 2739246237 | 2738543012 | Bacteria | 7115078 |
| 788 | 2739252143 | 2738543013 | Bacteria | 5618633 |
| 789 | 2739280144 | 2738543019 | Bacteria | 7459457 |
| 790 | 2765571373 | 2765235838 | Bacteria | 5445269 |
| 791 | 2808982459 | 2808606386 | Bacteria | 4471946 |
| 792 | 2809129714 | 2808606415 | Bacteria | 4576710 |
| 793 | 2809149231 | 2808606419 | Bacteria | 4576925 |
| 794 | 2816471385 | 2816332133 | Bacteria | 7249298 |
| 795 | 2819592931 | 2818991445 | Bacteria | 4955017 |
| 796 | 2819602514 | 2818991446 | Bacteria | 7757362 |
| 797 | 2819616563 | 2818991449 | Bacteria | 5518009 |
| 798 | 2831272046 | 2831265667 | Bacteria | 7184833 |
| 799 | 2834641213 | 2834641062 | Bacteria | 5559922 |
| 800 | 2838059865 | 2838054893 | Bacteria | 7451788 |
| 801 | 2839099214 | 2839094727 | Bacteria | 5534556 |
| 802 | 2839142722 | 2839138175 | Bacteria | 6549354 |
| 803 | 2842677734 | 2842677519 | Bacteria | 5615038 |
| 804 | 2842718978 | 2842718218 | Bacteria | 4560148 |
| 805 | 2842736254 | 2842733646 | Bacteria | 5716726 |
| 806 | 2842748750 | 2842747753 | Bacteria | 5578255 |
| 807 | 2852619372 | 2852618963 | Bacteria | 4577824 |
| 808 | 2881102746 | 2881101125 | Bacteria | 4590519 |
| 809 | 2884812088 | 2884811622 | Bacteria | 5552861 |
| 810 | 2884838558 | 2884836552 | Bacteria | 5219991 |
| 811 | 2884854849 | 2884852848 | Bacteria | 5221161 |
| 812 | 2885194884 | 2885192300 | Bacteria | 5882526 |
| 813 | 2885198491 | 2885198086 | Bacteria | 7212419 |
| 814 | 2885212129 | 2885211737 | Bacteria | 7212420 |
| 815 | 2896156482 | 2896154374 | Bacteria | 5221518 |
| 816 | 2899928663 | 2899924645 | Bacteria | 7487985 |
| 817 | 2901312407 | 2901300506 | Bacteria | 8463898 |
| 818 | 2904440754 | 2904439833 | Bacteria | 5931679 |
| 819 | 2904451997 | 2904449895 | Bacteria | 6927402 |
| 820 | 2904458857 | 2904456579 | Bacteria | 6819253 |
| 821 | 2904481065 | 2904479285 | Bacteria | 5073931 |
| 822 | 2904535353 | 2904530477 | Bacteria | 5876334 |
| 823 | 2904547444 | 2904541872 | Bacteria | 8915136 |
| 824 | 2904589169 | 2904584206 | Bacteria | 6028872 |
| 825 | 2904594613 | 2904589729 | Bacteria | 6113573 |
| 826 | 2904605841 | 2904601388 | Bacteria | 5884906 |
| 827 | 2919048919 | 2919046199 | Bacteria | 5567169 |
| 828 | 2919084077 | 2919079590 | Bacteria | 5946433 |
| 829 | 2919467019 | 2919462493 | Bacteria | 5817112 |
| 830 | 2919707213 | 2919704043 | Bacteria | 5560311 |
| 831 | 2923513957 | 2923510766 | Bacteria | 5926163 |
| 832 | 2928043392 | 2928037797 | Bacteria | 7273642 |
| 833 | 2928050834 | 2928044640 | Bacteria | 7271509 |
| 834 | 2928056264 | 2928051484 | Bacteria | 7773759 |
| 835 | 2928066257 | 2928064002 | Bacteria | 7419480 |
| 836 | 2928075894 | 2928070936 | Bacteria | 8062541 |
| 837 | 2928090089 | 2928084124 | Bacteria | 7159212 |
| 838 | 2928115692 | 2928115317 | Bacteria | 6477646 |
| 839 | 2928134769 | 2928130867 | Bacteria | 5467269 |
| 840 | 2929165054 | 2929160207 | Bacteria | 9075316 |
| 841 | 2929523464 | 2929520902 | Bacteria | 6765052 |
| 842 | 2945910335 | 2945909444 | Bacteria | 7065066 |
| 843 | 2945946305 | 2945945610 | Bacteria | 5951079 |
| 844 | 2945975906 | 2945972063 | Bacteria | 6086495 |
| 845 | 2945987621 | 2945984333 | Bacteria | 7358892 |
| 846 | 2954768673 | 2954767861 | Bacteria | 5535784 |
| 847 | 2974320177 | 2974320154 | Bacteria | 4571377 |
| 848 | 2990713710 | 2990710928 | Bacteria | 5002431 |
| 849 | 644746743 | 644736347 | Bacteria | 6476522 |
| 850 | 8003401105 | 8003400568 | Bacteria | 5535898 |
| 851 | Ga0451833_0503407 | |||
| 852 | JGI24740J21852_10006051 | |||
| 853 | JGI24739J22299_10007959 | |||
| 854 | JGI25155J39150_1000373 | |||
| 855 | JGI25155J39150_1000448 | |||
| 856 | JGI25156J39149_1000117 | |||
| 857 | JGI25162J39368_1003833 | |||
| 858 | JGI25154J39366_1000107 | |||
| 859 | JGI25154J39366_1000249 | |||
| 860 | JGI25157J39369_1000512 | |||
| 861 | JGI25152J39213_1001037 | |||
| 862 | JGI25150J39212_1001492 | |||
| 863 | JGI25150J39212_1003450 | |||
| 864 | JGI25159J45721_1000938 | |||
| 865 | JGI25159J45721_1019573 | |||
| 866 | JGI25151J46595_10005990 | |||
| 867 | JGI25151J46595_10006065 | |||
| 868 | JGI25151J46595_10006915 | |||
| 869 | JGI25151J46595_10008499 | |||
| 870 | JGI25151J46595_10026498 | |||
| 871 | JGI25151J46595_10037187 | |||
| 872 | JGI25153J46596_10001796 | |||
| 873 | JGI25153J46596_10006203 | |||
| 874 | rootH1_10006961 | |||
| 875 | rootH2_10063583 | |||
| 876 | rootL2_10008719 | |||
| 877 | rootL2_10049725 | |||
| 878 | JGI25160J50197_1000226 | |||
| 879 | JGI25160J50197_1001281 | |||
| 880 | JGI25160J50197_1016203 | |||
| 881 | JGI25161J50226_1000037 | |||
| 882 | JGI25161J50226_1002873 | |||
| 883 | JGI25161J50226_1003897 | |||
| 884 | Ga0006562J51391_1053388 | |||
| 885 | Ga0055538_1000085 | |||
| 886 | Ga0055539_1000126 | |||
| 887 | Ga0055533_1000133 | |||
| 888 | Ga0055532_1000044 | |||
| 889 | Ga0055525_1000174 | |||
| 890 | Ga0055535_1000075 | |||
| 891 | Ga0055535_1004532 | |||
| 892 | Ga0055542_1000059 | |||
| 893 | Ga0055526_1002374 | |||
| 894 | Ga0055526_1004721 | |||
| 895 | Ga0055526_1009710 | |||
| 896 | Ga0055526_1020944 | |||
| 897 | Ga0055526_1024924 | |||
| 898 | Ga0055537_1000209 | |||
| 899 | Ga0055537_1001009 | |||
| 900 | Ga0055537_1006249 | |||
| 901 | Ga0055537_1015227 | |||
| 902 | Ga0055524_1000233 | |||
| 903 | Ga0055524_1001273 | |||
| 904 | Ga0055524_1001585 | |||
| 905 | Ga0055524_1008286 | |||
| 906 | Ga0055536_1000110 | |||
| 907 | Ga0055536_1005196 | |||
| 908 | Ga0055536_1007740 | |||
| 909 | Ga0055536_1012477 | |||
| 910 | Ga0055536_1035477 | |||
| 911 | Ga0055534_1000204 | |||
| 912 | Ga0055534_1000762 | |||
| 913 | Ga0055534_1000901 | |||
| 914 | Ga0055534_1002032 | |||
| 915 | Ga0055528_1001708 | |||
| 916 | Ga0055528_1001972 | |||
| 917 | Ga0055528_1031882 | |||
| 918 | Ga0055530_10000758 | |||
| 919 | Ga0055530_10001159 | |||
| 920 | Ga0055530_10002021 | |||
| 921 | Ga0055530_10002991 | |||
| 922 | Ga0055540_1000080 | |||
| 923 | Ga0055540_1000137 | |||
| 924 | Ga0055540_1008445 | |||
| 925 | Ga0055540_1015866 | |||
| 926 | Ga0055540_1045518 | |||
| 927 | Ga0055531_10001920 | |||
| 928 | Ga0055531_10002432 | |||
| 929 | Ga0055531_10006303 | |||
| 930 | Ga0055531_10014072 | |||
| 931 | Ga0055531_10017034 | |||
| 932 | Ga0055541_1000085 | |||
| 933 | Ga0055543_1001262 | |||
| 934 | Ga0065165_1002511 | |||
| 935 | Ga0065165_1010738 | |||
| 936 | Ga0065165_1011902 | |||
| 937 | Ga0065165_1024021 | |||
| 938 | Ga0065714_10018134 | |||
| 939 | Ga0065704_10090130 | |||
| 940 | Ga0065704_10095050 | |||
| 941 | Ga0070683_100188826 | |||
| 942 | Ga0070670_100001478 | |||
| 943 | Ga0070677_10059413 | |||
| 944 | Ga0070677_10062281 | |||
| 945 | Ga0068869_100312709 | |||
| 946 | Ga0070666_10074775 | |||
| 947 | Ga0068868_100078023 | |||
| 948 | Ga0068868_100105985 | |||
| 949 | Ga0068868_100107238 | |||
| 950 | Ga0068868_100419992 | |||
| 951 | Ga0070689_100016515 | |||
| 952 | Ga0070668_100052259 | |||
| 953 | Ga0070668_100125281 | |||
| 954 | Ga0070669_100024394 | |||
| 955 | Ga0070669_100047396 | |||
| 956 | Ga0070669_100258273 | |||
| 957 | Ga0070675_100000072 | |||
| 958 | Ga0070675_100001530 | |||
| 959 | Ga0070671_100002032 | |||
| 960 | Ga0070671_100008208 | |||
| 961 | Ga0070671_100027427 | |||
| 962 | Ga0070671_100139968 | |||
| 963 | Ga0070674_100098177 | |||
| 964 | Ga0070674_100274601 | |||
| 965 | Ga0070673_100003979 | |||
| 966 | Ga0070673_100068932 | |||
| 967 | Ga0070673_100207365 | |||
| 968 | Ga0070673_100292490 | |||
| 969 | Ga0070673_100297708 | |||
| 970 | Ga0070673_100345816 | |||
| 971 | Ga0070673_100632013 | |||
| 972 | Ga0070688_100014106 | |||
| 973 | Ga0070667_100016510 | |||
| 974 | Ga0070667_100020627 | |||
| 975 | Ga0070667_100529164 | |||
| 976 | Ga0070667_100617186 | |||
| 977 | Ga0070663_100337433 | |||
| 978 | Ga0070678_100062379 | |||
| 979 | Ga0070678_100344769 | |||
| 980 | Ga0070678_100461159 | |||
| 981 | Ga0070662_100192579 | |||
| 982 | Ga0068867_100010282 | |||
| 983 | Ga0068867_100393172 | |||
| 984 | Ga0070706_100000815 | |||
| 985 | Ga0068853_100086219 | |||
| 986 | Ga0070672_100027211 | |||
| 987 | Ga0070672_100039485 | |||
| 988 | Ga0070672_100087689 | |||
| 989 | Ga0070672_100182461 | |||
| 990 | Ga0070672_100272449 | |||
| 991 | Ga0070665_100059422 | |||
| 992 | Ga0070665_100090744 | |||
| 993 | Ga0068855_100008256 | |||
| 994 | Ga0068855_100012665 | |||
| 995 | Ga0068855_100084137 | |||
| 996 | Ga0070664_100006488 | |||
| 997 | Ga0070664_100138105 | |||
| 998 | Ga0070664_100189648 | |||
| 999 | Ga0068857_100113011 | |||
| 1000 | Ga0068857_100184535 | |||
| 1001 | Ga0068857_100214539 | |||
| 1002 | Ga0068854_100021162 | |||
| 1003 | Ga0068856_100060699 | |||
| 1004 | Ga0068852_100001472 | |||
| 1005 | Ga0068852_100259021 | |||
| 1006 | Ga0068852_100733270 | |||
| 1007 | Ga0068859_100009439 | |||
| 1008 | Ga0068859_100023760 | |||
| 1009 | Ga0068864_100000365 | |||
| 1010 | Ga0068864_100008762 | |||
| 1011 | Ga0068864_100015666 | |||
| 1012 | Ga0068864_100057120 | |||
| 1013 | Ga0068864_100102794 | |||
| 1014 | Ga0068861_100103488 | |||
| 1015 | Ga0068861_100517631 | |||
| 1016 | Ga0068851_10022301 | |||
| 1017 | Ga0068851_10064125 | |||
| 1018 | Ga0068863_100006233 | |||
| 1019 | Ga0068863_100058427 | |||
| 1020 | Ga0068863_100356237 | |||
| 1021 | Ga0068858_100002406 | |||
| 1022 | Ga0068860_100570550 | |||
| 1023 | Ga0068862_100048603 | |||
| 1024 | Ga0068862_100081207 | |||
| 1025 | Ga0075365_10030760 | |||
| 1026 | Ga0075363_100184638 | |||
| 1027 | Ga0075363_100201294 | |||
| 1028 | Ga0075363_100206388 | |||
| 1029 | Ga0075364_10013074 | |||
| 1030 | Ga0075364_10015271 | |||
| 1031 | Ga0075364_10078247 | |||
| 1032 | Ga0075364_10152916 | |||
| 1033 | Ga0075432_10005480 | |||
| 1034 | Ga0075362_10012457 | |||
| 1035 | Ga0075362_10031439 | |||
| 1036 | Ga0075366_10002800 | |||
| 1037 | Ga0075366_10011897 | |||
| 1038 | Ga0075366_10052784 | |||
| 1039 | Ga0075366_10071406 | |||
| 1040 | Ga0075366_10076715 | |||
| 1041 | Ga0075366_10091014 | |||
| 1042 | Ga0075366_10093324 | |||
| 1043 | Ga0075366_10097344 | |||
| 1044 | Ga0075366_10276744 | |||
| 1045 | Ga0097621_100026071 | |||
| 1046 | Ga0097621_100155085 | |||
| 1047 | Ga0097621_100206637 | |||
| 1048 | Ga0097621_100291159 | |||
| 1049 | Ga0075370_10001172 | |||
| 1050 | Ga0075370_10002892 | |||
| 1051 | Ga0075370_10027339 | |||
| 1052 | Ga0075370_10030647 | |||
| 1053 | Ga0075370_10035165 | |||
| 1054 | Ga0075370_10123168 | |||
| 1055 | Ga0075370_10181047 | |||
| 1056 | Ga0068871_100021764 | |||
| 1057 | Ga0068871_100157315 | |||
| 1058 | Ga0068871_100269311 | |||
| 1059 | Ga0097620_100009439 | |||
| 1060 | Ga0097620_100023761 | |||
| 1061 | Ga0079104_1000020 | |||
| 1062 | Ga0079104_1000267 | |||
| 1063 | Ga0079104_1016875 | |||
| 1064 | Ga0099826_10000014 | |||
| 1065 | Ga0105251_10008698 | |||
| 1066 | Ga0105244_10009554 | |||
| 1067 | Ga0105250_10001195 | |||
| 1068 | Ga0105240_10003351 | |||
| 1069 | Ga0105240_10418698 | |||
| 1070 | Ga0105240_10749569 | |||
| 1071 | Ga0105245_10057279 | |||
| 1072 | Ga0105243_10001263 | |||
| 1073 | Ga0105243_10009492 | |||
| 1074 | Ga0105243_10022596 | |||
| 1075 | Ga0105241_10186487 | |||
| 1076 | Ga0105242_10004100 | |||
| 1077 | Ga0105242_10012580 | |||
| 1078 | Ga0105248_10014023 | |||
| 1079 | Ga0105248_10222044 | |||
| 1080 | Ga0105248_10463392 | |||
| 1081 | Ga0105237_10022411 | |||
| 1082 | Ga0105237_10091950 | |||
| 1083 | Ga0105237_10138414 | |||
| 1084 | Ga0105237_10437499 | |||
| 1085 | Ga0105238_10000038 | |||
| 1086 | Ga0105238_10033619 | |||
| 1087 | Ga0105238_10387968 | |||
| 1088 | Ga0105249_10039063 | |||
| 1089 | Ga0105249_11036917 | |||
| 1090 | Ga0105239_10010497 | |||
| 1091 | Ga0105239_10509832 | |||
| 1092 | Ga0105246_10024446 | |||
| 1093 | Ga0157373_10021391 | |||
| 1094 | Ga0157371_10170971 | |||
| 1095 | Ga0157370_10046759 | |||
| 1096 | Ga0157369_10009779 | |||
| 1097 | Ga0157374_10017623 | |||
| 1098 | Ga0157378_10262224 | |||
| 1099 | Ga0163162_10025495 | |||
| 1100 | Ga0163162_11139232 | |||
| 1101 | Ga0157372_10636484 | |||
| 1102 | Ga0157375_10022777 | |||
| 1103 | Ga0157375_10057967 | |||
| 1104 | Ga0157375_10210614 | |||
| 1105 | Ga0157375_10277650 | |||
| 1106 | Ga0157375_10530793 | |||
| 1107 | Ga0163163_10001376 | |||
| 1108 | Ga0163163_10160807 | |||
| 1109 | Ga0157380_10944521 | |||
| 1110 | Ga0182008_10002120 | |||
| 1111 | Ga0182008_10003759 | |||
| 1112 | Ga0182008_10110297 | |||
| 1113 | Ga0182008_10158269 | |||
| 1114 | Ga0157379_10025922 | |||
| 1115 | Ga0157379_10207554 | |||
| 1116 | Ga0157379_10305898 | |||
| 1117 | Ga0157376_10192263 | |||
| 1118 | Ga0157376_10305230 | |||
| 1119 | Ga0182006_1004394 | |||
| 1120 | Ga0182007_10000330 | |||
| 1121 | Ga0182007_10001131 | |||
| 1122 | Ga0182007_10112785 | |||
| 1123 | Ga0183362_10003 | |||
| 1124 | Ga0163161_10000118 | |||
| 1125 | Ga0163161_10006973 | |||
| 1126 | Ga0163161_10053410 | |||
| 1127 | Ga0163161_10174796 | |||
| 1128 | Ga0213872_10107482 | |||
| 1129 | Ga0209435_100004 | |||
| 1130 | Ga0209435_100239 | |||
| 1131 | Ga0209436_113575 | |||
| 1132 | Ga0209784_100021 | |||
| 1133 | Ga0209566_100039 | |||
| 1134 | Ga0209674_100036 | |||
| 1135 | Ga0209672_101521 | |||
| 1136 | Ga0209147_100011 | |||
| 1137 | Ga0209147_104501 | |||
| 1138 | Ga0209563_100040 | |||
| 1139 | Ga0209437_100207 | |||
| 1140 | Ga0209258_100078 | |||
| 1141 | Ga0209258_100528 | |||
| 1142 | Ga0207425_1000191 | |||
| 1143 | Ga0207425_1023809 | |||
| 1144 | Ga0209646_1000141 | |||
| 1145 | Ga0209646_1000149 | |||
| 1146 | Ga0209646_1000233 | |||
| 1147 | Ga0209026_1000066 | |||
| 1148 | Ga0209026_1000931 | |||
| 1149 | Ga0209677_100023 | |||
| 1150 | Ga0209148_1000086 | |||
| 1151 | Ga0209759_1000072 | |||
| 1152 | Ga0209759_1000182 | |||
| 1153 | Ga0209129_1000116 | |||
| 1154 | Ga0209129_1001707 | |||
| 1155 | Ga0209129_1002001 | |||
| 1156 | Ga0209565_1000045 | |||
| 1157 | Ga0209565_1000067 | |||
| 1158 | Ga0209565_1000133 | |||
| 1159 | Ga0209565_1000987 | |||
| 1160 | Ga0207666_1010003 | |||
| 1161 | Ga0209673_1000190 | |||
| 1162 | Ga0209673_1000315 | |||
| 1163 | Ga0209673_1000813 | |||
| 1164 | Ga0209673_1002491 | |||
| 1165 | Ga0209673_1027509 | |||
| 1166 | Ga0209673_1031648 | |||
| 1167 | Ga0209673_1037781 | |||
| 1168 | Ga0209130_1000159 | |||
| 1169 | Ga0209130_1000202 | |||
| 1170 | Ga0209130_1000307 | |||
| 1171 | Ga0209130_1004923 | |||
| 1172 | Ga0209130_1014857 | |||
| 1173 | Ga0209130_1017200 | |||
| 1174 | Ga0209675_1000038 | |||
| 1175 | Ga0209675_1000247 | |||
| 1176 | Ga0209675_1000282 | |||
| 1177 | Ga0209675_1002196 | |||
| 1178 | Ga0209675_1002329 | |||
| 1179 | Ga0209675_1005053 | |||
| 1180 | Ga0209675_1013191 | |||
| 1181 | Ga0209676_1000013 | |||
| 1182 | Ga0209676_1000064 | |||
| 1183 | Ga0209676_1000125 | |||
| 1184 | Ga0209676_1000732 | |||
| 1185 | Ga0209676_1002481 | |||
| 1186 | Ga0209676_1005722 | |||
| 1187 | Ga0209676_1028562 | |||
| 1188 | Ga0209676_1061991 | |||
| 1189 | Ga0209025_1000256 | |||
| 1190 | Ga0209025_1000293 | |||
| 1191 | Ga0209025_1000899 | |||
| 1192 | Ga0209025_1001146 | |||
| 1193 | Ga0209025_1001385 | |||
| 1194 | Ga0209025_1001957 | |||
| 1195 | Ga0209025_1010545 | |||
| 1196 | Ga0209025_1015359 | |||
| 1197 | Ga0209025_1043423 | |||
| 1198 | Ga0209564_1000201 | |||
| 1199 | Ga0209564_1000462 | |||
| 1200 | Ga0209564_1000918 | |||
| 1201 | Ga0209564_1001999 | |||
| 1202 | Ga0209564_1002274 | |||
| 1203 | Ga0209758_1000034 | |||
| 1204 | Ga0209758_1000126 | |||
| 1205 | Ga0209758_1010677 | |||
| 1206 | Ga0209758_1011684 | |||
| 1207 | Ga0209758_1032751 | |||
| 1208 | Ga0209050_1000008 | |||
| 1209 | Ga0209050_1000012 | |||
| 1210 | Ga0209050_1002321 | |||
| 1211 | Ga0209050_1002676 | |||
| 1212 | Ga0209050_1014676 | |||
| 1213 | Ga0209050_1017651 | |||
| 1214 | Ga0209050_1046391 | |||
| 1215 | Ga0209256_1000066 | |||
| 1216 | Ga0209256_1000105 | |||
| 1217 | Ga0209256_1000193 | |||
| 1218 | Ga0209256_1000203 | |||
| 1219 | Ga0209256_1000270 | |||
| 1220 | Ga0207426_1000145 | |||
| 1221 | Ga0207426_1000244 | |||
| 1222 | Ga0207426_1000369 | |||
| 1223 | Ga0207426_1002799 | |||
| 1224 | Ga0209051_1000005 | |||
| 1225 | Ga0209051_1000035 | |||
| 1226 | Ga0209051_1000134 | |||
| 1227 | Ga0209051_1000322 | |||
| 1228 | Ga0209051_1000344 | |||
| 1229 | Ga0209051_1000524 | |||
| 1230 | Ga0209051_1012706 | |||
| 1231 | Ga0209051_1040833 | |||
| 1232 | Ga0209051_1043998 | |||
| 1233 | Ga0209257_1000024 | |||
| 1234 | Ga0209257_1000048 | |||
| 1235 | Ga0209257_1000346 | |||
| 1236 | Ga0209257_1000849 | |||
| 1237 | Ga0209257_1001178 | |||
| 1238 | Ga0209257_1016979 | |||
| 1239 | Ga0209257_1018695 | |||
| 1240 | Ga0207656_10014447 | |||
| 1241 | Ga0207656_10044281 | |||
| 1242 | Ga0207696_1002283 | |||
| 1243 | Ga0207655_1002165 | |||
| 1244 | Ga0207713_1019388 | |||
| 1245 | Ga0207682_10005101 | |||
| 1246 | Ga0207682_10073804 | |||
| 1247 | Ga0207642_10200607 | |||
| 1248 | Ga0207688_10081355 | |||
| 1249 | Ga0207643_10037154 | |||
| 1250 | Ga0207643_10267740 | |||
| 1251 | Ga0207684_10001165 | |||
| 1252 | Ga0207695_10000748 | |||
| 1253 | Ga0207695_10000979 | |||
| 1254 | Ga0207695_10138986 | |||
| 1255 | Ga0207695_10156465 | |||
| 1256 | Ga0207671_10010004 | |||
| 1257 | Ga0207671_10087522 | |||
| 1258 | Ga0207649_10184320 | |||
| 1259 | Ga0207649_10206882 | |||
| 1260 | Ga0207649_10269994 | |||
| 1261 | Ga0207681_10016792 | |||
| 1262 | Ga0207694_10000069 | |||
| 1263 | Ga0207694_10117268 | |||
| 1264 | Ga0207650_10024897 | |||
| 1265 | Ga0207650_10112712 | |||
| 1266 | Ga0207650_10193708 | |||
| 1267 | Ga0207650_10420448 | |||
| 1268 | Ga0207650_10457438 | |||
| 1269 | Ga0207659_10001521 | |||
| 1270 | Ga0207659_10015117 | |||
| 1271 | Ga0207644_10003206 | |||
| 1272 | Ga0207644_10005562 | |||
| 1273 | Ga0207644_10008749 | |||
| 1274 | Ga0207706_10031489 | |||
| 1275 | Ga0207706_10141945 | |||
| 1276 | Ga0207686_10006431 | |||
| 1277 | Ga0207686_10021415 | |||
| 1278 | Ga0207709_10000055 | |||
| 1279 | Ga0207709_10000410 | |||
| 1280 | Ga0207709_10001314 | |||
| 1281 | Ga0207670_10019292 | |||
| 1282 | Ga0207669_10378592 | |||
| 1283 | Ga0207669_10464626 | |||
| 1284 | Ga0207704_10393562 | |||
| 1285 | Ga0207691_10011628 | |||
| 1286 | Ga0207691_10016757 | |||
| 1287 | Ga0207691_10019387 | |||
| 1288 | Ga0207691_10091541 | |||
| 1289 | Ga0207691_10130841 | |||
| 1290 | Ga0207691_10219990 | |||
| 1291 | Ga0207711_10015665 | |||
| 1292 | Ga0207711_10066801 | |||
| 1293 | Ga0207711_10178069 | |||
| 1294 | Ga0207661_10261559 | |||
| 1295 | Ga0207679_10004569 | |||
| 1296 | Ga0207679_10264253 | |||
| 1297 | Ga0207667_10000043 | |||
| 1298 | Ga0207667_10011296 | |||
| 1299 | Ga0207667_10020155 | |||
| 1300 | Ga0207667_10034212 | |||
| 1301 | Ga0207651_10008310 | |||
| 1302 | Ga0207651_10017232 | |||
| 1303 | Ga0207668_10028782 | |||
| 1304 | Ga0207668_10066281 | |||
| 1305 | Ga0207640_10006631 | |||
| 1306 | Ga0207658_10009364 | |||
| 1307 | Ga0207658_10021392 | |||
| 1308 | Ga0207658_10074457 | |||
| 1309 | Ga0207658_10499404 | |||
| 1310 | Ga0207677_10020400 | |||
| 1311 | Ga0207677_10040368 | |||
| 1312 | Ga0207677_10438947 | |||
| 1313 | Ga0207703_10003467 | |||
| 1314 | Ga0207639_10022031 | |||
| 1315 | Ga0207678_10030191 | |||
| 1316 | Ga0207678_10203779 | |||
| 1317 | Ga0207708_10138834 | |||
| 1318 | Ga0207702_10047328 | |||
| 1319 | Ga0207702_10229184 | |||
| 1320 | Ga0207641_10002637 | |||
| 1321 | Ga0207641_10149067 | |||
| 1322 | Ga0207641_10219612 | |||
| 1323 | Ga0207641_10288792 | |||
| 1324 | Ga0207641_10388443 | |||
| 1325 | Ga0207641_10507861 | |||
| 1326 | Ga0207648_10079881 | |||
| 1327 | Ga0207648_10112760 | |||
| 1328 | Ga0207648_10809765 | |||
| 1329 | Ga0207676_10000935 | |||
| 1330 | Ga0207676_10068245 | |||
| 1331 | Ga0207674_10427760 | |||
| 1332 | Ga0207675_100017080 | |||
| 1333 | Ga0207675_100076322 | |||
| 1334 | Ga0207675_100297232 | |||
| 1335 | Ga0207683_10031853 | |||
| 1336 | Ga0207698_10002359 | |||
| 1337 | Ga0207698_10034235 | |||
| 1338 | Ga0207698_10105626 | |||
| 1339 | Ga0207698_10528739 | |||
| 1340 | Ga0209281_1000002 | |||
| 1341 | Ga0209281_1000076 | |||
| 1342 | Ga0209970_1000439 | |||
| 1343 | Ga0209282_1000048 | |||
| 1344 | Ga0209282_1000783 | |||
| 1345 | Ga0268266_10465838 | |||
| 1346 | Ga0268265_10025855 | |||
| 1347 | Ga0268265_10035974 | |||
| 1348 | Ga0268265_10078795 | |||
| 1349 | Ga0268264_10329979 | |||
| 1350 | Ga0268264_10433089 | |||
| 1351 | Ga0307517_10176468 | |||
| 1352 | Ga0307515_10000104 | |||
| 1353 | Ga0307515_10001447 | |||
| 1354 | Ga0307515_10001910 | |||
| 1355 | Ga0307515_10007756 | |||
| 1356 | Ga0307515_10014992 | |||
| 1357 | Ga0307515_10030798 | |||
| 1358 | Ga0307515_10148686 | |||
| 1359 | Ga0307515_10254821 | |||
| 1360 | Ga0307512_10015937 | |||
| 1361 | Ga0316176_1160931 | |||
| 1362 | Ga0314311_1018871 | |||
| 1363 | Ga0316180_1072696 | |||
| 1364 | Ga0316183_1116903 | |||
| 1365 | Ga0316182_1114331 | |||
| 1366 | Ga0265327_10007552 | |||
| 1367 | Ga0265327_10120075 | |||
| 1368 | Ga0307513_10007505 | |||
| 1369 | Ga0307513_10013996 | |||
| 1370 | Ga0307513_10247073 | |||
| 1371 | Ga0307509_10228856 | |||
| 1372 | Ga0307408_100000425 | |||
| 1373 | Ga0307408_100249290 | |||
| 1374 | Ga0307408_100541879 | |||
| 1375 | Ga0307408_100654356 | |||
| 1376 | Ga0307508_10000757 | |||
| 1377 | Ga0307514_10001999 | |||
| 1378 | Ga0307514_10005653 | |||
| 1379 | Ga0307514_10012237 | |||
| 1380 | Ga0307514_10154761 | |||
| 1381 | Ga0265314_10024093 | |||
| 1382 | Ga0265314_10219171 | |||
| 1383 | Ga0307516_10000879 | |||
| 1384 | Ga0307516_10009691 | |||
| 1385 | Ga0307405_10025478 | |||
| 1386 | Ga0307405_10058986 | |||
| 1387 | Ga0307405_10071422 | |||
| 1388 | Ga0307405_10082685 | |||
| 1389 | Ga0307405_10153675 | |||
| 1390 | Ga0307405_10427278 | |||
| 1391 | Ga0307413_10045463 | |||
| 1392 | Ga0307413_10096006 | |||
| 1393 | Ga0307413_10516354 | |||
| 1394 | Ga0307410_10023794 | |||
| 1395 | Ga0307410_10359155 | |||
| 1396 | Ga0307406_10000849 | |||
| 1397 | Ga0307406_10014759 | |||
| 1398 | Ga0307406_10024450 | |||
| 1399 | Ga0307406_10092398 | |||
| 1400 | Ga0307412_10019864 | |||
| 1401 | Ga0307412_10048949 | |||
| 1402 | Ga0307412_10068525 | |||
| 1403 | Ga0307412_10212587 | |||
| 1404 | Ga0307412_10214207 | |||
| 1405 | Ga0307412_10345433 | |||
| 1406 | Ga0307409_100002108 | |||
| 1407 | Ga0307409_100016392 | |||
| 1408 | Ga0307409_100865692 | |||
| 1409 | Ga0307416_100000974 | |||
| 1410 | Ga0307416_100039991 | |||
| 1411 | Ga0307416_100458218 | |||
| 1412 | Ga0307414_10200561 | |||
| 1413 | Ga0307411_10016597 | |||
| 1414 | Ga0307411_10028408 | |||
| 1415 | Ga0307411_10699883 | |||
| 1416 | Ga0307415_100016196 | |||
| 1417 | Ga0395899_0001056 | |||
| 1418 | Ga0395900_0332891 | |||
| 1419 | Ga0395900_0760098 | |||
| 1420 | Ga0395898_0004283 | |||
| 1421 | Ga0395898_0079618 | |||
| 1422 | Ga0395905_0001044 | |||
| 1423 | Ga0395905_0020660 | |||
| 1424 | Ga0395901_0000922 | |||
| 1425 | Ga0395901_0063696 | |||
| 1426 | Ga0436365_1028618 | |||
| 1427 | Ga0436361_0335187 | |||
| 1428 | Ga0436361_0432344 | |||
| 1429 | Ga0436363_1708688 | |||
| 1430 | Ga0439436_0000115 | |||
| 1431 | Ga0439436_0010409 | |||
| 1432 | Ga0439439_0068671 | |||
| 1433 | Ga0439439_0075406 | |||
| 1434 | Ga0439447_022188 | |||
| 1435 | Ga0439465_0000808 | |||
| 1436 | Ga0439465_0023133 | |||
| 1437 | Ga0451789_0593619 | |||
| 1438 | Ga0451795_1233687 | |||
| 1439 | Ga0451800_0693667 | |||
| 1440 | Ga0451804_0092695 | |||
| 1441 | Ga0451853_0033084 | |||
| 1442 | Ga0439433_0000104 | |||
| 1443 | Ga0439445_0002012 | |||
| 1444 | Ga0439448_0116250 | |||
| 1445 | Ga0439432_001851 | |||
| 1446 | Ga0439449_0002196 | |||
| 1447 | Ga0439449_0004888 | |||
| 1448 | Ga0439449_0107901 | |||
| 1449 | Ga0439450_032827 | |||
| 1450 | Ga0439452_000603 | |||
| 1451 | Ga0439452_009911 | |||
| 1452 | Ga0450919_003171 | |||
| 1453 | Ga0450919_011728 | |||
| 1454 | Ga0450920_007152 | |||
| 1455 | Ga0450920_017409 | |||
| 1456 | Ga0450890_007008 | |||
| 1457 | Ga0450896_027095 | |||
| 1458 | Ga0450898_004259 | |||
| 1459 | Ga0450910_007614 | |||
| 1460 | Ga0439446_0077242 | |||
| 1461 | Ga0450908_016249 | |||
| 1462 | Ga0439434_0049774 | |||
| 1463 | Ga0450918_000692 | |||
| 1464 | Ga0450918_002503 | |||
| 1465 | Ga0451577_0000142 | |||
| 1466 | Ga0451577_0013160 | |||
| 1467 | Ga0453684_0000126 | |||
| 1468 | Ga0453684_0288399 | |||
| 1469 | Ga0466960_0046143 | |||
| 1470 | Ga0451576_0008009 | |||
| 1471 | Ga0451576_0012713 | |||
| 1472 | Ga0451576_0083681 | |||
| 1473 | Ga0451576_0425718 | |||
| 1474 | Ga0495590_0032979 | |||
| 1475 | Ga0495650_0000131 | |||
| 1476 | Ga0495650_0000189 | |||
| 1477 | Ga0495650_0002492 | |||
| 1478 | Ga0495605_0000003 | |||
| 1479 | Ga0495585_0143894 | |||
| 1480 | Ga0495596_0004647 | |||
| 1481 | Ga0495607_0011973 | |||
| 1482 | Ga0495610_0008515 | |||
| 1483 | Ga0495616_0007192 | |||
| 1484 | Ga0495616_0027530 | |||
| 1485 | Ga0495631_0008971 | |||
| 1486 | Ga0495632_0001209 | |||
| 1487 | Ga0495632_0005271 | |||
| 1488 | Ga0495637_0020430 | |||
| 1489 | Ga0495643_0000328 | |||
| 1490 | Ga0495643_0000702 | |||
| 1491 | Ga0495643_0002881 | |||
| 1492 | Ga0495642_0108684 | |||
| 1493 | Ga0495598_0076028 | |||
| 1494 | Ga0495609_0007705 | |||
| 1495 | Ga0495621_0046084 | |||
| 1496 | Ga0495597_0000024 | |||
| 1497 | Ga0495597_0144395 | |||
| 1498 | Ga0495633_0120414 | |||
| 1499 | Ga0495656_0000287 | |||
| 1500 | Ga0495656_0079269 | |||
| 1501 | Ga0495656_0085465 | |||
| 1502 | Ga0495668_0017695 | |||
| 1503 | Ga0495625_0000317 | |||
| 1504 | Ga0495625_0000533 | |||
| 1505 | Ga0495625_0002445 | |||
| 1506 | Ga0495625_0014641 | |||
| 1507 | Ga0495635_0101961 | |||
| 1508 | Ga0495661_0003204 | |||
| 1509 | Ga0495661_0008066 | |||
| 1510 | Ga0495658_0210067 | |||
| 1511 | Ga0495669_0101159 | |||
| 1512 | Ga0495670_0214160 | |||
| 1513 | Ga0495671_0007159 | |||
| 1514 | Ga0495649_0017074 | |||
| 1515 | Ga0495660_0086594 | |||
| 1516 | Ga0495636_0039759 | |||
| 1517 | Ga0495672_0000165 | |||
| 1518 | Ga0495687_010378 | |||
| 1519 | Ga0495687_064799 | |||
| 1520 | Ga0495677_0004557 | |||
| 1521 | Ga0495685_076888 | |||
| 1522 | Ga0495615_0015184 | |||
| 1523 | Ga0495626_0003640 | |||
| 1524 | Ga0495626_0132217 | |||
| 1525 | Ga0496101_0171137 | |||
| 1526 | Ga0496104_0322680 | |||
| 1527 | Ga0496104_0868516 | |||
| 1528 | Ga0496105_0165324 | |||
| 1529 | Ga0496108_0291770 | |||
| 1530 | Ga0496109_0069604 | |||
| 1531 | Ga0496109_0357466 | |||
| 1532 | Ga0496114_0043982 | |||
| 1533 | Ga0496116_0017337 | |||
| 1534 | Ga0496116_0043647 | |||
| 1535 | Ga0496117_0073408 | |||
| 1536 | Ga0496117_0209510 | |||
| 1537 | Ga0496118_0027309 | |||
| 1538 | Ga0496118_0147638 | |||
| 1539 | Ga0496121_0027569 | |||
| 1540 | Ga0496121_0034342 | |||
| 1541 | Ga0496121_0290683 | |||
| 1542 | Ga0496122_0001392 | |||
| 1543 | Ga0496122_0001678 | |||
| 1544 | Ga0496122_0019689 | |||
| 1545 | Ga0496122_0020671 | |||
| 1546 | Ga0496123_0000102 | |||
| 1547 | Ga0496123_0015355 | |||
| 1548 | Ga0496123_0019688 | |||
| 1549 | Ga0496123_0026399 | |||
| 1550 | Ga0496124_0000126 | |||
| 1551 | Ga0496124_0118206 | |||
| 1552 | Ga0496124_0146253 | |||
| 1553 | Ga0496125_0003314 | |||
| 1554 | Ga0496125_0005567 | |||
| 1555 | Ga0496125_0006122 | |||
| 1556 | Ga0496125_0008416 | |||
| 1557 | Ga0496125_0044650 | |||
| 1558 | Ga0496125_0079741 | |||
| 1559 | Ga0496126_0017829 | |||
| 1560 | Ga0495678_032313 | |||
| 1561 | Ga0501225_0005608 | |||
| 1562 | Ga0501262_000328 | |||
| 1563 | nmdc:mga03683_136909_c1 | |||
| 1564 | nmdc:mga03683_44530_c1 | |||
| 1565 | nmdc:mga00v17_135128_c1 | |||
| 1566 | nmdc:mga00v17_207639_c1 | |||
| 1567 | nmdc:mga00v17_65801_c1 | |||
| 1568 | nmdc:mga0yw44_97375_c1 | |||
| 1569 | nmdc:mga0k408_132862_c1 | |||
| 1570 | nmdc:mga0k408_256104_c1 | |||
| 1571 | nmdc:mga0k408_40364_c1 | |||
| 1572 | nmdc:mga0k408_60761_c1 | |||
| 1573 | nmdc:mga07m45_10975_c1 | |||
| 1574 | nmdc:mga07m45_28932_c1 | |||
| 1575 | nmdc:mga07m45_55894_c1 | |||
| 1576 | nmdc:mga07m45_717_c1 | |||
| 1577 | nmdc:mga07m45_789_c1 | |||
| 1578 | Ga0495612_0075512 | |||
| 1579 | Ga0500610_0002345 | |||
| 1580 | Ga0500610_0031775 | |||
| 1581 | Ga0500578_0000040 | |||
| 1582 | Ga0500651_0000028 | |||
| 1583 | Ga0500651_0126960 | |||
| 1584 | Ga0500571_000016 | |||
| 1585 | Ga0500607_002724 | |||
| 1586 | Ga0500642_0003186 | |||
| 1587 | Ga0500652_003243 | |||
| 1588 | Ga0500655_001317 | |||
| 1589 | Ga0500658_0000097 | |||
| 1590 | Ga0500658_0001213 | |||
| 1591 | Ga0500616_0052203 | |||
| 1592 | Ga0500616_0071872 | |||
| 1593 | Ga0500622_0000138 | |||
| 1594 | Ga0500634_0006895 | |||
| 1595 | Ga0500645_000326 | |||
| 1596 | Ga0500645_003804 | |||
| 1597 | 2511245625 | |||
| 1598 | 2511249593 | |||
| 1599 | 2511384046 | |||
| 1600 | 2513230505 | |||
| 1601 | 2513953948 | |||
| 1602 | 2514040083 | |||
| 1603 | 2521560206 | |||
| 1604 | 2548498878 | |||
| 1605 | 2550695325 | |||
| 1606 | 2553005006 | |||
| 1607 | 2587725780 | |||
| 1608 | 2587735171 | |||
| 1609 | 2587758779 | |||
| 1610 | 2588290711 | |||
| 1611 | 2599623026 | |||
| 1612 | 2599674673 | |||
| 1613 | 2599680630 | |||
| 1614 | 2599692645 | |||
| 1615 | 2643867923 | |||
| 1616 | 2643936454 | |||
| 1617 | 2643972211 | |||
| 1618 | 2643991788 | |||
| 1619 | 2644026226 | |||
| 1620 | 2644058982 | |||
| 1621 | 2644071209 | |||
| 1622 | 2644141678 | |||
| 1623 | 2644162012 | |||
| 1624 | 2644248716 | |||
| 1625 | 2644275551 | |||
| 1626 | 2644293532 | |||
| 1627 | 2644302834 | |||
| 1628 | 2644317810 | |||
| 1629 | 2644325308 | |||
| 1630 | 2644399045 | |||
| 1631 | 2644467287 | |||
| 1632 | 2644648339 | |||
| 1633 | 2722886009 | |||
| 1634 | 2738720945 | |||
| 1635 | 2738886327 | |||
| 1636 | 2739246237 | |||
| 1637 | 2739252143 | |||
| 1638 | 2739280144 | |||
| 1639 | 2765571373 | |||
| 1640 | 2808982459 | |||
| 1641 | 2809129714 | |||
| 1642 | 2809149231 | |||
| 1643 | 2816471385 | |||
| 1644 | 2819592931 | |||
| 1645 | 2819602514 | |||
| 1646 | 2819616563 | |||
| 1647 | 2831272046 | |||
| 1648 | 2834641213 | |||
| 1649 | 2838059865 | |||
| 1650 | 2839099214 | |||
| 1651 | 2839142722 | |||
| 1652 | 2842677734 | |||
| 1653 | 2842718978 | |||
| 1654 | 2842736254 | |||
| 1655 | 2842748750 | |||
| 1656 | 2852619372 | |||
| 1657 | 2881102746 | |||
| 1658 | 2884812088 | |||
| 1659 | 2884838558 | |||
| 1660 | 2884854849 | |||
| 1661 | 2885194884 | |||
| 1662 | 2885198491 | |||
| 1663 | 2885212129 | |||
| 1664 | 2896156482 | |||
| 1665 | 2899928663 | |||
| 1666 | 2901312407 | |||
| 1667 | 2904440754 | |||
| 1668 | 2904451997 | |||
| 1669 | 2904458857 | |||
| 1670 | 2904481065 | |||
| 1671 | 2904535353 | |||
| 1672 | 2904547444 | |||
| 1673 | 2904589169 | |||
| 1674 | 2904594613 | |||
| 1675 | 2904605841 | |||
| 1676 | 2919048919 | |||
| 1677 | 2919084077 | |||
| 1678 | 2919467019 | |||
| 1679 | 2919707213 | |||
| 1680 | 2923513957 | |||
| 1681 | 2928043392 | |||
| 1682 | 2928050834 | |||
| 1683 | 2928056264 | |||
| 1684 | 2928066257 | |||
| 1685 | 2928075894 | |||
| 1686 | 2928090089 | |||
| 1687 | 2928115692 | |||
| 1688 | 2928134769 | |||
| 1689 | 2929165054 | |||
| 1690 | 2929523464 | |||
| 1691 | 2945910335 | |||
| 1692 | 2945946305 | |||
| 1693 | 2945975906 | |||
| 1694 | 2945987621 | |||
| 1695 | 2954768673 | |||
| 1696 | 2974320177 | |||
| 1697 | 2990713710 | |||
| 1698 | 644746743 | |||
| 1699 | 8003401105 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
107
278
0.96
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.7738 | 14 | 242 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7624 | 53 | 241 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.7529 | 48 | 237 |
| 7ahd-assembly1.cif.gz_A | opua (e190q) occluded | 0.7503 | 14 | 242 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.737 | 49 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVG9_10_202_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9262 | 61 | 243 | 1.10.3720.10 |
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.925 | 51 | 242 | 1.10.3720.10 |
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9137 | 57 | 243 | 1.10.3720.10 |
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.913 | 53 | 245 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9085 | 56 | 244 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M1LJI3-F1-model_v4 | ABC transporter permease | 0.9898 | 2 | 254 |
GO:0005886
GO:0055085 |
| AF-E0MTU7-F1-model_v4 | ABC transporter, membrane spanning protein | 0.9858 | 6 | 251 |
GO:0005886
GO:0055085 |
| AF-A0A2D4RY88-F1-model_v4 | ABC transporter permease | 0.9854 | 2 | 249 |
GO:0005886
GO:0055085 |
| AF-A0A1H4ZP04-F1-model_v4 | NitT/TauT family transport system permease protein | 0.985 | 3 | 254 |
GO:0005886
GO:0055085 |
| AF-A0A4P8QRT2-F1-model_v4 | ABC transporter permease | 0.9848 | 5 | 250 |
GO:0005886
GO:0055085 |