F483440

General Info

Members Datasets Scaffolds Average Seq Length
850 385 840 107

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_1025951|Ga0495619_1025951_101_460
Length 119
Sequence LRRLKTKNQEKNMAEKPRLKLPKEAKKGDVIEIKTLMPHIMESGQRKDKDGKPIPRKIINKFTAEFNGKPVFSANLEPAIAANPYMEFYAKVEESGMFKFSWTDDDGTVTTAEEKITVG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
3 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
4 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
5 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
6 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
7 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
8 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
9 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
10 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
11 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
109 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
110 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
111 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
112 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
113 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
114 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
115 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
211 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
212 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
213 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
218 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
219 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
220 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
221 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
223 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
224 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
225 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
237 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
250 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
251 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
252 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
253 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
254 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
255 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
297 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
342 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
346 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
355 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
358 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
359 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
362 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
363 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
364 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
365 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
366 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
367 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
368 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
369 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
370 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
371 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
372 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
373 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
374 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
375 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
376 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
377 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
378 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
379 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
380 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
381 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
382 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
385 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0.24
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 0.47
Rhizoplane 8.47
Rhizosphere 82.12
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C6443 2010549000 Bacteria 1472
2 ARcpr5oldR_c011814 3300000041 Bacteria 746
3 JGI24750J21931_1020184 3300002070 Bacteria 928
4 JGI25406J46586_10000138 3300003203 Bacteria 31765
5 JGI25404J52841_10000288 3300003659 Bacteria 6507
6 JGI25404J52841_10016633 3300003659 Bacteria 1595
7 Ga0065165_1089247 3300005262 Bacteria 788
8 Ga0065712_10806853 3300005290 Bacteria 510
9 Ga0070658_10152408 3300005327 Bacteria 1936
10 Ga0070658_10281288 3300005327 Bacteria 1416
11 Ga0070658_11661314 3300005327 Bacteria 553
12 Ga0070676_10066362 3300005328 Bacteria 2156
13 Ga0070676_10206242 3300005328 Bacteria 1291
14 Ga0070683_100566384 3300005329 Bacteria 1086
15 Ga0070690_100035779 3300005330 Bacteria 3118
16 Ga0070670_100085242 3300005331 Bacteria 2714
17 Ga0068869_100944991 3300005334 Bacteria 748
18 Ga0070666_10044947 3300005335 Bacteria 2960
19 Ga0070666_10170100 3300005335 Bacteria 1526
20 Ga0070680_100073406 3300005336 Bacteria 2814
21 Ga0070682_100022461 3300005337 Bacteria 3737
22 Ga0070682_100691382 3300005337 Bacteria 817
23 Ga0068868_100023195 3300005338 Bacteria 4694
24 Ga0068868_100302903 3300005338 Bacteria 1358
25 Ga0070660_101517973 3300005339 Bacteria 570
26 Ga0070689_100271674 3300005340 Bacteria 1404
27 Ga0070691_10092647 3300005341 Bacteria 1492
28 Ga0070687_100655484 3300005343 Bacteria 728
29 Ga0070687_101266715 3300005343 Bacteria 546
30 Ga0070661_100063833 3300005344 Bacteria 2705
31 Ga0070661_100128827 3300005344 Bacteria 1900
32 Ga0070668_100111063 3300005347 Bacteria 2182
33 Ga0070669_100463638 3300005353 Bacteria 1046
34 Ga0070669_101941653 3300005353 Bacteria 514
35 Ga0070675_101292694 3300005354 Bacteria 672
36 Ga0070671_100075228 3300005355 Bacteria 2821
37 Ga0070671_100126562 3300005355 Bacteria 2151
38 Ga0070674_100118540 3300005356 Bacteria 1956
39 Ga0070674_100385100 3300005356 Bacteria 1142
40 Ga0070673_100031259 3300005364 Bacteria 3993
41 Ga0070673_100221129 3300005364 Bacteria 1639
42 Ga0070673_101180251 3300005364 Bacteria 717
43 Ga0070688_100016483 3300005365 Bacteria 4225
44 Ga0070667_100096956 3300005367 Bacteria 2543
45 Ga0070667_100277815 3300005367 Bacteria 1503
46 Ga0070709_10000855 3300005434 Bacteria 17027
47 Ga0070709_10004300 3300005434 Bacteria 7681
48 Ga0070709_10022160 3300005434 Bacteria 3711
49 Ga0070709_10023003 3300005434 Bacteria 3653
50 Ga0070709_10229367 3300005434 Bacteria 1328
51 Ga0070714_100431103 3300005435 Bacteria 1250
52 Ga0070714_100474559 3300005435 Bacteria 1190
53 Ga0070713_100002359 3300005436 Bacteria 12318
54 Ga0070713_100004066 3300005436 Bacteria 9738
55 Ga0070713_100031837 3300005436 Bacteria 4205
56 Ga0070713_100149309 3300005436 Bacteria 2077
57 Ga0070713_100306657 3300005436 Bacteria 1463
58 Ga0070713_101195986 3300005436 Bacteria 736
59 Ga0070710_10003385 3300005437 Bacteria 7554
60 Ga0070710_10029684 3300005437 Bacteria 2935
61 Ga0070710_10077078 3300005437 Bacteria 1936
62 Ga0070710_10096625 3300005437 Bacteria 1751
63 Ga0070710_10756435 3300005437 Bacteria 690
64 Ga0070711_100017702 3300005439 Bacteria 4539
65 Ga0070711_100017962 3300005439 Bacteria 4509
66 Ga0070711_100088060 3300005439 Bacteria 2230
67 Ga0070711_100128053 3300005439 Bacteria 1887
68 Ga0070711_100209488 3300005439 Bacteria 1509
69 Ga0070711_100506323 3300005439 Bacteria 996
70 Ga0070711_100838504 3300005439 Bacteria 781
71 Ga0070705_100221343 3300005440 Bacteria 1311
72 Ga0070700_100532159 3300005441 Bacteria 910
73 Ga0070700_101052240 3300005441 Bacteria 672
74 Ga0070694_100356334 3300005444 Bacteria 1135
75 Ga0070708_100206734 3300005445 Bacteria 1839
76 Ga0070708_101359363 3300005445 Bacteria 663
77 Ga0070663_100343464 3300005455 Bacteria 1207
78 Ga0070663_100412822 3300005455 Bacteria 1106
79 Ga0070678_100306263 3300005456 Bacteria 1352
80 Ga0070662_100448422 3300005457 Bacteria 1071
81 Ga0070681_10013271 3300005458 Bacteria 8185
82 Ga0068867_100235985 3300005459 Bacteria 1481
83 Ga0068867_100804167 3300005459 Bacteria 839
84 Ga0070685_10153929 3300005466 Bacteria 1459
85 Ga0070685_10281094 3300005466 Bacteria 1114
86 Ga0070679_100085231 3300005530 Bacteria 3146
87 Ga0070679_100122492 3300005530 Bacteria 2584
88 Ga0070684_100525862 3300005535 Bacteria 1096
89 Ga0070684_101177447 3300005535 Bacteria 721
90 Ga0068853_100068998 3300005539 Bacteria 3074
91 Ga0068853_100732708 3300005539 Bacteria 944
92 Ga0068853_100960902 3300005539 Bacteria 822
93 Ga0070686_100055931 3300005544 Bacteria 2529
94 Ga0070695_100065695 3300005545 Bacteria 2363
95 Ga0070695_100285865 3300005545 Bacteria 1214
96 Ga0070696_100142454 3300005546 Bacteria 1753
97 Ga0070696_100609966 3300005546 Bacteria 881
98 Ga0070693_100058059 3300005547 Bacteria 2239
99 Ga0070693_100248190 3300005547 Bacteria 1179
100 Ga0070693_100523254 3300005547 Bacteria 845
101 Ga0070693_100570628 3300005547 Bacteria 813
102 Ga0070665_100053413 3300005548 Bacteria 4052
103 Ga0070665_100069877 3300005548 Bacteria 3519
104 Ga0070665_100806559 3300005548 Bacteria 952
105 Ga0070704_101839071 3300005549 Bacteria 561
106 Ga0068855_100187602 3300005563 Bacteria 2335
107 Ga0068855_100677922 3300005563 Bacteria 1105
108 Ga0070664_100038514 3300005564 Bacteria 4024
109 Ga0070664_100523617 3300005564 Bacteria 1094
110 Ga0068857_100291795 3300005577 Bacteria 1502
111 Ga0068856_100084891 3300005614 Bacteria 3146
112 Ga0068856_101698263 3300005614 Bacteria 644
113 Ga0070702_100019143 3300005615 Bacteria 3563
114 Ga0070702_100469588 3300005615 Bacteria 917
115 Ga0068852_100348236 3300005616 Bacteria 1446
116 Ga0068859_100071001 3300005617 Bacteria 3517
117 Ga0068864_100088136 3300005618 Bacteria 2733
118 Ga0068864_100316532 3300005618 Bacteria 1464
119 Ga0068866_11269959 3300005718 Bacteria 534
120 Ga0068861_100600781 3300005719 Bacteria 1010
121 Ga0068861_101854549 3300005719 Bacteria 599
122 Ga0068851_10366750 3300005834 Bacteria 841
123 Ga0068863_100067439 3300005841 Bacteria 3384
124 Ga0068863_100615180 3300005841 Bacteria 1076
125 Ga0068858_100059299 3300005842 Bacteria 3537
126 Ga0068860_100000360 3300005843 Bacteria 60297
127 Ga0068860_100094153 3300005843 Bacteria 2855
128 Ga0068860_102313443 3300005843 Bacteria 558
129 Ga0068862_100500977 3300005844 Bacteria 1153
130 Ga0081455_10551309 3300005937 Bacteria 762
131 Ga0081540_1027303 3300005983 Bacteria 3238
132 Ga0081540_1029140 3300005983 Bacteria 3082
133 Ga0070717_10003328 3300006028 Bacteria 11477
134 Ga0070717_10007544 3300006028 Bacteria 8083
135 Ga0070717_10221253 3300006028 Bacteria 1664
136 Ga0070717_10391088 3300006028 Bacteria 1248
137 Ga0070717_10780830 3300006028 Bacteria 869
138 Ga0070717_10904072 3300006028 Bacteria 804
139 Ga0075365_10339531 3300006038 Bacteria 1058
140 Ga0075364_10105653 3300006051 Bacteria 1876
141 Ga0070715_10093139 3300006163 Bacteria 1391
142 Ga0070715_10179947 3300006163 Bacteria 1059
143 Ga0070715_10277313 3300006163 Bacteria 887
144 Ga0070715_10595935 3300006163 Bacteria 647
145 Ga0070716_100002233 3300006173 Bacteria 8923
146 Ga0070716_100031117 3300006173 Bacteria 2900
147 Ga0070712_100010775 3300006175 Bacteria 5779
148 Ga0070712_100051207 3300006175 Bacteria 2876
149 Ga0070712_100156648 3300006175 Bacteria 1755
150 Ga0070712_100441075 3300006175 Bacteria 1083
151 Ga0070712_100771012 3300006175 Bacteria 824
152 Ga0097621_100008876 3300006237 Bacteria 7268
153 Ga0097621_100026444 3300006237 Bacteria 4552
154 Ga0097621_100359483 3300006237 Bacteria 1297
155 Ga0097621_101183291 3300006237 Bacteria 720
156 Ga0068871_100015537 3300006358 Bacteria 5702
157 Ga0068871_100241467 3300006358 Bacteria 1571
158 Ga0075433_10423626 3300006852 Bacteria 1174
159 Ga0075434_100512931 3300006871 Bacteria 1219
160 Ga0075434_100581087 3300006871 Bacteria 1139
161 Ga0068865_100009015 3300006881 Bacteria 6171
162 Ga0068865_100415311 3300006881 Bacteria 1105
163 Ga0075436_100031219 3300006914 Bacteria 3668
164 Ga0075436_100414882 3300006914 Bacteria 977
165 Ga0097620_100071001 3300006931 Bacteria 3517
166 Ga0075435_100492508 3300007076 Bacteria 1059
167 Ga0099794_10252337 3300007265 Bacteria 910
168 Ga0105251_10012262 3300009011 Bacteria 4857
169 Ga0105245_10038270 3300009098 Bacteria 4268
170 Ga0105245_10287853 3300009098 Bacteria 1608
171 Ga0105245_11861990 3300009098 Bacteria 655
172 Ga0105247_10079094 3300009101 Bacteria 2069
173 Ga0105247_10086615 3300009101 Bacteria 1982
174 Ga0105247_10295137 3300009101 Bacteria 1122
175 Ga0105247_10390936 3300009101 Bacteria 988
176 Ga0105247_11027366 3300009101 Bacteria 645
177 Ga0105243_10080808 3300009148 Bacteria 2652
178 Ga0105243_10374450 3300009148 Bacteria 1315
179 Ga0105241_10037102 3300009174 Bacteria 3671
180 Ga0105241_10141127 3300009174 Bacteria 1962
181 Ga0105241_10358358 3300009174 Bacteria 1268
182 Ga0105242_10006274 3300009176 Bacteria 9156
183 Ga0105242_10059085 3300009176 Bacteria 3145
184 Ga0105242_10408608 3300009176 Bacteria 1269
185 Ga0105248_10065160 3300009177 Bacteria 4090
186 Ga0105248_10207704 3300009177 Bacteria 2206
187 Ga0105248_11436975 3300009177 Bacteria 781
188 Ga0105237_10021234 3300009545 Bacteria 6678
189 Ga0105237_10714057 3300009545 Bacteria 1009
190 Ga0105237_10996490 3300009545 Bacteria 845
191 Ga0105238_10027647 3300009551 Bacteria 5781
192 Ga0105238_10373216 3300009551 Bacteria 1417
193 Ga0105238_11148679 3300009551 Bacteria 800
194 Ga0105238_12070457 3300009551 Bacteria 603
195 Ga0105238_12678210 3300009551 Bacteria 535
196 Ga0105249_11247695 3300009553 Bacteria 815
197 Ga0105249_11523571 3300009553 Bacteria 741
198 Ga0105249_12134949 3300009553 Bacteria 633
199 Ga0105239_10074149 3300010375 Bacteria 3742
200 Ga0105239_10267093 3300010375 Bacteria 1924
201 Ga0105239_10304214 3300010375 Bacteria 1796
202 Ga0105239_10599290 3300010375 Bacteria 1257
203 Ga0105239_11040318 3300010375 Bacteria 942
204 Ga0105239_11652668 3300010375 Bacteria 741
205 Ga0105239_12356119 3300010375 Bacteria 620
206 Ga0105246_10053735 3300011119 Bacteria 2773
207 Ga0105246_10296493 3300011119 Bacteria 1303
208 Ga0157336_1011918 3300012477 Bacteria 683
209 Ga0157335_1000825 3300012492 Bacteria 1544
210 Ga0157345_1019228 3300012498 Bacteria 681
211 Ga0157314_1052637 3300012500 Bacteria 525
212 Ga0157313_1026749 3300012503 Bacteria 628
213 Ga0157324_1030507 3300012506 Bacteria 608
214 Ga0157316_1027201 3300012510 Bacteria 669
215 Ga0157338_1017731 3300012515 Bacteria 800
216 Ga0157370_11778711 3300013104 Bacteria 553
217 Ga0157374_10179291 3300013296 Bacteria 2069
218 Ga0157374_10208823 3300013296 Bacteria 1914
219 Ga0157378_10094941 3300013297 Bacteria 2716
220 Ga0157378_10934671 3300013297 Bacteria 899
221 Ga0157378_11010931 3300013297 Bacteria 866
222 Ga0157378_12095805 3300013297 Bacteria 616
223 Ga0163162_10108966 3300013306 Bacteria 2866
224 Ga0163162_10246430 3300013306 Bacteria 1918
225 Ga0163162_11121669 3300013306 Bacteria 891
226 Ga0157372_10134988 3300013307 Bacteria 2841
227 Ga0157372_12182728 3300013307 Bacteria 636
228 Ga0157375_10135433 3300013308 Bacteria 2586
229 Ga0157375_10329773 3300013308 Bacteria 1691
230 Ga0157375_10852394 3300013308 Bacteria 1058
231 Ga0163163_10335512 3300014325 Bacteria 1567
232 Ga0163163_10753207 3300014325 Bacteria 1037
233 Ga0157380_11841068 3300014326 Bacteria 665
234 Ga0157379_10007831 3300014968 Bacteria 9252
235 Ga0157379_10166035 3300014968 Bacteria 1992
236 Ga0157379_10829249 3300014968 Bacteria 874
237 Ga0157376_10448835 3300014969 Bacteria 1257
238 Ga0157376_10873512 3300014969 Bacteria 916
239 Ga0157376_10973157 3300014969 Bacteria 870
240 Ga0163161_10026256 3300017792 Bacteria 4126
241 Ga0163161_10068276 3300017792 Bacteria 2597
242 Ga0213876_10179521 3300021384 Bacteria 1126
243 Ga0213875_10477209 3300021388 Bacteria 598
244 Ga0207697_10228483 3300025315 Bacteria 821
245 Ga0207692_10005372 3300025898 Bacteria 5131
246 Ga0207692_10069774 3300025898 Bacteria 1848
247 Ga0207692_10340830 3300025898 Bacteria 922
248 Ga0207692_10361122 3300025898 Bacteria 897
249 Ga0207692_10564439 3300025898 Bacteria 728
250 Ga0207642_10301087 3300025899 Bacteria 929
251 Ga0207710_10046975 3300025900 Bacteria 1928
252 Ga0207710_10050402 3300025900 Bacteria 1868
253 Ga0207710_10072035 3300025900 Bacteria 1586
254 Ga0207710_10162358 3300025900 Bacteria 1089
255 Ga0207710_10359226 3300025900 Bacteria 743
256 Ga0207710_10401078 3300025900 Bacteria 704
257 Ga0207688_10391025 3300025901 Bacteria 861
258 Ga0207680_10029075 3300025903 Bacteria 3100
259 Ga0207685_10004129 3300025905 Bacteria 3644
260 Ga0207685_10029551 3300025905 Bacteria 1941
261 Ga0207685_10090429 3300025905 Bacteria 1287
262 Ga0207685_10174449 3300025905 Bacteria 992
263 Ga0207685_10179973 3300025905 Bacteria 979
264 Ga0207699_10001161 3300025906 Bacteria 12456
265 Ga0207699_10012349 3300025906 Bacteria 4344
266 Ga0207699_10014207 3300025906 Bacteria 4097
267 Ga0207699_10140066 3300025906 Bacteria 1589
268 Ga0207699_10328840 3300025906 Bacteria 1074
269 Ga0207699_10405139 3300025906 Bacteria 972
270 Ga0207645_10023325 3300025907 Bacteria 4022
271 Ga0207645_10528976 3300025907 Bacteria 799
272 Ga0207705_11434259 3300025909 Bacteria 524
273 Ga0207654_10043742 3300025911 Bacteria 2540
274 Ga0207654_10066063 3300025911 Bacteria 2132
275 Ga0207654_10235678 3300025911 Bacteria 1221
276 Ga0207707_10026208 3300025912 Bacteria 5096
277 Ga0207707_10340876 3300025912 Bacteria 1292
278 Ga0207671_10245556 3300025914 Bacteria 1407
279 Ga0207671_10642360 3300025914 Bacteria 845
280 Ga0207693_10003131 3300025915 Bacteria 14229
281 Ga0207693_10043770 3300025915 Bacteria 3520
282 Ga0207693_10058351 3300025915 Bacteria 3024
283 Ga0207693_10181380 3300025915 Bacteria 1657
284 Ga0207693_10225292 3300025915 Bacteria 1473
285 Ga0207663_10015462 3300025916 Bacteria 4210
286 Ga0207663_10061185 3300025916 Bacteria 2388
287 Ga0207663_10071436 3300025916 Bacteria 2240
288 Ga0207663_10188456 3300025916 Bacteria 1479
289 Ga0207663_10380554 3300025916 Bacteria 1075
290 Ga0207660_10788538 3300025917 Bacteria 775
291 Ga0207657_10162543 3300025919 Bacteria 1813
292 Ga0207649_10148323 3300025920 Bacteria 1612
293 Ga0207652_10098796 3300025921 Bacteria 2575
294 Ga0207652_10246038 3300025921 Bacteria 1612
295 Ga0207652_10599659 3300025921 Bacteria 988
296 Ga0207681_10554856 3300025923 Bacteria 946
297 Ga0207694_10040173 3300025924 Bacteria 3601
298 Ga0207694_10150540 3300025924 Bacteria 1874
299 Ga0207694_10633556 3300025924 Bacteria 900
300 Ga0207650_10259172 3300025925 Bacteria 1410
301 Ga0207659_11661661 3300025926 Bacteria 544
302 Ga0207687_10012582 3300025927 Bacteria 5527
303 Ga0207687_10033806 3300025927 Bacteria 3469
304 Ga0207687_10757178 3300025927 Bacteria 827
305 Ga0207700_10000917 3300025928 Bacteria 16892
306 Ga0207700_10021942 3300025928 Bacteria 4372
307 Ga0207700_10053149 3300025928 Bacteria 3033
308 Ga0207700_10102651 3300025928 Bacteria 2285
309 Ga0207700_10993708 3300025928 Bacteria 751
310 Ga0207700_11438312 3300025928 Bacteria 612
311 Ga0207664_10100523 3300025929 Bacteria 2388
312 Ga0207664_10261339 3300025929 Bacteria 1514
313 Ga0207664_10395828 3300025929 Bacteria 1228
314 Ga0207664_10418862 3300025929 Bacteria 1193
315 Ga0207664_11175493 3300025929 Bacteria 685
316 Ga0207664_11915049 3300025929 Bacteria 516
317 Ga0207644_10007559 3300025931 Bacteria 7084
318 Ga0207644_10115945 3300025931 Bacteria 2032
319 Ga0207644_11390102 3300025931 Bacteria 590
320 Ga0207706_10014945 3300025933 Bacteria 7030
321 Ga0207706_10189748 3300025933 Bacteria 1804
322 Ga0207686_10011564 3300025934 Bacteria 4836
323 Ga0207686_10507143 3300025934 Bacteria 937
324 Ga0207686_10847197 3300025934 Bacteria 735
325 Ga0207709_10125631 3300025935 Bacteria 1739
326 Ga0207709_10459689 3300025935 Bacteria 986
327 Ga0207709_10818320 3300025935 Bacteria 753
328 Ga0207670_10017561 3300025936 Bacteria 4326
329 Ga0207669_10767290 3300025937 Bacteria 797
330 Ga0207669_11343895 3300025937 Bacteria 608
331 Ga0207704_11180102 3300025938 Bacteria 652
332 Ga0207704_11339485 3300025938 Bacteria 613
333 Ga0207665_10000333 3300025939 Bacteria 32450
334 Ga0207665_10021917 3300025939 Bacteria 4201
335 Ga0207665_10111445 3300025939 Bacteria 1923
336 Ga0207711_10086244 3300025941 Bacteria 2752
337 Ga0207711_10107904 3300025941 Bacteria 2472
338 Ga0207711_10988006 3300025941 Bacteria 781
339 Ga0207689_10031849 3300025942 Bacteria 4386
340 Ga0207661_10862847 3300025944 Bacteria 833
341 Ga0207679_10701872 3300025945 Bacteria 918
342 Ga0207679_10876866 3300025945 Bacteria 820
343 Ga0207679_11669890 3300025945 Bacteria 583
344 Ga0207667_10168621 3300025949 Bacteria 2250
345 Ga0207667_10230228 3300025949 Bacteria 1898
346 Ga0207667_10814489 3300025949 Bacteria 930
347 Ga0207651_10072873 3300025960 Bacteria 2440
348 Ga0207712_10538677 3300025961 Bacteria 1003
349 Ga0207712_11132787 3300025961 Bacteria 697
350 Ga0207658_10047022 3300025986 Bacteria 3155
351 Ga0207658_10071512 3300025986 Bacteria 2627
352 Ga0207677_10139446 3300026023 Bacteria 1854
353 Ga0207677_11789826 3300026023 Bacteria 570
354 Ga0207703_10139094 3300026035 Bacteria 2105
355 Ga0207703_10333842 3300026035 Bacteria 1391
356 Ga0207703_10921854 3300026035 Bacteria 837
357 Ga0207703_11003981 3300026035 Bacteria 801
358 Ga0207703_12020444 3300026035 Bacteria 553
359 Ga0207639_10089016 3300026041 Bacteria 2465
360 Ga0207639_10400976 3300026041 Bacteria 1236
361 Ga0207639_10909645 3300026041 Bacteria 823
362 Ga0207639_11390914 3300026041 Bacteria 659
363 Ga0207678_10097972 3300026067 Bacteria 2505
364 Ga0207678_10107195 3300026067 Bacteria 2383
365 Ga0207678_10239787 3300026067 Bacteria 1553
366 Ga0207708_10038595 3300026075 Bacteria 3638
367 Ga0207708_10354172 3300026075 Bacteria 1205
368 Ga0207702_10276224 3300026078 Bacteria 1586
369 Ga0207702_11533230 3300026078 Bacteria 660
370 Ga0207641_10212558 3300026088 Bacteria 1789
371 Ga0207641_10750393 3300026088 Bacteria 963
372 Ga0207641_11516139 3300026088 Bacteria 672
373 Ga0207648_10124866 3300026089 Bacteria 2263
374 Ga0207648_10186503 3300026089 Bacteria 1837
375 Ga0207676_10186879 3300026095 Bacteria 1819
376 Ga0207675_102137106 3300026118 Bacteria 576
377 Ga0207683_10001447 3300026121 Bacteria 21461
378 Ga0207683_10153592 3300026121 Bacteria 2078
379 Ga0207683_10254310 3300026121 Bacteria 1603
380 Ga0207698_10383176 3300026142 Bacteria 1338
381 Ga0207698_10398539 3300026142 Bacteria 1315
382 Ga0209971_1154606 3300027682 Bacteria 566
383 Ga0209966_1014410 3300027695 Bacteria 1475
384 Ga0209974_10036257 3300027876 Bacteria 1638
385 Ga0265357_1020655 3300028023 Bacteria 720
386 Ga0268266_10025953 3300028379 Bacteria 4984
387 Ga0268266_10136477 3300028379 Bacteria 2198
388 Ga0268266_10243092 3300028379 Bacteria 1662
389 Ga0268265_12194390 3300028380 Bacteria 559
390 Ga0268264_10000030 3300028381 Bacteria 418542
391 Ga0268264_10483253 3300028381 Bacteria 1205
392 Ga0268264_10656641 3300028381 Bacteria 1038
393 Ga0265337_1001486 3300028556 Bacteria 11490
394 Ga0265338_10247553 3300028800 Bacteria 1316
395 Ga0265338_10306413 3300028800 Bacteria 1153
396 Ga0307511_10107189 3300030521 Bacteria 1800
397 Ga0265763_1005459 3300030763 Bacteria 1067
398 Ga0265773_1031879 3300031018 Bacteria 570
399 Ga0265332_10000899 3300031238 Bacteria 17859
400 Ga0265332_10175142 3300031238 Bacteria 895
401 Ga0265325_10000049 3300031241 Bacteria 80854
402 Ga0265325_10083742 3300031241 Bacteria 1582
403 Ga0265325_10242883 3300031241 Bacteria 818
404 Ga0265329_10221386 3300031242 Bacteria 626
405 Ga0265340_10005450 3300031247 Bacteria 7065
406 Ga0265340_10166484 3300031247 Bacteria 1000
407 Ga0265339_10058197 3300031249 Bacteria 2087
408 Ga0265339_10210681 3300031249 Bacteria 955
409 Ga0265331_10149249 3300031250 Bacteria 1062
410 Ga0265316_10261497 3300031344 Bacteria 1269
411 Ga0265316_10278153 3300031344 Bacteria 1223
412 Ga0307509_10014245 3300031507 Bacteria 9362
413 Ga0265313_10036963 3300031595 Bacteria 2447
414 Ga0307508_10173191 3300031616 Bacteria 1761
415 Ga0265314_10000784 3300031711 Bacteria 37699
416 Ga0265314_10005953 3300031711 Bacteria 10894
417 Ga0265314_10044806 3300031711 Bacteria 3132
418 Ga0265342_10000392 3300031712 Bacteria 48362
419 Ga0265342_10166027 3300031712 Bacteria 1218
420 Ga0307516_10005995 3300031730 Bacteria 14363
421 Ga0326468_10081748 3300031889 Bacteria 559
422 Ga0307510_10283860 3300033180 Bacteria 1125
423 Ga0373950_0018390 3300034818 Bacteria 1212
424 Ga0373958_0085356 3300034819 Bacteria 720
425 Ga0373959_0017137 3300034820 Bacteria 1350
426 Ga0373959_0087871 3300034820 Bacteria 725
427 Ga0373938_0008109 3300034957 Bacteria 1868
428 Ga0373926_0006103 3300035083 Bacteria 3991
429 Ga0373928_0004039 3300035084 Bacteria 2800
430 Ga0373934_0022825 3300035086 Bacteria 2415
431 Ga0373934_0120017 3300035086 Bacteria 1069
432 Ga0373940_0167330 3300035088 Bacteria 709
433 Ga0373949_0027055 3300035090 Bacteria 1347
434 Ga0373951_0006562 3300035091 Bacteria 2660
435 Ga0373952_0061984 3300035092 Bacteria 917
436 Ga0373923_0078244 3300035111 Bacteria 1431
437 Ga0373932_0003814 3300035112 Bacteria 3601
438 Ga0373932_0181145 3300035112 Bacteria 739
439 Ga0373939_0016078 3300035114 Bacteria 1968
440 Ga0373941_0013677 3300035115 Bacteria 2152
441 Ga0373945_0055006 3300035116 Bacteria 1472
442 Ga0373953_0006441 3300035117 Bacteria 3868
443 Ga0373953_0042214 3300035117 Bacteria 1817
444 Ga0373953_0128359 3300035117 Bacteria 1080
445 Ga0373954_0008900 3300035118 Bacteria 4417
446 Ga0373954_0200643 3300035118 Bacteria 980
447 Ga0373954_0224537 3300035118 Bacteria 924
448 Ga0373956_0019629 3300035119 Bacteria 2868
449 Ga0373956_0076710 3300035119 Bacteria 1530
450 Ga0373956_0257183 3300035119 Bacteria 830
451 Ga0373957_0341802 3300035120 Bacteria 638
452 Ga0373957_0419885 3300035120 Bacteria 577
453 Ga0373960_0004580 3300035121 Bacteria 3174
454 Ga0373943_0138348 3300035170 Bacteria 1310
455 Ga0373943_0374997 3300035170 Bacteria 818
456 Ga0373943_0433959 3300035170 Bacteria 761
457 Ga0373946_0022847 3300035171 Bacteria 2439
458 Ga0373946_0059173 3300035171 Bacteria 1625
459 Ga0373946_0178157 3300035171 Bacteria 1007
460 Ga0373955_0024935 3300035172 Bacteria 3064
461 Ga0373955_0144548 3300035172 Bacteria 1396
462 Ga0373955_0194939 3300035172 Bacteria 1205
463 Ga0373955_0615985 3300035172 Bacteria 665
464 Ga0373942_0057053 3300035207 Bacteria 1110
465 Ga0373961_0061888 3300035241 Bacteria 1138
466 Ga0373962_0057562 3300035242 Bacteria 1134
467 Ga0373962_0078344 3300035242 Bacteria 999
468 Ga0316574_0791808 3300035398 Bacteria 577
469 Ga0373924_0008024 3300035410 Bacteria 3821
470 Ga0373924_0029447 3300035410 Bacteria 2195
471 Ga0373924_0033955 3300035410 Bacteria 2063
472 Ga0373924_0044023 3300035410 Bacteria 1834
473 Ga0373931_0004569 3300035691 Bacteria 6331
474 Ga0373935_0004548 3300035692 Bacteria 8158
475 Ga0373935_0015490 3300035692 Bacteria 4609
476 Ga0373935_0035574 3300035692 Bacteria 3109
477 Ga0373935_0067946 3300035692 Bacteria 2293
478 Ga0373935_0104396 3300035692 Bacteria 1873
479 Ga0373935_0677034 3300035692 Bacteria 758
480 Ga0373927_0017601 3300035695 Bacteria 4702
481 Ga0373927_0184081 3300035695 Bacteria 1370
482 Ga0373927_0211276 3300035695 Bacteria 1274
483 Ga0373933_0002449 3300035724 Bacteria 10458
484 Ga0373933_0260278 3300035724 Bacteria 1118
485 Ga0373947_0005403 3300035725 Bacteria 7458
486 Ga0373947_0018365 3300035725 Bacteria 4024
487 Ga0373947_0119293 3300035725 Bacteria 1674
488 Ga0373947_0124973 3300035725 Bacteria 1637
489 Ga0373947_0202839 3300035725 Bacteria 1298
490 Ga0373947_0473216 3300035725 Bacteria 850
491 Ga0373937_0002996 3300036401 Bacteria 14164
492 Ga0373937_0008068 3300036401 Bacteria 9135
493 Ga0373937_0008991 3300036401 Bacteria 8673
494 Ga0373937_0142283 3300036401 Bacteria 2245
495 Ga0373937_0345221 3300036401 Bacteria 1410
496 Ga0373937_0516898 3300036401 Bacteria 1134
497 Ga0373937_0873754 3300036401 Bacteria 848
498 Ga0373937_2008695 3300036401 Bacteria 524
499 Ga0373925_0025234 3300037068 Bacteria 4340
500 Ga0373925_0098740 3300037068 Bacteria 2241
501 Ga0373925_0101593 3300037068 Bacteria 2211
502 Ga0373925_0742294 3300037068 Bacteria 809
503 Ga0373925_0759985 3300037068 Bacteria 799
504 Ga0395898_0613059 3300037466 Bacteria 1031
505 Ga0436364_0364973 3300037853 Bacteria 864
506 Ga0436365_0090047 3300039437 Bacteria 3528
507 Ga0436365_0390621 3300039437 Bacteria 505
508 Ga0436360_0203691 3300039438 Bacteria 1773
509 Ga0439465_0071611 3300041413 Bacteria 1163
510 Ga0451802_0275182 3300041460 Bacteria 1388
511 Ga0451841_0043378 3300041498 Bacteria 563
512 Ga0451843_0333450 3300041509 Bacteria 625
513 Ga0439455_0140561 3300042012 Bacteria 684
514 Ga0439464_0120779 3300042439 Bacteria 807
515 Ga0439464_0128357 3300042439 Bacteria 784
516 Ga0466967_1019021 3300045976 Bacteria 824
517 Ga0495592_0001840 3300046454 Bacteria 14914
518 Ga0495592_0010619 3300046454 Bacteria 6945
519 Ga0495592_0626729 3300046454 Bacteria 653
520 Ga0495603_0011026 3300046455 Bacteria 5480
521 Ga0495603_0037807 3300046455 Bacteria 2895
522 Ga0495629_0000269 3300046459 Bacteria 45206
523 Ga0495629_0069439 3300046459 Bacteria 2458
524 Ga0495629_0089738 3300046459 Bacteria 2144
525 Ga0495638_0040160 3300046460 Bacteria 2966
526 Ga0495641_0026269 3300046461 Bacteria 2843
527 Ga0495641_0042734 3300046461 Bacteria 2099
528 Ga0495641_0150265 3300046461 Bacteria 1041
529 Ga0495641_0317993 3300046461 Unclassified 702
530 Ga0495651_0005718 3300046462 Bacteria 9477
531 Ga0495651_0010406 3300046462 Bacteria 7147
532 Ga0495651_0064265 3300046462 Bacteria 2805
533 Ga0495651_0185639 3300046462 Bacteria 1468
534 Ga0495651_0360559 3300046462 Bacteria 958
535 Ga0495651_0460971 3300046462 Bacteria 820
536 Ga0495653_0010063 3300046463 Bacteria 7736
537 Ga0495653_0030364 3300046463 Bacteria 4306
538 Ga0495653_0146642 3300046463 Bacteria 1653
539 Ga0495653_0171215 3300046463 Bacteria 1499
540 Ga0495653_0216780 3300046463 Bacteria 1289
541 Ga0495653_0967615 3300046463 Bacteria 504
542 Ga0495580_0243568 3300046472 Bacteria 1232
543 Ga0495580_0560182 3300046472 Bacteria 758
544 Ga0495580_0651674 3300046472 Bacteria 692
545 Ga0495582_0003928 3300046473 Bacteria 8349
546 Ga0495582_0109872 3300046473 Bacteria 1548
547 Ga0495639_0396873 3300046475 Bacteria 696
548 Ga0495662_0105186 3300046476 Bacteria 1381
549 Ga0495662_0114856 3300046476 Bacteria 1320
550 Ga0495664_0010264 3300046477 Bacteria 5254
551 Ga0495664_0021710 3300046477 Bacteria 3709
552 Ga0495664_0118438 3300046477 Bacteria 1601
553 Ga0495664_0238448 3300046477 Bacteria 1100
554 Ga0495594_0009788 3300046499 Bacteria 4963
555 Ga0495594_0027976 3300046499 Bacteria 3040
556 Ga0495608_0001268 3300046511 Bacteria 17936
557 Ga0495608_0016256 3300046511 Bacteria 5147
558 Ga0495608_0285310 3300046511 Bacteria 1024
559 Ga0495610_0301084 3300046512 Bacteria 618
560 Ga0495618_0037072 3300046514 Bacteria 3061
561 Ga0495618_0088979 3300046514 Bacteria 1974
562 Ga0495618_0254207 3300046514 Bacteria 1102
563 Ga0495618_0331159 3300046514 Bacteria 941
564 Ga0495618_0574481 3300046514 Bacteria 673
565 Ga0495618_0597161 3300046514 Bacteria 657
566 Ga0495628_0005226 3300046516 Bacteria 11394
567 Ga0495628_0268395 3300046516 Bacteria 1270
568 Ga0495630_0192162 3300046517 Bacteria 1557
569 Ga0495630_0475487 3300046517 Bacteria 958
570 Ga0495630_0638424 3300046517 Bacteria 816
571 Ga0495666_0167651 3300046526 Bacteria 1016
572 Ga0495652_0061818 3300046529 Bacteria 3160
573 Ga0495652_0077885 3300046529 Bacteria 2746
574 Ga0495652_0216037 3300046529 Bacteria 1444
575 Ga0495652_0224929 3300046529 Bacteria 1407
576 Ga0495640_0006352 3300046533 Bacteria 9365
577 Ga0495640_0018005 3300046533 Bacteria 5252
578 Ga0495640_0040789 3300046533 Bacteria 3248
579 Ga0495640_0422869 3300046533 Bacteria 816
580 Ga0495586_0011910 3300046535 Bacteria 4619
581 Ga0495586_0171759 3300046535 Bacteria 1225
582 Ga0495587_0000620 3300046536 Bacteria 24097
583 Ga0495587_0058326 3300046536 Bacteria 2268
584 Ga0495645_0000848 3300046543 Bacteria 20818
585 Ga0495645_0008343 3300046543 Bacteria 7232
586 Ga0495645_0393965 3300046543 Bacteria 884
587 Ga0495645_0775211 3300046543 Bacteria 577
588 Ga0495622_0043236 3300046557 Bacteria 2095
589 Ga0495667_0001254 3300046559 Bacteria 16638
590 Ga0495667_0022137 3300046559 Bacteria 4283
591 Ga0495667_0097610 3300046559 Bacteria 1902
592 Ga0495667_0104514 3300046559 Bacteria 1831
593 Ga0495667_0105159 3300046559 Bacteria 1825
594 Ga0495667_0113573 3300046559 Unclassified 1750
595 Ga0495634_0017607 3300046642 Bacteria 5096
596 Ga0495634_0019712 3300046642 Bacteria 4790
597 Ga0495634_0266260 3300046642 Bacteria 1044
598 Ga0495635_0005437 3300046663 Bacteria 8861
599 Ga0495635_0036531 3300046663 Bacteria 3405
600 Ga0495635_0090897 3300046663 Bacteria 2088
601 Ga0495635_0091274 3300046663 Bacteria 2083
602 Ga0495635_0146947 3300046663 Bacteria 1605
603 Ga0495635_0346365 3300046663 Bacteria 992
604 Ga0495635_0466719 3300046663 Bacteria 833
605 Ga0495661_0165033 3300046665 Bacteria 1186
606 Ga0495588_0067758 3300046674 Bacteria 1853
607 Ga0495657_0002939 3300046675 Bacteria 14124
608 Ga0495657_0032408 3300046675 Bacteria 3646
609 Ga0495599_0062103 3300046678 Bacteria 2334
610 Ga0495599_0214597 3300046678 Bacteria 1179
611 Ga0495623_0026867 3300046679 Bacteria 3703
612 Ga0495623_0035166 3300046679 Bacteria 3211
613 Ga0495646_0000856 3300046680 Bacteria 17244
614 Ga0495646_0083480 3300046680 Bacteria 1857
615 Ga0495646_0202842 3300046680 Bacteria 1079
616 Ga0495647_0053754 3300046681 Bacteria 1571
617 Ga0495658_0004553 3300046683 Bacteria 6816
618 Ga0495658_0810370 3300046683 Bacteria 599
619 Ga0495613_0038188 3300046689 Bacteria 3559
620 Ga0495613_0162962 3300046689 Bacteria 1585
621 Ga0495613_0394572 3300046689 Bacteria 945
622 Ga0495613_0430843 3300046689 Unclassified 896
623 Ga0495624_0040542 3300046690 Bacteria 2982
624 Ga0495624_0137836 3300046690 Bacteria 1495
625 Ga0495624_0387213 3300046690 Bacteria 840
626 Ga0495624_0956348 3300046690 Bacteria 503
627 Ga0495600_0016667 3300046809 Bacteria 4669
628 Ga0495600_0052308 3300046809 Bacteria 2667
629 Ga0495600_0128219 3300046809 Bacteria 1649
630 Ga0495600_0133793 3300046809 Bacteria 1611
631 Ga0495600_0579557 3300046809 Bacteria 683
632 Ga0495581_0036567 3300047315 Bacteria 2841
633 Ga0495581_0101672 3300047315 Bacteria 1670
634 Ga0495604_0005959 3300047317 Bacteria 9671
635 Ga0495604_0027617 3300047317 Bacteria 4512
636 Ga0495604_0056504 3300047317 Bacteria 3020
637 Ga0495604_0103429 3300047317 Bacteria 2089
638 Ga0495604_0591355 3300047317 Bacteria 712
639 Ga0495674_0005637 3300047319 Bacteria 11992
640 Ga0495674_0061401 3300047319 Bacteria 3275
641 Ga0495676_0034516 3300047321 Bacteria 4244
642 Ga0495676_0144308 3300047321 Bacteria 1702
643 Ga0495680_0001472 3300047322 Bacteria 25404
644 Ga0495680_0006777 3300047322 Bacteria 10581
645 Ga0495680_0017612 3300047322 Bacteria 6090
646 Ga0495680_0018210 3300047322 Bacteria 5971
647 Ga0495680_0022232 3300047322 Bacteria 5290
648 Ga0495680_0217882 3300047322 Bacteria 1364
649 Ga0495680_0241607 3300047322 Bacteria 1282
650 Ga0495675_0018016 3300047444 Bacteria 4477
651 Ga0495675_0048151 3300047444 Bacteria 2712
652 Ga0495675_0168024 3300047444 Bacteria 1348
653 Ga0495684_0031095 3300047471 Bacteria 4098
654 Ga0495684_0047729 3300047471 Bacteria 3275
655 Ga0495684_0213504 3300047471 Bacteria 1418
656 Ga0495684_0294075 3300047471 Bacteria 1168
657 Ga0495684_0298325 3300047471 Bacteria 1158
658 Ga0495684_0633406 3300047471 Bacteria 717
659 Ga0495593_0009204 3300047673 Bacteria 5726
660 Ga0495602_0002664 3300048088 Bacteria 18252
661 Ga0495602_0013607 3300048088 Bacteria 8305
662 Ga0495602_0128650 3300048088 Bacteria 2023
663 Ga0495602_0183138 3300048088 Bacteria 1613
664 Ga0495602_0515833 3300048088 Bacteria 833
665 Ga0495614_0145476 3300048089 Bacteria 1055
666 Ga0496100_0006554 3300048903 Bacteria 6356
667 Ga0496100_0102455 3300048903 Bacteria 1975
668 Ga0496100_0204967 3300048903 Bacteria 1439
669 Ga0496100_0399268 3300048903 Bacteria 1047
670 Ga0496101_0007659 3300048904 Bacteria 7011
671 Ga0496101_0016572 3300048904 Bacteria 4982
672 Ga0496101_0147253 3300048904 Bacteria 1799
673 Ga0496101_0347632 3300048904 Bacteria 1165
674 Ga0496101_0435107 3300048904 Bacteria 1034
675 Ga0496102_0016358 3300048905 Bacteria 6479
676 Ga0496102_0070115 3300048905 Bacteria 3218
677 Ga0496102_0261230 3300048905 Bacteria 1632
678 Ga0496102_0776671 3300048905 Bacteria 880
679 Ga0496102_0812061 3300048905 Bacteria 857
680 Ga0496102_1210976 3300048905 Bacteria 675
681 Ga0496103_0107057 3300048906 Bacteria 1773
682 Ga0496103_0280558 3300048906 Bacteria 1071
683 Ga0496103_0316878 3300048906 Bacteria 1003
684 Ga0496104_0000215 3300048907 Bacteria 50960
685 Ga0496104_0005956 3300048907 Bacteria 10678
686 Ga0496104_0097659 3300048907 Bacteria 2812
687 Ga0496104_0243034 3300048907 Bacteria 1712
688 Ga0496104_0374856 3300048907 Bacteria 1335
689 Ga0496104_0498536 3300048907 Bacteria 1129
690 Ga0496105_0007651 3300048908 Bacteria 8374
691 Ga0496105_0020355 3300048908 Bacteria 5361
692 Ga0496105_0157101 3300048908 Bacteria 1867
693 Ga0496105_0242092 3300048908 Bacteria 1464
694 Ga0496105_0429422 3300048908 Bacteria 1045
695 Ga0496105_0515938 3300048908 Bacteria 936
696 Ga0496106_0001857 3300048909 Bacteria 15809
697 Ga0496106_0019937 3300048909 Bacteria 4973
698 Ga0496106_0067503 3300048909 Bacteria 2726
699 Ga0496107_0019768 3300048910 Bacteria 4754
700 Ga0496107_0295593 3300048910 Bacteria 1205
701 Ga0496107_0520826 3300048910 Bacteria 881
702 Ga0496108_0056436 3300048911 Bacteria 3299
703 Ga0496108_0057496 3300048911 Bacteria 3268
704 Ga0496108_0241156 3300048911 Bacteria 1572
705 Ga0496108_0448952 3300048911 Bacteria 1126
706 Ga0496109_0133946 3300048912 Bacteria 2314
707 Ga0496109_0156658 3300048912 Bacteria 2133
708 Ga0496109_0389585 3300048912 Bacteria 1316
709 Ga0496109_0401126 3300048912 Bacteria 1295
710 Ga0496109_0961668 3300048912 Bacteria 792
711 Ga0496109_1184394 3300048912 Bacteria 701
712 Ga0496110_0022488 3300048913 Bacteria 5355
713 Ga0496110_0302206 3300048913 Bacteria 1457
714 Ga0496110_0356076 3300048913 Bacteria 1333
715 Ga0496110_0368896 3300048913 Bacteria 1308
716 Ga0496111_0084837 3300048914 Bacteria 2315
717 Ga0496111_0317797 3300048914 Bacteria 1153
718 Ga0496112_0193985 3300048915 Bacteria 1992
719 Ga0496112_0195658 3300048915 Bacteria 1982
720 Ga0496112_0570510 3300048915 Bacteria 1064
721 Ga0496112_0830786 3300048915 Bacteria 848
722 Ga0496112_1243055 3300048915 Bacteria 661
723 Ga0496113_0251371 3300048916 Bacteria 1411
724 Ga0496113_0427014 3300048916 Bacteria 1064
725 Ga0496113_0436095 3300048916 Bacteria 1052
726 Ga0496113_1451526 3300048916 Bacteria 530
727 Ga0496114_0076223 3300048917 Bacteria 2825
728 Ga0496114_0376999 3300048917 Bacteria 1256
729 Ga0496114_1041826 3300048917 Bacteria 702
730 Ga0496115_0013246 3300048918 Bacteria 6231
731 Ga0496115_0073757 3300048918 Bacteria 2770
732 Ga0496115_0099732 3300048918 Bacteria 2380
733 Ga0496115_0582525 3300048918 Bacteria 891
734 Ga0496115_0713092 3300048918 Bacteria 787
735 Ga0496115_0759486 3300048918 Bacteria 757
736 Ga0496115_1243551 3300048918 Bacteria 557
737 Ga0496117_0010071 3300048920 Bacteria 8683
738 Ga0496118_0008611 3300048921 Bacteria 10500
739 Ga0496119_0145579 3300048922 Bacteria 1275
740 Ga0496121_0002635 3300048924 Bacteria 27038
741 Ga0496121_0166584 3300048924 Bacteria 1605
742 Ga0496121_0450721 3300048924 Bacteria 829
743 Ga0496122_0052608 3300048925 Bacteria 3080
744 Ga0496124_0011581 3300048927 Bacteria 8801
745 Ga0496124_0378319 3300048927 Bacteria 991
746 Ga0496125_0000746 3300048928 Bacteria 53671
747 Ga0496125_0131030 3300048928 Bacteria 1765
748 Ga0496126_0002122 3300048929 Bacteria 27701
749 Ga0496126_0038000 3300048929 Bacteria 4482
750 Ga0496126_0108022 3300048929 Bacteria 2426
751 Ga0496126_0157082 3300048929 Bacteria 1946
752 Ga0496126_0208556 3300048929 Bacteria 1646
753 Ga0496126_0430274 3300048929 Bacteria 1065
754 Ga0496126_0661143 3300048929 Bacteria 816
755 Ga0501031_0255750 3300049568 Bacteria 1138
756 Ga0501034_0182998 3300049571 Bacteria 2060
757 Ga0501036_0114702 3300049572 Bacteria 2277
758 Ga0501039_1344434 3300049575 Bacteria 551
759 Ga0501042_0286813 3300049578 Bacteria 1189
760 Ga0501043_0448869 3300049579 Bacteria 969
761 Ga0501043_1083288 3300049579 Bacteria 567
762 Ga0501047_0008787 3300049581 Bacteria 9533
763 Ga0501047_0611642 3300049581 Bacteria 911
764 Ga0501067_0711546 3300049583 Bacteria 565
765 Ga0501068_0691835 3300049584 Bacteria 667
766 Ga0501070_0367305 3300049586 Bacteria 1167
767 Ga0501073_0034839 3300049589 Bacteria 3581
768 Ga0501075_0734248 3300049591 Bacteria 752
769 Ga0501076_0220426 3300049592 Bacteria 1550
770 Ga0501079_0565858 3300049741 Bacteria 894
771 Ga0501080_1170424 3300049742 Bacteria 662
772 Ga0501081_0672417 3300049743 Bacteria 777
773 Ga0501083_0023331 3300049744 Bacteria 4292
774 Ga0501035_0657975 3300049822 Bacteria 849
775 Ga0501044_0103888 3300049823 Bacteria 2856
776 Ga0501044_0118153 3300049823 Bacteria 2655
777 nmdc:mga03n38_684651_c1 3300050490 Bacteria 590
778 nmdc:mga00v17_900844_c1 3300050491 Bacteria 560
779 nmdc:mga0yw44_16709_c1 3300050492 Bacteria 3973
780 nmdc:mga0yw44_945281_c1 3300050492 Bacteria 584
781 nmdc:mga0n895_141846_c1 3300050512 Bacteria 2431
782 nmdc:mga0n895_161587_c1 3300050512 Bacteria 695
783 nmdc:mga0rr50_134685_c1 3300050513 Bacteria 1982
784 nmdc:mga08x19_27777_c1 3300050514 Bacteria 3541
785 nmdc:mga08x19_580259_c1 3300050514 Bacteria 794
786 nmdc:mga0sz30_281867_c1 3300050516 Bacteria 740
787 Ga0495601_0000109 3300053077 Bacteria 45069
788 Ga0495601_0002506 3300053077 Bacteria 10450
789 Ga0495601_0006125 3300053077 Bacteria 7019
790 Ga0495601_0009758 3300053077 Bacteria 5677
791 Ga0495601_0053399 3300053077 Bacteria 2554
792 Ga0495601_0059733 3300053077 Bacteria 2418
793 Ga0495612_0000953 3300053078 Bacteria 11879
794 Ga0495612_0002655 3300053078 Bacteria 7376
795 Ga0495612_0006674 3300053078 Bacteria 4733
796 Ga0500635_0015242 3300053080 Bacteria 2267
797 Ga0495595_0001271 3300053084 Bacteria 9824
798 Ga0495595_0005318 3300053084 Bacteria 5205
799 Ga0495595_0005872 3300053084 Bacteria 4976
800 Ga0495595_0019136 3300053084 Bacteria 2968
801 Ga0495595_0033835 3300053084 Bacteria 2308
802 Ga0495619_0000289 3300053085 Bacteria 35778
803 Ga0495619_0000662 3300053085 Bacteria 22563
804 Ga0495619_0002507 3300053085 Bacteria 12025
805 Ga0495619_0004938 3300053085 Bacteria 8470
806 Ga0495619_0015439 3300053085 Bacteria 4832
807 Ga0495619_0376229 3300053085 Bacteria 981
808 Ga0495619_1025951 3300053085 Bacteria 551
809 Ga0500643_002483 3300053087 Bacteria 9484
810 Ga0500644_0000860 3300053088 Bacteria 9944
811 Ga0500646_0025028 3300053090 Bacteria 1610
812 Ga0500651_0156758 3300053093 Bacteria 1364
813 Ga0500651_0721863 3300053093 Bacteria 531
814 Ga0500566_0072243 3300053094 Bacteria 1935
815 Ga0500566_0436952 3300053094 Bacteria 576
816 Ga0500648_097400 3300053097 Bacteria 1640
817 Ga0500650_0451371 3300053098 Bacteria 551
818 Ga0500595_000062 3300053119 Bacteria 77506
819 Ga0500595_016246 3300053119 Bacteria 2776
820 Ga0500595_055576 3300053119 Bacteria 1212
821 Ga0500652_033278 3300053131 Bacteria 2036
822 Ga0500655_084049 3300053133 Bacteria 657
823 Ga0500559_0094578 3300053136 Bacteria 1371
824 Ga0500559_0262266 3300053136 Bacteria 813
825 Ga0500564_234759 3300053138 Bacteria 735
826 Ga0500573_0104422 3300053140 Bacteria 1591
827 Ga0500590_091329 3300053148 Bacteria 1478
828 Ga0500590_108729 3300053148 Bacteria 1319
829 Ga0500603_014973 3300053150 Bacteria 1819
830 Ga0500616_0000006 3300053153 Bacteria 944738
831 Ga0500638_168116 3300053162 Bacteria 958
832 Ga0500639_028570 3300053163 Bacteria 2947
833 Ga0500639_157943 3300053163 Bacteria 1036
834 Ga0500636_0175949 3300053177 Bacteria 1153
835 Ga0500637_0056548 3300053178 Bacteria 2241
836 Ga0500637_0082391 3300053178 Bacteria 1859
837 Ga0500645_000101 3300053730 Bacteria 68128
838 Ga0500596_005660 3300053735 Bacteria 2174
839 Ga0501082_0067452 3300060353 Bacteria 3081
840 Ga0530510_0471912 3300061734 Bacteria 950

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_10007559 Ga0207644_100075595 100
2 3300026041 Ga0207639_10909645 Ga0207639_109096452 101
3 iso_pu_bacteria 2513237102 2513700651 101
4 iso_pu_bacteria 2824617872 2824622032 101
5 iso_pu_bacteria 2824626560 2824629296 101
6 iso_pu_bacteria 2824635225 2824639171 101
7 iso_pu_bacteria 2824644064 2824652638 101
8 iso_pu_bacteria 2824714736 2824723190 101
9 iso_pu_bacteria 2824723954 2824731758 101
10 iso_pu_bacteria 2904690495 2904698944 102
11 iso_pu_bacteria 2908756301 2908758741 102
12 iso_pu_bacteria 643348564 643605219 102
13 3300005618 Ga0068864_100316532 Ga0068864_1003165323 104
14 3300005841 Ga0068863_100615180 Ga0068863_1006151802 104
15 3300005843 Ga0068860_100000360 Ga0068860_10000036044 104
16 3300006237 Ga0097621_100359483 Ga0097621_1003594832 104
17 3300006237 Ga0097621_101183291 Ga0097621_1011832912 104
18 3300009101 Ga0105247_10079094 Ga0105247_100790944 104
19 3300009101 Ga0105247_11027366 Ga0105247_110273661 104
20 3300010375 Ga0105239_11040318 Ga0105239_110403182 104
21 3300010375 Ga0105239_11652668 Ga0105239_116526682 104
22 3300010375 Ga0105239_12356119 Ga0105239_123561192 104
23 3300025900 Ga0207710_10162358 Ga0207710_101623583 104
24 3300025900 Ga0207710_10401078 Ga0207710_104010781 104
25 3300025931 Ga0207644_11390102 Ga0207644_113901022 104
26 3300026035 Ga0207703_12020444 Ga0207703_120204441 104
27 3300026088 Ga0207641_10750393 Ga0207641_107503932 104
28 3300028381 Ga0268264_10000030 Ga0268264_10000030239 104
29 3300030521 Ga0307511_10107189 Ga0307511_101071892 104
30 3300031507 Ga0307509_10014245 Ga0307509_100142453 104
31 3300031616 Ga0307508_10173191 Ga0307508_101731912 104
32 3300031730 Ga0307516_10005995 Ga0307516_100059959 104
33 3300033180 Ga0307510_10283860 Ga0307510_102838602 104
34 3300035692 Ga0373935_0004548 Ga0373935_0004548_3721_4041 104
35 3300035692 Ga0373935_0677034 Ga0373935_0677034_277_594 104
36 3300035695 Ga0373927_0184081 Ga0373927_0184081_198_515 104
37 3300035725 Ga0373947_0473216 Ga0373947_0473216_303_620 104
38 3300037068 Ga0373925_0742294 Ga0373925_0742294_319_636 104
39 3300046477 Ga0495664_0238448 Ga0495664_0238448_420_737 104
40 3300046514 Ga0495618_0597161 Ga0495618_0597161_20_337 104
41 3300046690 Ga0495624_0956348 Ga0495624_0956348_150_467 104
42 3300048904 Ga0496101_0147253 Ga0496101_0147253_823_1140 104
43 3300048909 Ga0496106_0001857 Ga0496106_0001857_5030_5347 104
44 3300048920 Ga0496117_0010071 Ga0496117_0010071_160_477 104
45 3300048921 Ga0496118_0008611 Ga0496118_0008611_3089_3406 104
46 3300048924 Ga0496121_0002635 Ga0496121_0002635_18091_18408 104
47 3300048924 Ga0496121_0166584 Ga0496121_0166584_464_781 104
48 3300048927 Ga0496124_0011581 Ga0496124_0011581_4531_4848 104
49 3300048928 Ga0496125_0131030 Ga0496125_0131030_1365_1682 104
50 3300048929 Ga0496126_0002122 Ga0496126_0002122_25392_25709 104
51 3300048929 Ga0496126_0430274 Ga0496126_0430274_485_802 104
52 3300050490 nmdc:mga03n38_684651_c1 nmdc:mga03n38_684651_c1_31_348 104
53 3300053093 Ga0500651_0156758 Ga0500651_0156758_625_942 104
54 3300053094 Ga0500566_0436952 Ga0500566_0436952_220_537 104
55 3300053097 Ga0500648_097400 Ga0500648_097400_1047_1364 104
56 3300053119 Ga0500595_055576 Ga0500595_055576_164_481 104
57 3300053136 Ga0500559_0094578 Ga0500559_0094578_460_777 104
58 3300053140 Ga0500573_0104422 Ga0500573_0104422_1127_1444 104
59 3300053148 Ga0500590_091329 Ga0500590_091329_366_683 104
60 3300053148 Ga0500590_108729 Ga0500590_108729_529_846 104
61 3300053150 Ga0500603_014973 Ga0500603_014973_927_1244 104
62 3300053162 Ga0500638_168116 Ga0500638_168116_366_683 104
63 3300053163 Ga0500639_157943 Ga0500639_157943_410_727 104
64 3300053177 Ga0500636_0175949 Ga0500636_0175949_489_806 104
65 3300053178 Ga0500637_0056548 Ga0500637_0056548_576_893 104
66 3300053735 Ga0500596_005660 Ga0500596_005660_687_1004 104
67 2010549000 RicEn_C6443 RicEn_113920 105
68 3300000041 ARcpr5oldR_c011814 ARcpr5oldR_0118142 105
69 3300002070 JGI24750J21931_1020184 JGI24750J21931_10201842 105
70 3300003203 JGI25406J46586_10000138 JGI25406J46586_100001385 105
71 3300003659 JGI25404J52841_10000288 JGI25404J52841_100002882 105
72 3300003659 JGI25404J52841_10016633 JGI25404J52841_100166333 105
73 3300005262 Ga0065165_1089247 Ga0065165_10892472 105
74 3300005290 Ga0065712_10806853 Ga0065712_108068531 105
75 3300005327 Ga0070658_10152408 Ga0070658_101524082 105
76 3300005327 Ga0070658_10281288 Ga0070658_102812883 105
77 3300005327 Ga0070658_11661314 Ga0070658_116613141 105
78 3300005328 Ga0070676_10066362 Ga0070676_100663622 105
79 3300005328 Ga0070676_10206242 Ga0070676_102062422 105
80 3300005329 Ga0070683_100566384 Ga0070683_1005663842 105
81 3300005330 Ga0070690_100035779 Ga0070690_1000357791 105
82 3300005331 Ga0070670_100085242 Ga0070670_1000852423 105
83 3300005334 Ga0068869_100944991 Ga0068869_1009449911 105
84 3300005335 Ga0070666_10044947 Ga0070666_100449473 105
85 3300005335 Ga0070666_10170100 Ga0070666_101701002 105
86 3300005336 Ga0070680_100073406 Ga0070680_1000734063 105
87 3300005337 Ga0070682_100022461 Ga0070682_1000224613 105
88 3300005337 Ga0070682_100691382 Ga0070682_1006913822 105
89 3300005338 Ga0068868_100023195 Ga0068868_1000231953 105
90 3300005338 Ga0068868_100302903 Ga0068868_1003029032 105
91 3300005339 Ga0070660_101517973 Ga0070660_1015179731 105
92 3300005340 Ga0070689_100271674 Ga0070689_1002716741 105
93 3300005341 Ga0070691_10092647 Ga0070691_100926472 105
94 3300005343 Ga0070687_100655484 Ga0070687_1006554842 105
95 3300005343 Ga0070687_101266715 Ga0070687_1012667151 105
96 3300005344 Ga0070661_100063833 Ga0070661_1000638332 105
97 3300005344 Ga0070661_100128827 Ga0070661_1001288272 105
98 3300005347 Ga0070668_100111063 Ga0070668_1001110633 105
99 3300005353 Ga0070669_100463638 Ga0070669_1004636382 105
100 3300005353 Ga0070669_101941653 Ga0070669_1019416531 105
101 3300005354 Ga0070675_101292694 Ga0070675_1012926942 105
102 3300005355 Ga0070671_100075228 Ga0070671_1000752282 105
103 3300005355 Ga0070671_100126562 Ga0070671_1001265621 105
104 3300005356 Ga0070674_100118540 Ga0070674_1001185402 105
105 3300005356 Ga0070674_100385100 Ga0070674_1003851002 105
106 3300005364 Ga0070673_100031259 Ga0070673_1000312594 105
107 3300005364 Ga0070673_100221129 Ga0070673_1002211293 105
108 3300005364 Ga0070673_101180251 Ga0070673_1011802512 105
109 3300005365 Ga0070688_100016483 Ga0070688_1000164833 105
110 3300005367 Ga0070667_100096956 Ga0070667_1000969562 105
111 3300005367 Ga0070667_100277815 Ga0070667_1002778153 105
112 3300005434 Ga0070709_10000855 Ga0070709_1000085516 105
113 3300005434 Ga0070709_10004300 Ga0070709_100043008 105
114 3300005434 Ga0070709_10022160 Ga0070709_100221604 105
115 3300005434 Ga0070709_10023003 Ga0070709_100230033 105
116 3300005434 Ga0070709_10229367 Ga0070709_102293672 105
117 3300005435 Ga0070714_100431103 Ga0070714_1004311031 105
118 3300005435 Ga0070714_100474559 Ga0070714_1004745593 105
119 3300005436 Ga0070713_100002359 Ga0070713_10000235914 105
120 3300005436 Ga0070713_100004066 Ga0070713_1000040664 105
121 3300005436 Ga0070713_100031837 Ga0070713_1000318373 105
122 3300005436 Ga0070713_100149309 Ga0070713_1001493091 105
123 3300005436 Ga0070713_100306657 Ga0070713_1003066572 105
124 3300005436 Ga0070713_101195986 Ga0070713_1011959862 105
125 3300005437 Ga0070710_10003385 Ga0070710_100033852 105
126 3300005437 Ga0070710_10029684 Ga0070710_100296843 105
127 3300005437 Ga0070710_10077078 Ga0070710_100770784 105
128 3300005437 Ga0070710_10096625 Ga0070710_100966254 105
129 3300005437 Ga0070710_10756435 Ga0070710_107564351 105
130 3300005439 Ga0070711_100017702 Ga0070711_1000177027 105
131 3300005439 Ga0070711_100017962 Ga0070711_1000179622 105
132 3300005439 Ga0070711_100088060 Ga0070711_1000880602 105
133 3300005439 Ga0070711_100128053 Ga0070711_1001280532 105
134 3300005439 Ga0070711_100209488 Ga0070711_1002094883 105
135 3300005439 Ga0070711_100506323 Ga0070711_1005063232 105
136 3300005439 Ga0070711_100838504 Ga0070711_1008385042 105
137 3300005440 Ga0070705_100221343 Ga0070705_1002213432 105
138 3300005441 Ga0070700_100532159 Ga0070700_1005321591 105
139 3300005441 Ga0070700_101052240 Ga0070700_1010522402 105
140 3300005444 Ga0070694_100356334 Ga0070694_1003563342 105
141 3300005445 Ga0070708_100206734 Ga0070708_1002067342 105
142 3300005445 Ga0070708_101359363 Ga0070708_1013593631 105
143 3300005455 Ga0070663_100343464 Ga0070663_1003434642 105
144 3300005455 Ga0070663_100412822 Ga0070663_1004128221 105
145 3300005456 Ga0070678_100306263 Ga0070678_1003062631 105
146 3300005457 Ga0070662_100448422 Ga0070662_1004484222 105
147 3300005458 Ga0070681_10013271 Ga0070681_100132717 105
148 3300005459 Ga0068867_100235985 Ga0068867_1002359852 105
149 3300005459 Ga0068867_100804167 Ga0068867_1008041672 105
150 3300005466 Ga0070685_10153929 Ga0070685_101539292 105
151 3300005466 Ga0070685_10281094 Ga0070685_102810942 105
152 3300005530 Ga0070679_100085231 Ga0070679_1000852312 105
153 3300005530 Ga0070679_100122492 Ga0070679_1001224923 105
154 3300005535 Ga0070684_100525862 Ga0070684_1005258622 105
155 3300005535 Ga0070684_101177447 Ga0070684_1011774471 105
156 3300005539 Ga0068853_100068998 Ga0068853_1000689983 105
157 3300005539 Ga0068853_100732708 Ga0068853_1007327082 105
158 3300005539 Ga0068853_100960902 Ga0068853_1009609021 105
159 3300005544 Ga0070686_100055931 Ga0070686_1000559313 105
160 3300005545 Ga0070695_100065695 Ga0070695_1000656952 105
161 3300005545 Ga0070695_100285865 Ga0070695_1002858652 105
162 3300005546 Ga0070696_100142454 Ga0070696_1001424543 105
163 3300005546 Ga0070696_100609966 Ga0070696_1006099662 105
164 3300005547 Ga0070693_100058059 Ga0070693_1000580591 105
165 3300005547 Ga0070693_100248190 Ga0070693_1002481902 105
166 3300005547 Ga0070693_100523254 Ga0070693_1005232542 105
167 3300005547 Ga0070693_100570628 Ga0070693_1005706282 105
168 3300005548 Ga0070665_100053413 Ga0070665_1000534133 105
169 3300005548 Ga0070665_100069877 Ga0070665_1000698773 105
170 3300005548 Ga0070665_100806559 Ga0070665_1008065592 105
171 3300005549 Ga0070704_101839071 Ga0070704_1018390712 105
172 3300005563 Ga0068855_100187602 Ga0068855_1001876022 105
173 3300005563 Ga0068855_100677922 Ga0068855_1006779222 105
174 3300005564 Ga0070664_100038514 Ga0070664_1000385143 105
175 3300005564 Ga0070664_100523617 Ga0070664_1005236172 105
176 3300005577 Ga0068857_100291795 Ga0068857_1002917952 105
177 3300005614 Ga0068856_100084891 Ga0068856_1000848911 105
178 3300005614 Ga0068856_101698263 Ga0068856_1016982632 105
179 3300005615 Ga0070702_100019143 Ga0070702_1000191432 105
180 3300005615 Ga0070702_100469588 Ga0070702_1004695882 105
181 3300005616 Ga0068852_100348236 Ga0068852_1003482362 105
182 3300005617 Ga0068859_100071001 Ga0068859_1000710013 105
183 3300005618 Ga0068864_100088136 Ga0068864_1000881363 105
184 3300005718 Ga0068866_11269959 Ga0068866_112699591 105
185 3300005719 Ga0068861_100600781 Ga0068861_1006007811 105
186 3300005719 Ga0068861_101854549 Ga0068861_1018545491 105
187 3300005834 Ga0068851_10366750 Ga0068851_103667502 105
188 3300005841 Ga0068863_100067439 Ga0068863_1000674393 105
189 3300005842 Ga0068858_100059299 Ga0068858_1000592993 105
190 3300005843 Ga0068860_100094153 Ga0068860_1000941532 105
191 3300005843 Ga0068860_102313443 Ga0068860_1023134432 105
192 3300005844 Ga0068862_100500977 Ga0068862_1005009772 105
193 3300005937 Ga0081455_10551309 Ga0081455_105513092 105
194 3300005983 Ga0081540_1027303 Ga0081540_10273033 105
195 3300005983 Ga0081540_1029140 Ga0081540_10291403 105
196 3300006028 Ga0070717_10003328 Ga0070717_1000332811 105
197 3300006028 Ga0070717_10007544 Ga0070717_100075443 105
198 3300006028 Ga0070717_10221253 Ga0070717_102212533 105
199 3300006028 Ga0070717_10391088 Ga0070717_103910882 105
200 3300006028 Ga0070717_10780830 Ga0070717_107808302 105
201 3300006028 Ga0070717_10904072 Ga0070717_109040721 105
202 3300006038 Ga0075365_10339531 Ga0075365_103395312 105
203 3300006051 Ga0075364_10105653 Ga0075364_101056533 105
204 3300006163 Ga0070715_10093139 Ga0070715_100931393 105
205 3300006163 Ga0070715_10179947 Ga0070715_101799472 105
206 3300006163 Ga0070715_10277313 Ga0070715_102773132 105
207 3300006163 Ga0070715_10595935 Ga0070715_105959351 105
208 3300006173 Ga0070716_100002233 Ga0070716_1000022335 105
209 3300006173 Ga0070716_100031117 Ga0070716_1000311173 105
210 3300006175 Ga0070712_100010775 Ga0070712_1000107751 105
211 3300006175 Ga0070712_100051207 Ga0070712_1000512072 105
212 3300006175 Ga0070712_100156648 Ga0070712_1001566483 105
213 3300006175 Ga0070712_100441075 Ga0070712_1004410752 105
214 3300006175 Ga0070712_100771012 Ga0070712_1007710122 105
215 3300006237 Ga0097621_100008876 Ga0097621_1000088764 105
216 3300006237 Ga0097621_100026444 Ga0097621_1000264443 105
217 3300006358 Ga0068871_100015537 Ga0068871_1000155374 105
218 3300006358 Ga0068871_100241467 Ga0068871_1002414673 105
219 3300006852 Ga0075433_10423626 Ga0075433_104236261 105
220 3300006871 Ga0075434_100512931 Ga0075434_1005129312 105
221 3300006871 Ga0075434_100581087 Ga0075434_1005810872 105
222 3300006881 Ga0068865_100009015 Ga0068865_1000090154 105
223 3300006881 Ga0068865_100415311 Ga0068865_1004153112 105
224 3300006914 Ga0075436_100031219 Ga0075436_1000312193 105
225 3300006914 Ga0075436_100414882 Ga0075436_1004148822 105
226 3300006931 Ga0097620_100071001 Ga0097620_1000710013 105
227 3300007076 Ga0075435_100492508 Ga0075435_1004925083 105
228 3300007265 Ga0099794_10252337 Ga0099794_102523372 105
229 3300009011 Ga0105251_10012262 Ga0105251_100122623 105
230 3300009098 Ga0105245_10038270 Ga0105245_100382703 105
231 3300009098 Ga0105245_10287853 Ga0105245_102878532 105
232 3300009098 Ga0105245_11861990 Ga0105245_118619902 105
233 3300009101 Ga0105247_10086615 Ga0105247_100866152 105
234 3300009101 Ga0105247_10295137 Ga0105247_102951372 105
235 3300009101 Ga0105247_10390936 Ga0105247_103909362 105
236 3300009148 Ga0105243_10080808 Ga0105243_100808084 105
237 3300009148 Ga0105243_10374450 Ga0105243_103744502 105
238 3300009174 Ga0105241_10037102 Ga0105241_100371023 105
239 3300009174 Ga0105241_10141127 Ga0105241_101411272 105
240 3300009174 Ga0105241_10358358 Ga0105241_103583581 105
241 3300009176 Ga0105242_10006274 Ga0105242_100062747 105
242 3300009176 Ga0105242_10059085 Ga0105242_100590853 105
243 3300009176 Ga0105242_10408608 Ga0105242_104086082 105
244 3300009177 Ga0105248_10065160 Ga0105248_100651602 105
245 3300009177 Ga0105248_10207704 Ga0105248_102077042 105
246 3300009177 Ga0105248_11436975 Ga0105248_114369752 105
247 3300009545 Ga0105237_10021234 Ga0105237_100212346 105
248 3300009545 Ga0105237_10714057 Ga0105237_107140572 105
249 3300009545 Ga0105237_10996490 Ga0105237_109964902 105
250 3300009551 Ga0105238_10027647 Ga0105238_100276474 105
251 3300009551 Ga0105238_10373216 Ga0105238_103732161 105
252 3300009551 Ga0105238_11148679 Ga0105238_111486792 105
253 3300009551 Ga0105238_12070457 Ga0105238_120704572 105
254 3300009551 Ga0105238_12678210 Ga0105238_126782101 105
255 3300009553 Ga0105249_11247695 Ga0105249_112476952 105
256 3300009553 Ga0105249_11523571 Ga0105249_115235711 105
257 3300009553 Ga0105249_12134949 Ga0105249_121349491 105
258 3300010375 Ga0105239_10074149 Ga0105239_100741494 105
259 3300010375 Ga0105239_10267093 Ga0105239_102670932 105
260 3300010375 Ga0105239_10304214 Ga0105239_103042142 105
261 3300010375 Ga0105239_10599290 Ga0105239_105992903 105
262 3300011119 Ga0105246_10053735 Ga0105246_100537353 105
263 3300011119 Ga0105246_10296493 Ga0105246_102964932 105
264 3300012477 Ga0157336_1011918 Ga0157336_10119182 105
265 3300012492 Ga0157335_1000825 Ga0157335_10008253 105
266 3300012498 Ga0157345_1019228 Ga0157345_10192282 105
267 3300012500 Ga0157314_1052637 Ga0157314_10526371 105
268 3300012503 Ga0157313_1026749 Ga0157313_10267491 105
269 3300012506 Ga0157324_1030507 Ga0157324_10305072 105
270 3300012510 Ga0157316_1027201 Ga0157316_10272011 105
271 3300012515 Ga0157338_1017731 Ga0157338_10177312 105
272 3300013104 Ga0157370_11778711 Ga0157370_117787111 105
273 3300013296 Ga0157374_10179291 Ga0157374_101792913 105
274 3300013296 Ga0157374_10208823 Ga0157374_102088233 105
275 3300013297 Ga0157378_10094941 Ga0157378_100949413 105
276 3300013297 Ga0157378_10934671 Ga0157378_109346712 105
277 3300013297 Ga0157378_11010931 Ga0157378_110109311 105
278 3300013297 Ga0157378_12095805 Ga0157378_120958052 105
279 3300013306 Ga0163162_10108966 Ga0163162_101089662 105
280 3300013306 Ga0163162_10246430 Ga0163162_102464302 105
281 3300013306 Ga0163162_11121669 Ga0163162_111216692 105
282 3300013307 Ga0157372_10134988 Ga0157372_101349883 105
283 3300013307 Ga0157372_12182728 Ga0157372_121827282 105
284 3300013308 Ga0157375_10135433 Ga0157375_101354333 105
285 3300013308 Ga0157375_10329773 Ga0157375_103297733 105
286 3300013308 Ga0157375_10852394 Ga0157375_108523942 105
287 3300014325 Ga0163163_10335512 Ga0163163_103355122 105
288 3300014325 Ga0163163_10753207 Ga0163163_107532072 105
289 3300014326 Ga0157380_11841068 Ga0157380_118410681 105
290 3300014968 Ga0157379_10007831 Ga0157379_1000783110 105
291 3300014968 Ga0157379_10166035 Ga0157379_101660353 105
292 3300014968 Ga0157379_10829249 Ga0157379_108292491 105
293 3300014969 Ga0157376_10448835 Ga0157376_104488352 105
294 3300014969 Ga0157376_10873512 Ga0157376_108735121 105
295 3300014969 Ga0157376_10973157 Ga0157376_109731572 105
296 3300017792 Ga0163161_10026256 Ga0163161_100262564 105
297 3300017792 Ga0163161_10068276 Ga0163161_100682762 105
298 3300021384 Ga0213876_10179521 Ga0213876_101795212 105
299 3300021388 Ga0213875_10477209 Ga0213875_104772092 105
300 3300025315 Ga0207697_10228483 Ga0207697_102284832 105
301 3300025898 Ga0207692_10005372 Ga0207692_100053723 105
302 3300025898 Ga0207692_10069774 Ga0207692_100697742 105
303 3300025898 Ga0207692_10340830 Ga0207692_103408302 105
304 3300025898 Ga0207692_10361122 Ga0207692_103611222 105
305 3300025898 Ga0207692_10564439 Ga0207692_105644392 105
306 3300025899 Ga0207642_10301087 Ga0207642_103010872 105
307 3300025900 Ga0207710_10046975 Ga0207710_100469752 105
308 3300025900 Ga0207710_10050402 Ga0207710_100504022 105
309 3300025900 Ga0207710_10072035 Ga0207710_100720352 105
310 3300025900 Ga0207710_10359226 Ga0207710_103592262 105
311 3300025901 Ga0207688_10391025 Ga0207688_103910252 105
312 3300025903 Ga0207680_10029075 Ga0207680_100290754 105
313 3300025905 Ga0207685_10004129 Ga0207685_100041293 105
314 3300025905 Ga0207685_10029551 Ga0207685_100295512 105
315 3300025905 Ga0207685_10090429 Ga0207685_100904292 105
316 3300025905 Ga0207685_10174449 Ga0207685_101744492 105
317 3300025905 Ga0207685_10179973 Ga0207685_101799732 105
318 3300025906 Ga0207699_10001161 Ga0207699_100011617 105
319 3300025906 Ga0207699_10012349 Ga0207699_100123496 105
320 3300025906 Ga0207699_10014207 Ga0207699_100142072 105
321 3300025906 Ga0207699_10140066 Ga0207699_101400662 105
322 3300025906 Ga0207699_10328840 Ga0207699_103288402 105
323 3300025906 Ga0207699_10405139 Ga0207699_104051391 105
324 3300025907 Ga0207645_10023325 Ga0207645_100233255 105
325 3300025907 Ga0207645_10528976 Ga0207645_105289761 105
326 3300025909 Ga0207705_11434259 Ga0207705_114342591 105
327 3300025911 Ga0207654_10043742 Ga0207654_100437423 105
328 3300025911 Ga0207654_10066063 Ga0207654_100660632 105
329 3300025911 Ga0207654_10235678 Ga0207654_102356783 105
330 3300025912 Ga0207707_10026208 Ga0207707_100262083 105
331 3300025912 Ga0207707_10340876 Ga0207707_103408762 105
332 3300025914 Ga0207671_10245556 Ga0207671_102455562 105
333 3300025914 Ga0207671_10642360 Ga0207671_106423602 105
334 3300025915 Ga0207693_10003131 Ga0207693_1000313113 105
335 3300025915 Ga0207693_10043770 Ga0207693_100437705 105
336 3300025915 Ga0207693_10058351 Ga0207693_100583511 105
337 3300025915 Ga0207693_10181380 Ga0207693_101813802 105
338 3300025915 Ga0207693_10225292 Ga0207693_102252922 105
339 3300025916 Ga0207663_10015462 Ga0207663_100154623 105
340 3300025916 Ga0207663_10061185 Ga0207663_100611852 105
341 3300025916 Ga0207663_10071436 Ga0207663_100714363 105
342 3300025916 Ga0207663_10188456 Ga0207663_101884561 105
343 3300025916 Ga0207663_10380554 Ga0207663_103805542 105
344 3300025917 Ga0207660_10788538 Ga0207660_107885381 105
345 3300025919 Ga0207657_10162543 Ga0207657_101625432 105
346 3300025920 Ga0207649_10148323 Ga0207649_101483232 105
347 3300025921 Ga0207652_10098796 Ga0207652_100987962 105
348 3300025921 Ga0207652_10246038 Ga0207652_102460383 105
349 3300025921 Ga0207652_10599659 Ga0207652_105996591 105
350 3300025923 Ga0207681_10554856 Ga0207681_105548562 105
351 3300025924 Ga0207694_10040173 Ga0207694_100401734 105
352 3300025924 Ga0207694_10150540 Ga0207694_101505402 105
353 3300025924 Ga0207694_10633556 Ga0207694_106335562 105
354 3300025925 Ga0207650_10259172 Ga0207650_102591723 105
355 3300025926 Ga0207659_11661661 Ga0207659_116616612 105
356 3300025927 Ga0207687_10012582 Ga0207687_100125824 105
357 3300025927 Ga0207687_10033806 Ga0207687_100338065 105
358 3300025927 Ga0207687_10757178 Ga0207687_107571783 105
359 3300025928 Ga0207700_10000917 Ga0207700_1000091717 105
360 3300025928 Ga0207700_10021942 Ga0207700_100219423 105
361 3300025928 Ga0207700_10053149 Ga0207700_100531493 105
362 3300025928 Ga0207700_10102651 Ga0207700_101026514 105
363 3300025928 Ga0207700_10993708 Ga0207700_109937082 105
364 3300025928 Ga0207700_11438312 Ga0207700_114383122 105
365 3300025929 Ga0207664_10100523 Ga0207664_101005231 105
366 3300025929 Ga0207664_10261339 Ga0207664_102613391 105
367 3300025929 Ga0207664_10395828 Ga0207664_103958282 105
368 3300025929 Ga0207664_10418862 Ga0207664_104188622 105
369 3300025929 Ga0207664_11175493 Ga0207664_111754932 105
370 3300025929 Ga0207664_11915049 Ga0207664_119150491 105
371 3300025931 Ga0207644_10115945 Ga0207644_101159452 105
372 3300025933 Ga0207706_10014945 Ga0207706_100149456 105
373 3300025933 Ga0207706_10189748 Ga0207706_101897482 105
374 3300025934 Ga0207686_10011564 Ga0207686_100115644 105
375 3300025934 Ga0207686_10507143 Ga0207686_105071432 105
376 3300025934 Ga0207686_10847197 Ga0207686_108471972 105
377 3300025935 Ga0207709_10125631 Ga0207709_101256313 105
378 3300025935 Ga0207709_10459689 Ga0207709_104596892 105
379 3300025935 Ga0207709_10818320 Ga0207709_108183202 105
380 3300025936 Ga0207670_10017561 Ga0207670_100175614 105
381 3300025937 Ga0207669_10767290 Ga0207669_107672902 105
382 3300025937 Ga0207669_11343895 Ga0207669_113438952 105
383 3300025938 Ga0207704_11180102 Ga0207704_111801021 105
384 3300025938 Ga0207704_11339485 Ga0207704_113394852 105
385 3300025939 Ga0207665_10000333 Ga0207665_1000033311 105
386 3300025939 Ga0207665_10021917 Ga0207665_100219173 105
387 3300025939 Ga0207665_10111445 Ga0207665_101114451 105
388 3300025941 Ga0207711_10086244 Ga0207711_100862443 105
389 3300025941 Ga0207711_10107904 Ga0207711_101079042 105
390 3300025941 Ga0207711_10988006 Ga0207711_109880062 105
391 3300025942 Ga0207689_10031849 Ga0207689_100318494 105
392 3300025944 Ga0207661_10862847 Ga0207661_108628472 105
393 3300025945 Ga0207679_10701872 Ga0207679_107018721 105
394 3300025945 Ga0207679_10876866 Ga0207679_108768661 105
395 3300025945 Ga0207679_11669890 Ga0207679_116698902 105
396 3300025949 Ga0207667_10168621 Ga0207667_101686213 105
397 3300025949 Ga0207667_10230228 Ga0207667_102302282 105
398 3300025949 Ga0207667_10814489 Ga0207667_108144891 105
399 3300025960 Ga0207651_10072873 Ga0207651_100728731 105
400 3300025961 Ga0207712_10538677 Ga0207712_105386771 105
401 3300025961 Ga0207712_11132787 Ga0207712_111327871 105
402 3300025986 Ga0207658_10047022 Ga0207658_100470222 105
403 3300025986 Ga0207658_10071512 Ga0207658_100715122 105
404 3300026023 Ga0207677_10139446 Ga0207677_101394462 105
405 3300026023 Ga0207677_11789826 Ga0207677_117898262 105
406 3300026035 Ga0207703_10139094 Ga0207703_101390944 105
407 3300026035 Ga0207703_10333842 Ga0207703_103338422 105
408 3300026035 Ga0207703_10921854 Ga0207703_109218542 105
409 3300026035 Ga0207703_11003981 Ga0207703_110039812 105
410 3300026041 Ga0207639_10089016 Ga0207639_100890163 105
411 3300026041 Ga0207639_10400976 Ga0207639_104009763 105
412 3300026041 Ga0207639_11390914 Ga0207639_113909142 105
413 3300026067 Ga0207678_10097972 Ga0207678_100979723 105
414 3300026067 Ga0207678_10107195 Ga0207678_101071954 105
415 3300026067 Ga0207678_10239787 Ga0207678_102397872 105
416 3300026075 Ga0207708_10038595 Ga0207708_100385952 105
417 3300026075 Ga0207708_10354172 Ga0207708_103541722 105
418 3300026078 Ga0207702_10276224 Ga0207702_102762241 105
419 3300026078 Ga0207702_11533230 Ga0207702_115332302 105
420 3300026088 Ga0207641_10212558 Ga0207641_102125583 105
421 3300026088 Ga0207641_11516139 Ga0207641_115161392 105
422 3300026089 Ga0207648_10124866 Ga0207648_101248663 105
423 3300026089 Ga0207648_10186503 Ga0207648_101865032 105
424 3300026095 Ga0207676_10186879 Ga0207676_101868794 105
425 3300026118 Ga0207675_102137106 Ga0207675_1021371062 105
426 3300026121 Ga0207683_10001447 Ga0207683_1000144710 105
427 3300026121 Ga0207683_10153592 Ga0207683_101535921 105
428 3300026121 Ga0207683_10254310 Ga0207683_102543102 105
429 3300026142 Ga0207698_10383176 Ga0207698_103831762 105
430 3300026142 Ga0207698_10398539 Ga0207698_103985392 105
431 3300027682 Ga0209971_1154606 Ga0209971_11546062 105
432 3300027695 Ga0209966_1014410 Ga0209966_10144102 105
433 3300027876 Ga0209974_10036257 Ga0209974_100362572 105
434 3300028023 Ga0265357_1020655 Ga0265357_10206552 105
435 3300028379 Ga0268266_10025953 Ga0268266_100259532 105
436 3300028379 Ga0268266_10136477 Ga0268266_101364774 105
437 3300028379 Ga0268266_10243092 Ga0268266_102430923 105
438 3300028380 Ga0268265_12194390 Ga0268265_121943902 105
439 3300028381 Ga0268264_10483253 Ga0268264_104832532 105
440 3300028381 Ga0268264_10656641 Ga0268264_106566412 105
441 3300028556 Ga0265337_1001486 Ga0265337_100148616 105
442 3300028800 Ga0265338_10247553 Ga0265338_102475531 105
443 3300028800 Ga0265338_10306413 Ga0265338_103064132 105
444 3300030763 Ga0265763_1005459 Ga0265763_10054592 105
445 3300031018 Ga0265773_1031879 Ga0265773_10318792 105
446 3300031238 Ga0265332_10000899 Ga0265332_1000089912 105
447 3300031238 Ga0265332_10175142 Ga0265332_101751421 105
448 3300031241 Ga0265325_10000049 Ga0265325_1000004982 105
449 3300031241 Ga0265325_10083742 Ga0265325_100837422 105
450 3300031241 Ga0265325_10242883 Ga0265325_102428832 105
451 3300031242 Ga0265329_10221386 Ga0265329_102213862 105
452 3300031247 Ga0265340_10005450 Ga0265340_100054508 105
453 3300031247 Ga0265340_10166484 Ga0265340_101664842 105
454 3300031249 Ga0265339_10058197 Ga0265339_100581972 105
455 3300031249 Ga0265339_10210681 Ga0265339_102106811 105
456 3300031250 Ga0265331_10149249 Ga0265331_101492492 105
457 3300031344 Ga0265316_10261497 Ga0265316_102614972 105
458 3300031344 Ga0265316_10278153 Ga0265316_102781533 105
459 3300031595 Ga0265313_10036963 Ga0265313_100369633 105
460 3300031711 Ga0265314_10000784 Ga0265314_1000078410 105
461 3300031711 Ga0265314_10005953 Ga0265314_1000595311 105
462 3300031711 Ga0265314_10044806 Ga0265314_100448062 105
463 3300031712 Ga0265342_10000392 Ga0265342_1000039246 105
464 3300031712 Ga0265342_10166027 Ga0265342_101660272 105
465 3300031889 Ga0326468_10081748 Ga0326468_100817481 105
466 3300034818 Ga0373950_0018390 Ga0373950_0018390_847_1170 105
467 3300034819 Ga0373958_0085356 Ga0373958_0085356_343_666 105
468 3300034820 Ga0373959_0017137 Ga0373959_0017137_43_366 105
469 3300034820 Ga0373959_0087871 Ga0373959_0087871_381_704 105
470 3300034957 Ga0373938_0008109 Ga0373938_0008109_734_1057 105
471 3300035083 Ga0373926_0006103 Ga0373926_0006103_3172_3495 105
472 3300035084 Ga0373928_0004039 Ga0373928_0004039_1034_1357 105
473 3300035086 Ga0373934_0022825 Ga0373934_0022825_1705_2028 105
474 3300035086 Ga0373934_0120017 Ga0373934_0120017_210_533 105
475 3300035088 Ga0373940_0167330 Ga0373940_0167330_147_470 105
476 3300035090 Ga0373949_0027055 Ga0373949_0027055_152_475 105
477 3300035091 Ga0373951_0006562 Ga0373951_0006562_307_630 105
478 3300035092 Ga0373952_0061984 Ga0373952_0061984_548_871 105
479 3300035111 Ga0373923_0078244 Ga0373923_0078244_560_883 105
480 3300035112 Ga0373932_0003814 Ga0373932_0003814_635_958 105
481 3300035112 Ga0373932_0181145 Ga0373932_0181145_317_640 105
482 3300035114 Ga0373939_0016078 Ga0373939_0016078_547_870 105
483 3300035115 Ga0373941_0013677 Ga0373941_0013677_920_1243 105
484 3300035116 Ga0373945_0055006 Ga0373945_0055006_759_1082 105
485 3300035117 Ga0373953_0006441 Ga0373953_0006441_1458_1781 105
486 3300035117 Ga0373953_0042214 Ga0373953_0042214_1001_1324 105
487 3300035117 Ga0373953_0128359 Ga0373953_0128359_660_983 105
488 3300035118 Ga0373954_0008900 Ga0373954_0008900_805_1128 105
489 3300035118 Ga0373954_0200643 Ga0373954_0200643_42_365 105
490 3300035118 Ga0373954_0224537 Ga0373954_0224537_254_577 105
491 3300035119 Ga0373956_0019629 Ga0373956_0019629_318_641 105
492 3300035119 Ga0373956_0076710 Ga0373956_0076710_1058_1381 105
493 3300035119 Ga0373956_0257183 Ga0373956_0257183_247_570 105
494 3300035120 Ga0373957_0341802 Ga0373957_0341802_76_399 105
495 3300035120 Ga0373957_0419885 Ga0373957_0419885_157_480 105
496 3300035121 Ga0373960_0004580 Ga0373960_0004580_1267_1590 105
497 3300035170 Ga0373943_0138348 Ga0373943_0138348_792_1115 105
498 3300035170 Ga0373943_0374997 Ga0373943_0374997_299_622 105
499 3300035170 Ga0373943_0433959 Ga0373943_0433959_70_393 105
500 3300035171 Ga0373946_0022847 Ga0373946_0022847_865_1188 105
501 3300035171 Ga0373946_0059173 Ga0373946_0059173_208_531 105
502 3300035171 Ga0373946_0178157 Ga0373946_0178157_328_651 105
503 3300035172 Ga0373955_0024935 Ga0373955_0024935_734_1057 105
504 3300035172 Ga0373955_0144548 Ga0373955_0144548_497_820 105
505 3300035172 Ga0373955_0194939 Ga0373955_0194939_170_493 105
506 3300035172 Ga0373955_0615985 Ga0373955_0615985_262_585 105
507 3300035207 Ga0373942_0057053 Ga0373942_0057053_187_510 105
508 3300035241 Ga0373961_0061888 Ga0373961_0061888_790_1113 105
509 3300035242 Ga0373962_0057562 Ga0373962_0057562_523_846 105
510 3300035242 Ga0373962_0078344 Ga0373962_0078344_301_624 105
511 3300035398 Ga0316574_0791808 Ga0316574_0791808_70_393 105
512 3300035410 Ga0373924_0008024 Ga0373924_0008024_1916_2239 105
513 3300035410 Ga0373924_0029447 Ga0373924_0029447_166_489 105
514 3300035410 Ga0373924_0033955 Ga0373924_0033955_1464_1787 105
515 3300035410 Ga0373924_0044023 Ga0373924_0044023_1229_1552 105
516 3300035691 Ga0373931_0004569 Ga0373931_0004569_1122_1445 105
517 3300035692 Ga0373935_0015490 Ga0373935_0015490_4206_4529 105
518 3300035692 Ga0373935_0035574 Ga0373935_0035574_2079_2402 105
519 3300035692 Ga0373935_0067946 Ga0373935_0067946_1069_1392 105
520 3300035692 Ga0373935_0104396 Ga0373935_0104396_964_1287 105
521 3300035695 Ga0373927_0017601 Ga0373927_0017601_3954_4277 105
522 3300035695 Ga0373927_0211276 Ga0373927_0211276_871_1194 105
523 3300035724 Ga0373933_0002449 Ga0373933_0002449_6434_6757 105
524 3300035724 Ga0373933_0260278 Ga0373933_0260278_459_782 105
525 3300035725 Ga0373947_0005403 Ga0373947_0005403_5202_5525 105
526 3300035725 Ga0373947_0018365 Ga0373947_0018365_2203_2526 105
527 3300035725 Ga0373947_0119293 Ga0373947_0119293_1206_1529 105
528 3300035725 Ga0373947_0124973 Ga0373947_0124973_1171_1494 105
529 3300035725 Ga0373947_0202839 Ga0373947_0202839_209_532 105
530 3300036401 Ga0373937_0002996 Ga0373937_0002996_6306_6629 105
531 3300036401 Ga0373937_0008068 Ga0373937_0008068_807_1130 105
532 3300036401 Ga0373937_0008991 Ga0373937_0008991_1236_1559 105
533 3300036401 Ga0373937_0142283 Ga0373937_0142283_1058_1381 105
534 3300036401 Ga0373937_0345221 Ga0373937_0345221_859_1182 105
535 3300036401 Ga0373937_0516898 Ga0373937_0516898_709_1032 105
536 3300036401 Ga0373937_0873754 Ga0373937_0873754_97_420 105
537 3300036401 Ga0373937_2008695 Ga0373937_2008695_70_393 105
538 3300037068 Ga0373925_0025234 Ga0373925_0025234_1881_2204 105
539 3300037068 Ga0373925_0098740 Ga0373925_0098740_193_516 105
540 3300037068 Ga0373925_0101593 Ga0373925_0101593_1208_1531 105
541 3300037068 Ga0373925_0759985 Ga0373925_0759985_445_768 105
542 3300037466 Ga0395898_0613059 Ga0395898_0613059_427_747 105
543 3300037853 Ga0436364_0364973 Ga0436364_0364973_163_483 105
544 3300039437 Ga0436365_0090047 Ga0436365_0090047_1051_1374 105
545 3300039437 Ga0436365_0390621 Ga0436365_0390621_85_405 105
546 3300039438 Ga0436360_0203691 Ga0436360_0203691_655_978 105
547 3300041413 Ga0439465_0071611 Ga0439465_0071611_358_678 105
548 3300041460 Ga0451802_0275182 Ga0451802_0275182_621_938 105
549 3300041498 Ga0451841_0043378 Ga0451841_0043378_95_415 105
550 3300041509 Ga0451843_0333450 Ga0451843_0333450_206_523 105
551 3300042012 Ga0439455_0140561 Ga0439455_0140561_99_422 105
552 3300042439 Ga0439464_0120779 Ga0439464_0120779_131_451 105
553 3300042439 Ga0439464_0128357 Ga0439464_0128357_156_479 105
554 3300045976 Ga0466967_1019021 Ga0466967_1019021_469_789 105
555 3300046454 Ga0495592_0001840 Ga0495592_0001840_6862_7185 105
556 3300046454 Ga0495592_0010619 Ga0495592_0010619_4869_5192 105
557 3300046454 Ga0495592_0626729 Ga0495592_0626729_156_479 105
558 3300046455 Ga0495603_0011026 Ga0495603_0011026_1948_2271 105
559 3300046455 Ga0495603_0037807 Ga0495603_0037807_1118_1441 105
560 3300046459 Ga0495629_0000269 Ga0495629_0000269_15888_16211 105
561 3300046459 Ga0495629_0069439 Ga0495629_0069439_1668_1991 105
562 3300046459 Ga0495629_0089738 Ga0495629_0089738_406_729 105
563 3300046460 Ga0495638_0040160 Ga0495638_0040160_2300_2623 105
564 3300046461 Ga0495641_0026269 Ga0495641_0026269_1412_1735 105
565 3300046461 Ga0495641_0042734 Ga0495641_0042734_1134_1457 105
566 3300046461 Ga0495641_0150265 Ga0495641_0150265_256_579 105
567 3300046461 Ga0495641_0317993 Ga0495641_0317993_26_349 105
568 3300046462 Ga0495651_0005718 Ga0495651_0005718_5831_6154 105
569 3300046462 Ga0495651_0010406 Ga0495651_0010406_6123_6446 105
570 3300046462 Ga0495651_0064265 Ga0495651_0064265_1748_2071 105
571 3300046462 Ga0495651_0185639 Ga0495651_0185639_72_395 105
572 3300046462 Ga0495651_0360559 Ga0495651_0360559_428_751 105
573 3300046462 Ga0495651_0460971 Ga0495651_0460971_81_404 105
574 3300046463 Ga0495653_0010063 Ga0495653_0010063_3247_3570 105
575 3300046463 Ga0495653_0030364 Ga0495653_0030364_1690_2013 105
576 3300046463 Ga0495653_0146642 Ga0495653_0146642_809_1132 105
577 3300046463 Ga0495653_0171215 Ga0495653_0171215_801_1124 105
578 3300046463 Ga0495653_0216780 Ga0495653_0216780_585_908 105
579 3300046463 Ga0495653_0967615 Ga0495653_0967615_32_355 105
580 3300046472 Ga0495580_0243568 Ga0495580_0243568_137_460 105
581 3300046472 Ga0495580_0560182 Ga0495580_0560182_76_399 105
582 3300046472 Ga0495580_0651674 Ga0495580_0651674_32_355 105
583 3300046473 Ga0495582_0003928 Ga0495582_0003928_2866_3189 105
584 3300046473 Ga0495582_0109872 Ga0495582_0109872_55_378 105
585 3300046475 Ga0495639_0396873 Ga0495639_0396873_340_663 105
586 3300046476 Ga0495662_0105186 Ga0495662_0105186_22_345 105
587 3300046476 Ga0495662_0114856 Ga0495662_0114856_24_347 105
588 3300046477 Ga0495664_0010264 Ga0495664_0010264_2002_2325 105
589 3300046477 Ga0495664_0021710 Ga0495664_0021710_208_531 105
590 3300046477 Ga0495664_0118438 Ga0495664_0118438_854_1177 105
591 3300046499 Ga0495594_0009788 Ga0495594_0009788_1962_2285 105
592 3300046499 Ga0495594_0027976 Ga0495594_0027976_646_969 105
593 3300046511 Ga0495608_0001268 Ga0495608_0001268_11651_11974 105
594 3300046511 Ga0495608_0016256 Ga0495608_0016256_3424_3747 105
595 3300046511 Ga0495608_0285310 Ga0495608_0285310_547_870 105
596 3300046512 Ga0495610_0301084 Ga0495610_0301084_198_518 105
597 3300046514 Ga0495618_0037072 Ga0495618_0037072_686_1009 105
598 3300046514 Ga0495618_0088979 Ga0495618_0088979_1511_1834 105
599 3300046514 Ga0495618_0254207 Ga0495618_0254207_660_983 105
600 3300046514 Ga0495618_0331159 Ga0495618_0331159_79_402 105
601 3300046514 Ga0495618_0574481 Ga0495618_0574481_125_448 105
602 3300046516 Ga0495628_0005226 Ga0495628_0005226_3522_3845 105
603 3300046516 Ga0495628_0268395 Ga0495628_0268395_29_352 105
604 3300046517 Ga0495630_0192162 Ga0495630_0192162_277_600 105
605 3300046517 Ga0495630_0475487 Ga0495630_0475487_143_466 105
606 3300046517 Ga0495630_0638424 Ga0495630_0638424_146_469 105
607 3300046526 Ga0495666_0167651 Ga0495666_0167651_70_393 105
608 3300046529 Ga0495652_0061818 Ga0495652_0061818_2721_3044 105
609 3300046529 Ga0495652_0077885 Ga0495652_0077885_244_567 105
610 3300046529 Ga0495652_0216037 Ga0495652_0216037_788_1111 105
611 3300046529 Ga0495652_0224929 Ga0495652_0224929_807_1130 105
612 3300046533 Ga0495640_0006352 Ga0495640_0006352_1678_2001 105
613 3300046533 Ga0495640_0018005 Ga0495640_0018005_4907_5230 105
614 3300046533 Ga0495640_0040789 Ga0495640_0040789_342_665 105
615 3300046533 Ga0495640_0422869 Ga0495640_0422869_274_597 105
616 3300046535 Ga0495586_0011910 Ga0495586_0011910_3946_4269 105
617 3300046535 Ga0495586_0171759 Ga0495586_0171759_470_793 105
618 3300046536 Ga0495587_0000620 Ga0495587_0000620_12758_13081 105
619 3300046536 Ga0495587_0058326 Ga0495587_0058326_1372_1695 105
620 3300046543 Ga0495645_0000848 Ga0495645_0000848_9075_9398 105
621 3300046543 Ga0495645_0008343 Ga0495645_0008343_6760_7083 105
622 3300046543 Ga0495645_0393965 Ga0495645_0393965_223_546 105
623 3300046543 Ga0495645_0775211 Ga0495645_0775211_40_363 105
624 3300046557 Ga0495622_0043236 Ga0495622_0043236_1382_1705 105
625 3300046559 Ga0495667_0001254 Ga0495667_0001254_4274_4597 105
626 3300046559 Ga0495667_0022137 Ga0495667_0022137_3920_4243 105
627 3300046559 Ga0495667_0097610 Ga0495667_0097610_443_766 105
628 3300046559 Ga0495667_0104514 Ga0495667_0104514_55_378 105
629 3300046559 Ga0495667_0105159 Ga0495667_0105159_485_808 105
630 3300046559 Ga0495667_0113573 Ga0495667_0113573_1397_1720 105
631 3300046642 Ga0495634_0017607 Ga0495634_0017607_2544_2867 105
632 3300046642 Ga0495634_0019712 Ga0495634_0019712_4274_4597 105
633 3300046642 Ga0495634_0266260 Ga0495634_0266260_208_531 105
634 3300046663 Ga0495635_0005437 Ga0495635_0005437_1527_1850 105
635 3300046663 Ga0495635_0036531 Ga0495635_0036531_637_960 105
636 3300046663 Ga0495635_0090897 Ga0495635_0090897_96_419 105
637 3300046663 Ga0495635_0091274 Ga0495635_0091274_1513_1836 105
638 3300046663 Ga0495635_0146947 Ga0495635_0146947_493_816 105
639 3300046663 Ga0495635_0346365 Ga0495635_0346365_508_831 105
640 3300046663 Ga0495635_0466719 Ga0495635_0466719_472_795 105
641 3300046665 Ga0495661_0165033 Ga0495661_0165033_781_1098 105
642 3300046674 Ga0495588_0067758 Ga0495588_0067758_391_714 105
643 3300046675 Ga0495657_0002939 Ga0495657_0002939_5247_5570 105
644 3300046675 Ga0495657_0032408 Ga0495657_0032408_2178_2501 105
645 3300046678 Ga0495599_0062103 Ga0495599_0062103_775_1098 105
646 3300046678 Ga0495599_0214597 Ga0495599_0214597_679_1002 105
647 3300046679 Ga0495623_0026867 Ga0495623_0026867_1491_1814 105
648 3300046679 Ga0495623_0035166 Ga0495623_0035166_77_400 105
649 3300046680 Ga0495646_0000856 Ga0495646_0000856_2478_2801 105
650 3300046680 Ga0495646_0083480 Ga0495646_0083480_513_836 105
651 3300046680 Ga0495646_0202842 Ga0495646_0202842_406_729 105
652 3300046681 Ga0495647_0053754 Ga0495647_0053754_1083_1406 105
653 3300046683 Ga0495658_0004553 Ga0495658_0004553_3661_3984 105
654 3300046683 Ga0495658_0810370 Ga0495658_0810370_181_504 105
655 3300046689 Ga0495613_0038188 Ga0495613_0038188_1938_2261 105
656 3300046689 Ga0495613_0162962 Ga0495613_0162962_1086_1409 105
657 3300046689 Ga0495613_0394572 Ga0495613_0394572_167_490 105
658 3300046689 Ga0495613_0430843 Ga0495613_0430843_553_876 105
659 3300046690 Ga0495624_0040542 Ga0495624_0040542_646_969 105
660 3300046690 Ga0495624_0137836 Ga0495624_0137836_172_495 105
661 3300046690 Ga0495624_0387213 Ga0495624_0387213_16_339 105
662 3300046809 Ga0495600_0016667 Ga0495600_0016667_3505_3828 105
663 3300046809 Ga0495600_0052308 Ga0495600_0052308_347_670 105
664 3300046809 Ga0495600_0128219 Ga0495600_0128219_226_549 105
665 3300046809 Ga0495600_0133793 Ga0495600_0133793_229_552 105
666 3300046809 Ga0495600_0579557 Ga0495600_0579557_112_435 105
667 3300047315 Ga0495581_0036567 Ga0495581_0036567_1465_1788 105
668 3300047315 Ga0495581_0101672 Ga0495581_0101672_771_1094 105
669 3300047317 Ga0495604_0005959 Ga0495604_0005959_1491_1814 105
670 3300047317 Ga0495604_0027617 Ga0495604_0027617_2932_3255 105
671 3300047317 Ga0495604_0056504 Ga0495604_0056504_1306_1629 105
672 3300047317 Ga0495604_0103429 Ga0495604_0103429_517_840 105
673 3300047317 Ga0495604_0591355 Ga0495604_0591355_369_689 105
674 3300047319 Ga0495674_0005637 Ga0495674_0005637_2616_2939 105
675 3300047319 Ga0495674_0061401 Ga0495674_0061401_2082_2405 105
676 3300047321 Ga0495676_0034516 Ga0495676_0034516_2210_2533 105
677 3300047321 Ga0495676_0144308 Ga0495676_0144308_1110_1433 105
678 3300047322 Ga0495680_0001472 Ga0495680_0001472_13040_13363 105
679 3300047322 Ga0495680_0006777 Ga0495680_0006777_8682_9005 105
680 3300047322 Ga0495680_0017612 Ga0495680_0017612_4574_4897 105
681 3300047322 Ga0495680_0018210 Ga0495680_0018210_477_800 105
682 3300047322 Ga0495680_0022232 Ga0495680_0022232_528_851 105
683 3300047322 Ga0495680_0217882 Ga0495680_0217882_667_990 105
684 3300047322 Ga0495680_0241607 Ga0495680_0241607_646_969 105
685 3300047444 Ga0495675_0018016 Ga0495675_0018016_2694_3017 105
686 3300047444 Ga0495675_0048151 Ga0495675_0048151_93_416 105
687 3300047444 Ga0495675_0168024 Ga0495675_0168024_137_460 105
688 3300047471 Ga0495684_0031095 Ga0495684_0031095_1290_1613 105
689 3300047471 Ga0495684_0047729 Ga0495684_0047729_2209_2532 105
690 3300047471 Ga0495684_0213504 Ga0495684_0213504_524_847 105
691 3300047471 Ga0495684_0294075 Ga0495684_0294075_238_561 105
692 3300047471 Ga0495684_0298325 Ga0495684_0298325_310_633 105
693 3300047471 Ga0495684_0633406 Ga0495684_0633406_244_567 105
694 3300047673 Ga0495593_0009204 Ga0495593_0009204_4545_4868 105
695 3300048088 Ga0495602_0002664 Ga0495602_0002664_6091_6414 105
696 3300048088 Ga0495602_0013607 Ga0495602_0013607_5822_6145 105
697 3300048088 Ga0495602_0128650 Ga0495602_0128650_1245_1568 105
698 3300048088 Ga0495602_0183138 Ga0495602_0183138_428_751 105
699 3300048088 Ga0495602_0515833 Ga0495602_0515833_317_640 105
700 3300048089 Ga0495614_0145476 Ga0495614_0145476_297_620 105
701 3300048903 Ga0496100_0006554 Ga0496100_0006554_4884_5207 105
702 3300048903 Ga0496100_0102455 Ga0496100_0102455_1199_1522 105
703 3300048903 Ga0496100_0204967 Ga0496100_0204967_777_1100 105
704 3300048903 Ga0496100_0399268 Ga0496100_0399268_242_565 105
705 3300048904 Ga0496101_0007659 Ga0496101_0007659_4889_5212 105
706 3300048904 Ga0496101_0016572 Ga0496101_0016572_1558_1881 105
707 3300048904 Ga0496101_0347632 Ga0496101_0347632_216_539 105
708 3300048904 Ga0496101_0435107 Ga0496101_0435107_184_507 105
709 3300048905 Ga0496102_0016358 Ga0496102_0016358_2750_3073 105
710 3300048905 Ga0496102_0070115 Ga0496102_0070115_2522_2845 105
711 3300048905 Ga0496102_0261230 Ga0496102_0261230_335_658 105
712 3300048905 Ga0496102_0776671 Ga0496102_0776671_152_475 105
713 3300048905 Ga0496102_0812061 Ga0496102_0812061_517_840 105
714 3300048905 Ga0496102_1210976 Ga0496102_1210976_94_414 105
715 3300048906 Ga0496103_0107057 Ga0496103_0107057_903_1226 105
716 3300048906 Ga0496103_0280558 Ga0496103_0280558_369_692 105
717 3300048906 Ga0496103_0316878 Ga0496103_0316878_495_818 105
718 3300048907 Ga0496104_0000215 Ga0496104_0000215_23178_23501 105
719 3300048907 Ga0496104_0005956 Ga0496104_0005956_6910_7233 105
720 3300048907 Ga0496104_0097659 Ga0496104_0097659_713_1036 105
721 3300048907 Ga0496104_0243034 Ga0496104_0243034_1111_1434 105
722 3300048907 Ga0496104_0374856 Ga0496104_0374856_406_729 105
723 3300048907 Ga0496104_0498536 Ga0496104_0498536_529_852 105
724 3300048908 Ga0496105_0007651 Ga0496105_0007651_3188_3511 105
725 3300048908 Ga0496105_0020355 Ga0496105_0020355_795_1118 105
726 3300048908 Ga0496105_0157101 Ga0496105_0157101_1534_1857 105
727 3300048908 Ga0496105_0242092 Ga0496105_0242092_1131_1454 105
728 3300048908 Ga0496105_0429422 Ga0496105_0429422_294_617 105
729 3300048908 Ga0496105_0515938 Ga0496105_0515938_152_475 105
730 3300048909 Ga0496106_0019937 Ga0496106_0019937_2638_2961 105
731 3300048909 Ga0496106_0067503 Ga0496106_0067503_1298_1621 105
732 3300048910 Ga0496107_0019768 Ga0496107_0019768_985_1308 105
733 3300048910 Ga0496107_0295593 Ga0496107_0295593_301_624 105
734 3300048910 Ga0496107_0520826 Ga0496107_0520826_153_476 105
735 3300048911 Ga0496108_0056436 Ga0496108_0056436_406_729 105
736 3300048911 Ga0496108_0057496 Ga0496108_0057496_2499_2822 105
737 3300048911 Ga0496108_0241156 Ga0496108_0241156_11_334 105
738 3300048911 Ga0496108_0448952 Ga0496108_0448952_562_885 105
739 3300048912 Ga0496109_0133946 Ga0496109_0133946_1981_2304 105
740 3300048912 Ga0496109_0156658 Ga0496109_0156658_35_358 105
741 3300048912 Ga0496109_0389585 Ga0496109_0389585_11_334 105
742 3300048912 Ga0496109_0401126 Ga0496109_0401126_406_729 105
743 3300048912 Ga0496109_0961668 Ga0496109_0961668_49_372 105
744 3300048912 Ga0496109_1184394 Ga0496109_1184394_223_546 105
745 3300048913 Ga0496110_0022488 Ga0496110_0022488_686_1009 105
746 3300048913 Ga0496110_0302206 Ga0496110_0302206_569_892 105
747 3300048913 Ga0496110_0356076 Ga0496110_0356076_982_1305 105
748 3300048913 Ga0496110_0368896 Ga0496110_0368896_378_701 105
749 3300048914 Ga0496111_0084837 Ga0496111_0084837_1259_1582 105
750 3300048914 Ga0496111_0317797 Ga0496111_0317797_43_366 105
751 3300048915 Ga0496112_0193985 Ga0496112_0193985_1197_1520 105
752 3300048915 Ga0496112_0195658 Ga0496112_0195658_566_889 105
753 3300048915 Ga0496112_0570510 Ga0496112_0570510_406_729 105
754 3300048915 Ga0496112_0830786 Ga0496112_0830786_199_522 105
755 3300048915 Ga0496112_1243055 Ga0496112_1243055_161_484 105
756 3300048916 Ga0496113_0251371 Ga0496113_0251371_756_1079 105
757 3300048916 Ga0496113_0427014 Ga0496113_0427014_336_659 105
758 3300048916 Ga0496113_0436095 Ga0496113_0436095_166_489 105
759 3300048916 Ga0496113_1451526 Ga0496113_1451526_25_348 105
760 3300048917 Ga0496114_0076223 Ga0496114_0076223_648_971 105
761 3300048917 Ga0496114_0376999 Ga0496114_0376999_676_996 105
762 3300048917 Ga0496114_1041826 Ga0496114_1041826_243_566 105
763 3300048918 Ga0496115_0013246 Ga0496115_0013246_5168_5491 105
764 3300048918 Ga0496115_0073757 Ga0496115_0073757_408_731 105
765 3300048918 Ga0496115_0099732 Ga0496115_0099732_1924_2247 105
766 3300048918 Ga0496115_0582525 Ga0496115_0582525_490_813 105
767 3300048918 Ga0496115_0713092 Ga0496115_0713092_436_759 105
768 3300048918 Ga0496115_0759486 Ga0496115_0759486_29_352 105
769 3300048918 Ga0496115_1243551 Ga0496115_1243551_195_518 105
770 3300048922 Ga0496119_0145579 Ga0496119_0145579_576_899 105
771 3300048924 Ga0496121_0450721 Ga0496121_0450721_276_596 105
772 3300048925 Ga0496122_0052608 Ga0496122_0052608_2695_3015 105
773 3300048927 Ga0496124_0378319 Ga0496124_0378319_580_900 105
774 3300048928 Ga0496125_0000746 Ga0496125_0000746_38055_38375 105
775 3300048929 Ga0496126_0038000 Ga0496126_0038000_2087_2407 105
776 3300048929 Ga0496126_0108022 Ga0496126_0108022_617_937 105
777 3300048929 Ga0496126_0157082 Ga0496126_0157082_505_825 105
778 3300048929 Ga0496126_0208556 Ga0496126_0208556_838_1158 105
779 3300048929 Ga0496126_0661143 Ga0496126_0661143_454_771 105
780 3300049568 Ga0501031_0255750 Ga0501031_0255750_282_605 105
781 3300049571 Ga0501034_0182998 Ga0501034_0182998_1667_1990 105
782 3300049572 Ga0501036_0114702 Ga0501036_0114702_598_918 105
783 3300049575 Ga0501039_1344434 Ga0501039_1344434_50_373 105
784 3300049578 Ga0501042_0286813 Ga0501042_0286813_519_839 105
785 3300049579 Ga0501043_0448869 Ga0501043_0448869_346_669 105
786 3300049579 Ga0501043_1083288 Ga0501043_1083288_173_496 105
787 3300049581 Ga0501047_0008787 Ga0501047_0008787_1088_1411 105
788 3300049581 Ga0501047_0611642 Ga0501047_0611642_267_590 105
789 3300049583 Ga0501067_0711546 Ga0501067_0711546_21_344 105
790 3300049584 Ga0501068_0691835 Ga0501068_0691835_301_624 105
791 3300049586 Ga0501070_0367305 Ga0501070_0367305_306_629 105
792 3300049589 Ga0501073_0034839 Ga0501073_0034839_1450_1773 105
793 3300049591 Ga0501075_0734248 Ga0501075_0734248_166_486 105
794 3300049592 Ga0501076_0220426 Ga0501076_0220426_146_466 105
795 3300049741 Ga0501079_0565858 Ga0501079_0565858_236_559 105
796 3300049742 Ga0501080_1170424 Ga0501080_1170424_184_507 105
797 3300049743 Ga0501081_0672417 Ga0501081_0672417_289_609 105
798 3300049744 Ga0501083_0023331 Ga0501083_0023331_686_1009 105
799 3300049822 Ga0501035_0657975 Ga0501035_0657975_376_699 105
800 3300049823 Ga0501044_0103888 Ga0501044_0103888_2228_2551 105
801 3300049823 Ga0501044_0118153 Ga0501044_0118153_749_1072 105
802 3300050491 nmdc:mga00v17_900844_c1 nmdc:mga00v17_900844_c1_64_384 105
803 3300050492 nmdc:mga0yw44_16709_c1 nmdc:mga0yw44_16709_c1_2243_2560 105
804 3300050492 nmdc:mga0yw44_945281_c1 nmdc:mga0yw44_945281_c1_146_469 105
805 3300050512 nmdc:mga0n895_141846_c1 nmdc:mga0n895_141846_c1_1539_1862 105
806 3300050512 nmdc:mga0n895_161587_c1 nmdc:mga0n895_161587_c1_186_509 105
807 3300050513 nmdc:mga0rr50_134685_c1 nmdc:mga0rr50_134685_c1_652_975 105
808 3300050514 nmdc:mga08x19_27777_c1 nmdc:mga08x19_27777_c1_1649_1972 105
809 3300050514 nmdc:mga08x19_580259_c1 nmdc:mga08x19_580259_c1_360_683 105
810 3300050516 nmdc:mga0sz30_281867_c1 nmdc:mga0sz30_281867_c1_104_421 105
811 3300053077 Ga0495601_0000109 Ga0495601_0000109_39064_39387 105
812 3300053077 Ga0495601_0002506 Ga0495601_0002506_2637_2960 105
813 3300053077 Ga0495601_0006125 Ga0495601_0006125_2615_2938 105
814 3300053077 Ga0495601_0009758 Ga0495601_0009758_3960_4283 105
815 3300053077 Ga0495601_0053399 Ga0495601_0053399_629_952 105
816 3300053077 Ga0495601_0059733 Ga0495601_0059733_1282_1605 105
817 3300053078 Ga0495612_0000953 Ga0495612_0000953_7771_8094 105
818 3300053078 Ga0495612_0002655 Ga0495612_0002655_163_486 105
819 3300053078 Ga0495612_0006674 Ga0495612_0006674_1940_2263 105
820 3300053080 Ga0500635_0015242 Ga0500635_0015242_1848_2168 105
821 3300053084 Ga0495595_0001271 Ga0495595_0001271_4057_4380 105
822 3300053084 Ga0495595_0005318 Ga0495595_0005318_2194_2517 105
823 3300053084 Ga0495595_0005872 Ga0495595_0005872_2298_2621 105
824 3300053084 Ga0495595_0019136 Ga0495595_0019136_652_975 105
825 3300053084 Ga0495595_0033835 Ga0495595_0033835_1827_2150 105
826 3300053085 Ga0495619_0000289 Ga0495619_0000289_29246_29569 105
827 3300053085 Ga0495619_0000662 Ga0495619_0000662_18117_18440 105
828 3300053085 Ga0495619_0002507 Ga0495619_0002507_10227_10550 105
829 3300053085 Ga0495619_0004938 Ga0495619_0004938_1237_1560 105
830 3300053085 Ga0495619_0015439 Ga0495619_0015439_4112_4435 105
831 3300053085 Ga0495619_0376229 Ga0495619_0376229_287_610 105
832 3300053085 Ga0495619_1025951 Ga0495619_1025951_101_460 105
833 3300053087 Ga0500643_002483 Ga0500643_002483_6749_7072 105
834 3300053088 Ga0500644_0000860 Ga0500644_0000860_9207_9530 105
835 3300053090 Ga0500646_0025028 Ga0500646_0025028_527_850 105
836 3300053093 Ga0500651_0721863 Ga0500651_0721863_152_475 105
837 3300053094 Ga0500566_0072243 Ga0500566_0072243_1391_1714 105
838 3300053098 Ga0500650_0451371 Ga0500650_0451371_111_434 105
839 3300053119 Ga0500595_000062 Ga0500595_000062_16421_16744 105
840 3300053119 Ga0500595_016246 Ga0500595_016246_1363_1680 105
841 3300053131 Ga0500652_033278 Ga0500652_033278_18_341 105
842 3300053133 Ga0500655_084049 Ga0500655_084049_311_634 105
843 3300053136 Ga0500559_0262266 Ga0500559_0262266_86_406 105
844 3300053138 Ga0500564_234759 Ga0500564_234759_372_692 105
845 3300053153 Ga0500616_0000006 Ga0500616_0000006_806424_806747 105
846 3300053163 Ga0500639_028570 Ga0500639_028570_272_592 105
847 3300053178 Ga0500637_0082391 Ga0500637_0082391_859_1179 105
848 3300053730 Ga0500645_000101 Ga0500645_000101_29624_29947 105
849 3300060353 Ga0501082_0067452 Ga0501082_0067452_1412_1735 105
850 3300061734 Ga0530510_0471912 Ga0530510_0471912_519_839 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

19

115

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.9211 2 105
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.9173 2 105
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.9118 2 104
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8912 2 105
2oxh-assembly1.cif.gz_Z the soxyz complex of paracoccus pantotrophus 0.8892 3 104
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9173 2 105 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8912 2 105 2.60.40.10
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8415 3 103 2.60.40.10
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8163 1 105 2.60.40.2470
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7989 3 103 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A6P1B118-F1-model_v4 deleted 0.9377 40 105
AF-A0A6L8GCQ2-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9318 2 105
AF-A0A484H5H5-F1-model_v4 Sulfur oxidation protein SoxZ 0.9295 3 105
AF-A0A7V8ISW7-F1-model_v4 deleted 0.9293 2 105
AF-A0A3B8RJ57-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9286 3 105

Feature Viewer

pLDDT pTM Quality
91.87 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map