F483441

General Info

Members Datasets Scaffolds Average Seq Length
850 578 1700 441

Family's Representative Sequence

Representative Sequence 3300053145|Ga0500586_019666|Ga0500586_019666_286_1890
Length 482
Sequence MLTPRTRKRRENASAWLFDIHIRNDQGTEPRSGFGMRHQRLRASLTLPRTFIPAALAWQRNAHHLALRHQQTSTGTPTMDVHRRHLLTVSGAGLAAGAFAASSDAARAAPLTSTLGRDATQYGVRPGSQDDQTRVLQRAIDEAARAQVPLALPPGVYRTGTLKLARGSQIIGIRGLTLDGNFAKLPPRRGLLHMVQARELRISDCSITNSGGAGIWLENSAGAITGNTLTNIATTAIVSFDAQGLIVAQNTIAGSSSNGIEILRTAIGDDGTQVIDNRIEDIKAGPGGSGQYGNAINAFRAGNVIVSGNRIRNCDYSAVRGNREVALYSEFAFEAAIIANNTVDGAALGVSVCNFNEGGRIAVVQGNIIRNLIPKRPIGTAPDDDAGIGIYIEADASVTGNVVENAPSFGMIAGWGKYLRFIGIGVSVAPGAGTALVSNNMISGAARGAVVGLDHAKPVTPDLTADGAQRYQQVALSGNTVR

Samples

Sample ID Description Type Environment
1 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
56 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
77 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
78 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
79 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
130 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
131 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
132 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
137 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
138 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
303 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
304 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
308 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
309 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
310 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
311 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
312 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
313 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
314 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
315 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
316 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
317 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
318 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
319 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
320 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
321 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
322 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
323 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
324 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
325 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
326 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
330 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
331 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
332 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
333 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
334 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
335 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
336 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
337 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
338 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
339 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
340 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
341 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
344 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
345 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
346 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
351 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
352 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
353 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
354 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
355 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
356 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
357 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
358 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
359 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
360 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
361 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
362 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
363 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
364 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
365 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
366 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
367 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
368 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
369 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
370 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
371 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
372 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
373 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
374 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
375 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
376 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
377 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
378 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
379 2643221651 Afipia sp. Root123D2 Isolate Unclassified
380 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
381 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
382 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
383 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
384 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
385 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
386 2791355199
387 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
388 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
389 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
390 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
391 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
392 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
393 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
394 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
395 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
396 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
397 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
398 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
399 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
400 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
401 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
402 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
403 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
404 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
405 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
406 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
407 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
408 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
409 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
410 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
411 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
412 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
413 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
414 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
415 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
416 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
417 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
418 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
419 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
420 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
421 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
422 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
423 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
424 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
425 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
426 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
427 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
428 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
429 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
430 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
431 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
432 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
433 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
434 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
435 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
436 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
437 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
438 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
439 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
440 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
441 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
442 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
443 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
444 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
445 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
446 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
447 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
448 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
449 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
450 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
451 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
452 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
453 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
454 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
455 2904699407
456 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
457 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
458 2906610324
459 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
460 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
461 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
462 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
463 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
464 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
465 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
466 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
467 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
468 2922368715
469 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
470 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
471 2922425934
472 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
473 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
474 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
475 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
476 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
477 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
478 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
479 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
480 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
481 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
482 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
483 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
484 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
485 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
486 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
487 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
488 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
489 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
490 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
491 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
492 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
493 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
494 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
495 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
496 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
497 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
498 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
499 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
500 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
501 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
502 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
503 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
504 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
505 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
506 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
507 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
508 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
509 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
510 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
511 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
512 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
513 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
514 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
515 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
516 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
517 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
518 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
519 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
520 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
521 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
522 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
523 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
524 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
525 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
526 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
527 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
528 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
529 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
530 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
531 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
532 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
533 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
534 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
535 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
536 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
537 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
538 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
539 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
540 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
541 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
542 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
543 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
544 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
545 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
546 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
547 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
548 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
549 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
550 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
551 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
552 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
553 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
554 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
555 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
556 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
557 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
558 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
559 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
560 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
561 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
562 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
563 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
564 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
565 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
566 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
567 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
568 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
569 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
570 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
571 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
572 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
573 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
574 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
575 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
576 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
577 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
578 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.61
Metatranscriptomes 0
Isolates 26.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 21.06
Rhizoplane 3.53
Rhizosphere 49.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500586_019666 3300053145 Bacteria 2103
2 JGI25406J46586_10000034 3300003203 Bacteria 64645
3 JGI25406J46586_10003494 3300003203 Bacteria 7382
4 JGI25153J46596_10006205 3300003215 Bacteria 6115
5 JGI25153J46596_10008275 3300003215 Bacteria 4993
6 JGI25160J50197_1004954 3300003354 Bacteria 5654
7 JGI25404J52841_10006160 3300003659 Bacteria 2499
8 Ga0055543_1003802 3300004625 Bacteria 4295
9 Ga0065165_1002181 3300005262 Bacteria 17639
10 Ga0065165_1002644 3300005262 Bacteria 14510
11 Ga0065165_1013018 3300005262 Bacteria 3337
12 Ga0070658_10077056 3300005327 Bacteria 2735
13 Ga0070683_100016132 3300005329 Bacteria 6577
14 Ga0070680_100016901 3300005336 Bacteria 5743
15 Ga0070680_100027944 3300005336 Bacteria 4521
16 Ga0070682_100024159 3300005337 Bacteria 3615
17 Ga0068868_100016332 3300005338 Bacteria 5511
18 Ga0070674_100053656 3300005356 Bacteria 2784
19 Ga0070674_100126772 3300005356 Bacteria 1897
20 Ga0070659_100058474 3300005366 Bacteria 3043
21 Ga0070659_100171022 3300005366 Bacteria 1780
22 Ga0070659_100259197 3300005366 Bacteria 1442
23 Ga0070667_100101821 3300005367 Bacteria 2481
24 Ga0070709_10000376 3300005434 Bacteria 27515
25 Ga0070714_100071962 3300005435 Bacteria 2991
26 Ga0070713_100093072 3300005436 Bacteria 2597
27 Ga0070710_10000497 3300005437 Bacteria 18490
28 Ga0070710_10011859 3300005437 Bacteria 4316
29 Ga0070710_10093308 3300005437 Bacteria 1779
30 Ga0070711_100023752 3300005439 Bacteria 3992
31 Ga0070711_100028927 3300005439 Bacteria 3651
32 Ga0070711_100031162 3300005439 Bacteria 3537
33 Ga0070711_100057504 3300005439 Bacteria 2693
34 Ga0070663_100014414 3300005455 Bacteria 5073
35 Ga0070663_100034654 3300005455 Bacteria 3497
36 Ga0070678_100081258 3300005456 Bacteria 2456
37 Ga0070662_100223020 3300005457 Bacteria 1505
38 Ga0070681_10042647 3300005458 Bacteria 4546
39 Ga0070698_100065850 3300005471 Bacteria 3648
40 Ga0070679_100022990 3300005530 Bacteria 6097
41 Ga0070679_100040520 3300005530 Bacteria 4634
42 Ga0070679_100046635 3300005530 Bacteria 4319
43 Ga0070684_100090204 3300005535 Bacteria 2725
44 Ga0068853_100016983 3300005539 Bacteria 6000
45 Ga0068855_100053112 3300005563 Bacteria 4768
46 Ga0068855_100094442 3300005563 Bacteria 3448
47 Ga0068855_100291560 3300005563 Bacteria 1809
48 Ga0068857_100014724 3300005577 Bacteria 6824
49 Ga0068857_100023313 3300005577 Bacteria 5447
50 Ga0068854_100003845 3300005578 Bacteria 9407
51 Ga0068854_100036066 3300005578 Bacteria 3465
52 Ga0068856_100000061 3300005614 Bacteria 100823
53 Ga0068856_100005538 3300005614 Bacteria 12434
54 Ga0068856_100011815 3300005614 Bacteria 8463
55 Ga0068856_100050178 3300005614 Bacteria 4113
56 Ga0068852_100002580 3300005616 Bacteria 12500
57 Ga0068852_100016848 3300005616 Bacteria 5713
58 Ga0068852_100049351 3300005616 Bacteria 3600
59 Ga0068852_100090084 3300005616 Bacteria 2743
60 Ga0068859_100147849 3300005617 Bacteria 2425
61 Ga0068861_100179594 3300005719 Bacteria 1761
62 Ga0068851_10006584 3300005834 Bacteria 5310
63 Ga0068863_100033056 3300005841 Bacteria 4928
64 Ga0068860_100001652 3300005843 Bacteria 23863
65 Ga0068862_100080072 3300005844 Bacteria 2832
66 Ga0081455_10000577 3300005937 Bacteria 47777
67 Ga0081455_10001359 3300005937 Bacteria 30249
68 Ga0081455_10006207 3300005937 Bacteria 12886
69 Ga0081455_10043382 3300005937 Bacteria 3934
70 Ga0081455_10075981 3300005937 Bacteria 2769
71 Ga0081540_1000575 3300005983 Bacteria 35551
72 Ga0081540_1006111 3300005983 Bacteria 8845
73 Ga0081540_1006404 3300005983 Bacteria 8580
74 Ga0081540_1011696 3300005983 Bacteria 5843
75 Ga0081540_1012437 3300005983 Bacteria 5604
76 Ga0081540_1017871 3300005983 Bacteria 4373
77 Ga0081540_1035952 3300005983 Bacteria 2649
78 Ga0081539_10000113 3300005985 Bacteria 189418
79 Ga0081539_10000341 3300005985 Bacteria 103044
80 Ga0081539_10087132 3300005985 Bacteria 1623
81 Ga0070717_10051048 3300006028 Bacteria 3402
82 Ga0070717_10163017 3300006028 Bacteria 1935
83 Ga0070717_10287549 3300006028 Bacteria 1459
84 Ga0075365_10032771 3300006038 Bacteria 3344
85 Ga0075365_10119454 3300006038 Bacteria 1817
86 Ga0075365_10128669 3300006038 Bacteria 1751
87 Ga0075363_100082159 3300006048 Bacteria 1763
88 Ga0075364_10028026 3300006051 Bacteria 3603
89 Ga0070716_100045989 3300006173 Bacteria 2454
90 Ga0070712_100003491 3300006175 Bacteria 9671
91 Ga0070712_100093737 3300006175 Bacteria 2205
92 Ga0075367_10001858 3300006178 Bacteria 9326
93 Ga0075367_10019050 3300006178 Bacteria 3799
94 Ga0075369_10007616 3300006186 Bacteria 4136
95 Ga0075369_10022057 3300006186 Bacteria 2624
96 Ga0075370_10037604 3300006353 Bacteria 2722
97 Ga0075431_100212076 3300006847 Bacteria 1978
98 Ga0068865_100201048 3300006881 Bacteria 1547
99 Ga0097620_100147857 3300006931 Bacteria 2425
100 Ga0099825_1026117 3300006941 Bacteria 3158
101 Ga0099824_1005536 3300006942 Bacteria 17739
102 Ga0099824_1015819 3300006942 Bacteria 7020
103 Ga0099794_10010045 3300007265 Bacteria 4007
104 Ga0099794_10058269 3300007265 Bacteria 1872
105 Ga0105240_10013705 3300009093 Bacteria 11109
106 Ga0105240_10016135 3300009093 Bacteria 10123
107 Ga0105240_10022923 3300009093 Bacteria 8271
108 Ga0105240_10084733 3300009093 Bacteria 3885
109 Ga0111539_10091707 3300009094 Bacteria 3569
110 Ga0105245_10141381 3300009098 Bacteria 2267
111 Ga0114129_10052838 3300009147 Bacteria 5701
112 Ga0105241_10001401 3300009174 Bacteria 18447
113 Ga0105241_10054655 3300009174 Bacteria 3057
114 Ga0105242_10088105 3300009176 Bacteria 2607
115 Ga0105248_10223486 3300009177 Bacteria 2120
116 Ga0105237_10008696 3300009545 Bacteria 10967
117 Ga0105237_10025027 3300009545 Bacteria 6106
118 Ga0105237_10058120 3300009545 Bacteria 3871
119 Ga0105237_10070560 3300009545 Bacteria 3490
120 Ga0105237_10233551 3300009545 Bacteria 1840
121 Ga0105238_10006652 3300009551 Bacteria 11526
122 Ga0105238_10011666 3300009551 Bacteria 8855
123 Ga0105238_10051276 3300009551 Bacteria 4151
124 Ga0105238_10071644 3300009551 Bacteria 3463
125 Ga0105249_10107809 3300009553 Bacteria 2629
126 Ga0105239_10034156 3300010375 Bacteria 5583
127 Ga0105239_10040516 3300010375 Bacteria 5104
128 Ga0105239_10054806 3300010375 Bacteria 4374
129 Ga0105239_10058442 3300010375 Bacteria 4232
130 Ga0157370_10188643 3300013104 Bacteria 1914
131 Ga0157369_10003682 3300013105 Bacteria 18215
132 Ga0157369_10004083 3300013105 Bacteria 17280
133 Ga0157378_10009387 3300013297 Bacteria 8523
134 Ga0157372_10043633 3300013307 Bacteria 4965
135 Ga0157372_10177915 3300013307 Bacteria 2462
136 Ga0157375_10011128 3300013308 Bacteria 7934
137 Ga0157380_10013986 3300014326 Bacteria 5861
138 Ga0157376_10008594 3300014969 Bacteria 7379
139 Ga0214544_1000368 3300021320 Bacteria 79177
140 Ga0214542_1002192 3300021321 Bacteria 40482
141 Ga0214545_1000203 3300021324 Bacteria 79176
142 Ga0214543_1000322 3300021327 Bacteria 76376
143 Ga0213876_10000898 3300021384 Bacteria 19843
144 Ga0209563_100727 3300025230 Bacteria 10170
145 Ga0209677_100437 3300025253 Bacteria 24430
146 Ga0209677_104304 3300025253 Bacteria 4170
147 Ga0209148_1000180 3300025254 Bacteria 124830
148 Ga0209233_1004255 3300025261 Bacteria 4900
149 Ga0209455_1007803 3300025272 Bacteria 2979
150 Ga0209564_1001937 3300025295 Bacteria 18414
151 Ga0209758_1000011 3300025297 Bacteria 1049685
152 Ga0209758_1000359 3300025297 Bacteria 81559
153 Ga0209758_1000365 3300025297 Bacteria 80645
154 Ga0209758_1000530 3300025297 Bacteria 60826
155 Ga0209758_1004237 3300025297 Bacteria 12139
156 Ga0209758_1005198 3300025297 Bacteria 10225
157 Ga0209758_1027110 3300025297 Bacteria 2458
158 Ga0209256_1003423 3300025299 Bacteria 11147
159 Ga0207426_1000429 3300025302 Bacteria 68612
160 Ga0207426_1000998 3300025302 Bacteria 27598
161 Ga0207426_1020516 3300025302 Bacteria 2295
162 Ga0209257_1001196 3300025304 Bacteria 32644
163 Ga0207692_10000915 3300025898 Bacteria 10659
164 Ga0207692_10075490 3300025898 Bacteria 1788
165 Ga0207688_10049442 3300025901 Bacteria 2350
166 Ga0207647_10022267 3300025904 Bacteria 4212
167 Ga0207647_10118780 3300025904 Bacteria 1560
168 Ga0207699_10001327 3300025906 Bacteria 11741
169 Ga0207699_10010250 3300025906 Bacteria 4695
170 Ga0207699_10019793 3300025906 Bacteria 3597
171 Ga0207705_10057946 3300025909 Bacteria 2795
172 Ga0207684_10086326 3300025910 Bacteria 2673
173 Ga0207654_10000411 3300025911 Bacteria 24726
174 Ga0207707_10001362 3300025912 Bacteria 22693
175 Ga0207707_10016091 3300025912 Bacteria 6524
176 Ga0207707_10109082 3300025912 Bacteria 2420
177 Ga0207695_10000008 3300025913 Bacteria 1058268
178 Ga0207695_10000424 3300025913 Bacteria 93657
179 Ga0207695_10035687 3300025913 Bacteria 5387
180 Ga0207671_10016997 3300025914 Bacteria 5630
181 Ga0207693_10008179 3300025915 Bacteria 8569
182 Ga0207663_10028587 3300025916 Bacteria 3265
183 Ga0207663_10111602 3300025916 Bacteria 1856
184 Ga0207663_10145865 3300025916 Bacteria 1654
185 Ga0207660_10020110 3300025917 Bacteria 4477
186 Ga0207660_10092897 3300025917 Bacteria 2240
187 Ga0207657_10006063 3300025919 Bacteria 12571
188 Ga0207652_10009418 3300025921 Bacteria 7854
189 Ga0207681_10048754 3300025923 Bacteria 2860
190 Ga0207694_10000347 3300025924 Bacteria 43770
191 Ga0207694_10046201 3300025924 Bacteria 3365
192 Ga0207694_10056360 3300025924 Bacteria 3052
193 Ga0207650_10096336 3300025925 Bacteria 2270
194 Ga0207687_10073302 3300025927 Bacteria 2451
195 Ga0207664_10044500 3300025929 Bacteria 3476
196 Ga0207664_10059216 3300025929 Bacteria 3049
197 Ga0207644_10031587 3300025931 Bacteria 3691
198 Ga0207669_10014040 3300025937 Bacteria 4003
199 Ga0207704_10078578 3300025938 Bacteria 2123
200 Ga0207665_10005475 3300025939 Bacteria 8475
201 Ga0207711_10025944 3300025941 Bacteria 4915
202 Ga0207661_10000647 3300025944 Bacteria 22491
203 Ga0207661_10161451 3300025944 Bacteria 1944
204 Ga0207667_10050734 3300025949 Bacteria 4377
205 Ga0207667_10257860 3300025949 Bacteria 1783
206 Ga0207668_10074081 3300025972 Bacteria 2442
207 Ga0207640_10017736 3300025981 Bacteria 4171
208 Ga0207640_10086180 3300025981 Bacteria 2162
209 Ga0207677_10021930 3300026023 Bacteria 3915
210 Ga0207703_10088661 3300026035 Bacteria 2597
211 Ga0207678_10015346 3300026067 Bacteria 6738
212 Ga0207678_10039799 3300026067 Bacteria 4078
213 Ga0207678_10078914 3300026067 Bacteria 2819
214 Ga0207678_10089106 3300026067 Bacteria 2637
215 Ga0207678_10097100 3300026067 Bacteria 2518
216 Ga0207708_10048033 3300026075 Bacteria 3248
217 Ga0207702_10000002 3300026078 Bacteria 491507
218 Ga0207702_10000243 3300026078 Bacteria 63718
219 Ga0207702_10011407 3300026078 Bacteria 7409
220 Ga0207702_10191830 3300026078 Bacteria 1888
221 Ga0207674_10003854 3300026116 Bacteria 18276
222 Ga0207674_10009561 3300026116 Bacteria 11063
223 Ga0207675_100029871 3300026118 Bacteria 5074
224 Ga0207675_100048223 3300026118 Bacteria 3977
225 Ga0207675_100130941 3300026118 Bacteria 2379
226 Ga0207683_10046044 3300026121 Bacteria 3815
227 Ga0207683_10070990 3300026121 Bacteria 3078
228 Ga0207698_10026014 3300026142 Bacteria 4134
229 Ga0209389_1000001 3300027296 Bacteria 463799
230 Ga0209389_1000134 3300027296 Bacteria 65168
231 Ga0209589_1000014 3300027357 Bacteria 227996
232 Ga0209589_1000033 3300027357 Bacteria 140561
233 Ga0209489_100014 3300027361 Bacteria 227996
234 Ga0209489_100040 3300027361 Bacteria 164986
235 Ga0209489_119453 3300027361 Bacteria 2265
236 Ga0209489_119748 3300027361 Bacteria 2139
237 Ga0209700_100007 3300027363 Bacteria 454608
238 Ga0209700_100024 3300027363 Bacteria 227996
239 Ga0268266_10036645 3300028379 Bacteria 4176
240 Ga0268266_10073800 3300028379 Bacteria 2961
241 Ga0268266_10105326 3300028379 Bacteria 2491
242 Ga0268265_10069583 3300028380 Bacteria 2733
243 Ga0268264_10000048 3300028381 Bacteria 334457
244 Ga0265337_1009505 3300028556 Bacteria 3467
245 Ga0265326_10016163 3300028558 Bacteria 2158
246 Ga0265319_1005194 3300028563 Bacteria 6291
247 Ga0265334_10003849 3300028573 Bacteria 6776
248 Ga0265323_10001021 3300028653 Bacteria 14579
249 Ga0265336_10000397 3300028666 Bacteria 27403
250 Ga0307517_10001507 3300028786 Bacteria 38891
251 Ga0307515_10056013 3300028794 Bacteria 5742
252 Ga0265338_10000034 3300028800 Bacteria 244623
253 Ga0265325_10015311 3300031241 Bacteria 4315
254 Ga0265340_10001084 3300031247 Bacteria 15490
255 Ga0265339_10020405 3300031249 Bacteria 3872
256 Ga0265331_10016991 3300031250 Bacteria 3806
257 Ga0307509_10143252 3300031507 Bacteria 2320
258 Ga0307508_10000249 3300031616 Bacteria 65482
259 Ga0307508_10107568 3300031616 Bacteria 2388
260 Ga0265314_10014031 3300031711 Bacteria 6439
261 Ga0265342_10003896 3300031712 Bacteria 11989
262 Ga0307516_10005695 3300031730 Bacteria 14770
263 Ga0307516_10055077 3300031730 Bacteria 3884
264 Ga0307516_10089715 3300031730 Bacteria 2904
265 Ga0307405_10047565 3300031731 Bacteria 2642
266 Ga0307405_10105036 3300031731 Bacteria 1902
267 Ga0307507_10080724 3300033179 Bacteria 2866
268 Ga0307510_10008055 3300033180 Bacteria 12542
269 Ga0307510_10017631 3300033180 Bacteria 8416
270 Ga0307510_10024060 3300033180 Bacteria 7044
271 Ga0307510_10133015 3300033180 Bacteria 2153
272 Ga0315911_1000002 3300033442 Bacteria 926833
273 Ga0373926_0004912 3300035083 Bacteria 4391
274 Ga0373923_0006495 3300035111 Bacteria 4047
275 Ga0373936_0006011 3300035113 Bacteria 4575
276 Ga0373945_0005674 3300035116 Bacteria 4002
277 Ga0373954_0007067 3300035118 Bacteria 4899
278 Ga0373943_0008537 3300035170 Bacteria 4593
279 Ga0373946_0002265 3300035171 Bacteria 6795
280 Ga0373946_0013981 3300035171 Bacteria 3022
281 Ga0373955_0005896 3300035172 Bacteria 5539
282 Ga0373935_0000681 3300035692 Bacteria 17958
283 Ga0373935_0028648 3300035692 Bacteria 3442
284 Ga0373927_0000985 3300035695 Bacteria 21674
285 Ga0373927_0002439 3300035695 Bacteria 13560
286 Ga0373927_0031836 3300035695 Bacteria 3435
287 Ga0373933_0001176 3300035724 Bacteria 15509
288 Ga0373947_0000118 3300035725 Bacteria 39817
289 Ga0373947_0025523 3300035725 Bacteria 3447
290 Ga0373937_0069070 3300036401 Bacteria 3257
291 Ga0373937_0130575 3300036401 Bacteria 2346
292 Ga0373925_0001151 3300037068 Bacteria 23461
293 Ga0373925_0093688 3300037068 Bacteria 2299
294 Ga0395899_0056072 3300037312 Bacteria 2913
295 Ga0395900_0001529 3300037418 Bacteria 27494
296 Ga0395900_0083776 3300037418 Bacteria 3276
297 Ga0395898_0014173 3300037466 Bacteria 8198
298 Ga0395898_0042524 3300037466 Bacteria 4482
299 Ga0395905_0009682 3300037471 Bacteria 9408
300 Ga0395905_0014127 3300037471 Bacteria 7631
301 Ga0436364_1112623 3300037853 Bacteria 2676
302 Ga0395901_0011625 3300038443 Bacteria 8916
303 Ga0395901_0109013 3300038443 Bacteria 2907
304 Ga0395901_0140309 3300038443 Bacteria 2540
305 Ga0436365_0191965 3300039437 Bacteria 59780
306 Ga0436363_0996694 3300039450 Bacteria 4547
307 Ga0439465_0005851 3300041413 Bacteria 3913
308 Ga0466969_0022064 3300044656 Bacteria 3290
309 Ga0466972_0000200 3300044658 Bacteria 43953
310 Ga0466965_0076660 3300044683 Bacteria 1687
311 Ga0466961_0000050 3300044693 Bacteria 71289
312 Ga0466961_0076880 3300044693 Bacteria 2115
313 Ga0466963_0014914 3300044694 Bacteria 4802
314 Ga0466964_0038812 3300044706 Bacteria 1916
315 Ga0466957_0017874 3300044842 Bacteria 4160
316 Ga0466957_0045999 3300044842 Bacteria 2648
317 Ga0466959_0003216 3300045049 Bacteria 10627
318 Ga0466959_0063305 3300045049 Bacteria 2686
319 Ga0466967_0006745 3300045976 Bacteria 8170
320 Ga0466967_0077106 3300045976 Bacteria 2999
321 Ga0495592_0028302 3300046454 Bacteria 4245
322 Ga0495592_0033732 3300046454 Bacteria 3860
323 Ga0495603_0000053 3300046455 Bacteria 49373
324 Ga0495603_0011237 3300046455 Bacteria 5423
325 Ga0495603_0014491 3300046455 Bacteria 4768
326 Ga0495629_0008916 3300046459 Bacteria 7373
327 Ga0495629_0018227 3300046459 Bacteria 5028
328 Ga0495629_0045223 3300046459 Bacteria 3089
329 Ga0495629_0085573 3300046459 Bacteria 2200
330 Ga0495638_0001532 3300046460 Bacteria 20807
331 Ga0495638_0051184 3300046460 Bacteria 2576
332 Ga0495638_0060740 3300046460 Bacteria 2336
333 Ga0495638_0086418 3300046460 Bacteria 1895
334 Ga0495641_0010050 3300046461 Bacteria 5546
335 Ga0495651_0001520 3300046462 Bacteria 17929
336 Ga0495651_0050024 3300046462 Bacteria 3225
337 Ga0495651_0051215 3300046462 Bacteria 3185
338 Ga0495651_0067192 3300046462 Bacteria 2735
339 Ga0495651_0095975 3300046462 Bacteria 2216
340 Ga0495653_0057882 3300046463 Bacteria 2948
341 Ga0495580_0001877 3300046472 Bacteria 18497
342 Ga0495582_0000186 3300046473 Bacteria 34006
343 Ga0495639_0000078 3300046475 Bacteria 46048
344 Ga0495639_0022927 3300046475 Bacteria 2741
345 Ga0495662_0001326 3300046476 Bacteria 12264
346 Ga0495664_0008167 3300046477 Bacteria 5830
347 Ga0495664_0011159 3300046477 Bacteria 5057
348 Ga0495594_0000103 3300046499 Bacteria 39690
349 Ga0495594_0030010 3300046499 Bacteria 2940
350 Ga0495583_0040787 3300046506 Bacteria 2178
351 Ga0495606_0004866 3300046507 Bacteria 13163
352 Ga0495608_0017545 3300046511 Bacteria 4950
353 Ga0495608_0031044 3300046511 Bacteria 3614
354 Ga0495618_0117514 3300046514 Bacteria 1703
355 Ga0495618_0120901 3300046514 Bacteria 1677
356 Ga0495628_0014211 3300046516 Bacteria 6682
357 Ga0495630_0003505 3300046517 Bacteria 10910
358 Ga0495630_0153994 3300046517 Bacteria 1749
359 Ga0495631_0042068 3300046518 Bacteria 2020
360 Ga0495631_0043587 3300046518 Bacteria 1979
361 Ga0495643_0099939 3300046522 Bacteria 1488
362 Ga0495644_0026973 3300046523 Bacteria 2178
363 Ga0495648_0002554 3300046524 Bacteria 16674
364 Ga0495648_0007789 3300046524 Bacteria 8521
365 Ga0495648_0024700 3300046524 Bacteria 4084
366 Ga0495666_0093854 3300046526 Bacteria 1415
367 Ga0495652_0004137 3300046529 Bacteria 13996
368 Ga0495652_0131261 3300046529 Bacteria 1983
369 Ga0495652_0166790 3300046529 Bacteria 1704
370 Ga0495665_0000190 3300046531 Bacteria 31563
371 Ga0495640_0001905 3300046533 Bacteria 16627
372 Ga0495640_0087702 3300046533 Bacteria 2057
373 Ga0495622_0005230 3300046557 Bacteria 6015
374 Ga0495622_0015848 3300046557 Bacteria 3505
375 Ga0495667_0006001 3300046559 Bacteria 8214
376 Ga0495667_0009435 3300046559 Bacteria 6611
377 Ga0495656_0060531 3300046615 Bacteria 1651
378 Ga0495634_0001169 3300046642 Bacteria 24315
379 Ga0495634_0064194 3300046642 Bacteria 2435
380 Ga0495625_0053578 3300046660 Bacteria 2884
381 Ga0495635_0000211 3300046663 Bacteria 36892
382 Ga0495635_0000985 3300046663 Bacteria 18760
383 Ga0495635_0015479 3300046663 Bacteria 5332
384 Ga0495588_0001447 3300046674 Bacteria 10166
385 Ga0495588_0033733 3300046674 Bacteria 2586
386 Ga0495588_0054544 3300046674 Bacteria 2062
387 Ga0495657_0000889 3300046675 Bacteria 26346
388 Ga0495657_0013750 3300046675 Bacteria 5959
389 Ga0495599_0000957 3300046678 Bacteria 16146
390 Ga0495599_0083621 3300046678 Bacteria 1993
391 Ga0495623_0005834 3300046679 Bacteria 8030
392 Ga0495623_0005846 3300046679 Bacteria 8019
393 Ga0495646_0022073 3300046680 Bacteria 4018
394 Ga0495647_0028522 3300046681 Bacteria 2058
395 Ga0495658_0000108 3300046683 Bacteria 43771
396 Ga0495658_0013308 3300046683 Bacteria 4186
397 Ga0495669_0001878 3300046684 Bacteria 8615
398 Ga0495613_0010887 3300046689 Bacteria 6750
399 Ga0495613_0105927 3300046689 Bacteria 2029
400 Ga0495624_0003469 3300046690 Bacteria 11689
401 Ga0495600_0001856 3300046809 Bacteria 11854
402 Ga0495600_0009971 3300046809 Bacteria 5886
403 Ga0495600_0036170 3300046809 Bacteria 3208
404 Ga0495581_0000501 3300047315 Bacteria 20012
405 Ga0495581_0013051 3300047315 Bacteria 4815
406 Ga0495581_0127441 3300047315 Bacteria 1482
407 Ga0495604_0015222 3300047317 Bacteria 6139
408 Ga0495604_0025993 3300047317 Bacteria 4662
409 Ga0495674_0000228 3300047319 Bacteria 46998
410 Ga0495674_0008379 3300047319 Bacteria 9850
411 Ga0495674_0070755 3300047319 Bacteria 3014
412 Ga0495672_0011909 3300047320 Bacteria 6101
413 Ga0495676_0152454 3300047321 Bacteria 1643
414 Ga0495680_0002530 3300047322 Bacteria 18695
415 Ga0495673_0012247 3300047469 Bacteria 4561
416 Ga0495684_0018149 3300047471 Bacteria 5422
417 Ga0495684_0143545 3300047471 Bacteria 1789
418 Ga0495686_0008845 3300047472 Bacteria 7331
419 Ga0495593_0002763 3300047673 Bacteria 10557
420 Ga0495593_0056534 3300047673 Bacteria 2062
421 Ga0495593_0084435 3300047673 Bacteria 1639
422 Ga0495602_0003401 3300048088 Bacteria 16456
423 Ga0496100_0041350 3300048903 Bacteria 2938
424 Ga0496101_0039152 3300048904 Bacteria 3370
425 Ga0496101_0081029 3300048904 Bacteria 2399
426 Ga0496102_0008501 3300048905 Bacteria 8801
427 Ga0496103_0016380 3300048906 Bacteria 4423
428 Ga0496103_0157513 3300048906 Bacteria 1456
429 Ga0496104_0000281 3300048907 Bacteria 45166
430 Ga0496104_0005754 3300048907 Bacteria 10852
431 Ga0496104_0008421 3300048907 Bacteria 9169
432 Ga0496104_0025549 3300048907 Bacteria 5446
433 Ga0496105_0011220 3300048908 Bacteria 7069
434 Ga0496105_0043844 3300048908 Bacteria 3689
435 Ga0496106_0005076 3300048909 Bacteria 9744
436 Ga0496106_0131349 3300048909 Bacteria 1964
437 Ga0496107_0070819 3300048910 Bacteria 2533
438 Ga0496108_0000845 3300048911 Bacteria 23854
439 Ga0496109_0000592 3300048912 Bacteria 30336
440 Ga0496109_0298042 3300048912 Bacteria 1520
441 Ga0496110_0011293 3300048913 Bacteria 7302
442 Ga0496110_0023231 3300048913 Bacteria 5272
443 Ga0496110_0245293 3300048913 Bacteria 1630
444 Ga0496111_0031284 3300048914 Bacteria 3791
445 Ga0496112_0000017 3300048915 Bacteria 191284
446 Ga0496112_0001178 3300048915 Bacteria 19598
447 Ga0496112_0079384 3300048915 Bacteria 3246
448 Ga0496113_0011677 3300048916 Bacteria 5875
449 Ga0496113_0053320 3300048916 Bacteria 3024
450 Ga0496115_0022242 3300048918 Bacteria 4910
451 Ga0496116_0022752 3300048919 Bacteria 4687
452 Ga0496116_0054476 3300048919 Bacteria 2635
453 Ga0496116_0130238 3300048919 Bacteria 1436
454 Ga0496117_0132713 3300048920 Bacteria 1506
455 Ga0496118_0003113 3300048921 Bacteria 21268
456 Ga0496118_0053861 3300048921 Bacteria 3052
457 Ga0496118_0126482 3300048921 Bacteria 1652
458 Ga0496119_0005325 3300048922 Bacteria 12378
459 Ga0496119_0049769 3300048922 Bacteria 2588
460 Ga0496120_0001511 3300048923 Bacteria 27505
461 Ga0496120_0055680 3300048923 Bacteria 2235
462 Ga0496121_0000886 3300048924 Bacteria 54049
463 Ga0496121_0002017 3300048924 Bacteria 32207
464 Ga0496121_0002694 3300048924 Bacteria 26563
465 Ga0496121_0013709 3300048924 Bacteria 8688
466 Ga0496121_0017276 3300048924 Bacteria 7381
467 Ga0496121_0026234 3300048924 Bacteria 5498
468 Ga0496121_0041651 3300048924 Bacteria 4011
469 Ga0496121_0042521 3300048924 Bacteria 3950
470 Ga0496121_0056125 3300048924 Bacteria 3274
471 Ga0496121_0081237 3300048924 Bacteria 2566
472 Ga0496122_0014132 3300048925 Bacteria 7742
473 Ga0496122_0079207 3300048925 Bacteria 2297
474 Ga0496123_0068394 3300048926 Bacteria 2237
475 Ga0496124_0096800 3300048927 Bacteria 2397
476 Ga0496125_0000040 3300048928 Bacteria 314478
477 Ga0496125_0002027 3300048928 Bacteria 27438
478 Ga0496125_0005006 3300048928 Bacteria 14960
479 Ga0496125_0054179 3300048928 Bacteria 3280
480 Ga0496126_0008257 3300048929 Bacteria 11246
481 Ga0496126_0017486 3300048929 Bacteria 7141
482 Ga0496126_0025006 3300048929 Bacteria 5755
483 Ga0496126_0028691 3300048929 Bacteria 5299
484 Ga0496126_0046030 3300048929 Bacteria 4006
485 Ga0496126_0058006 3300048929 Bacteria 3491
486 Ga0496126_0062123 3300048929 Bacteria 3353
487 Ga0496126_0121969 3300048929 Bacteria 2259
488 Ga0496126_0205544 3300048929 Bacteria 1660
489 Ga0501031_0010139 3300049568 Bacteria 6140
490 Ga0501032_0007050 3300049569 Bacteria 8245
491 Ga0501032_0027533 3300049569 Bacteria 3906
492 Ga0501032_0113009 3300049569 Bacteria 1796
493 Ga0501032_0123021 3300049569 Bacteria 1714
494 Ga0501033_0000250 3300049570 Bacteria 51978
495 Ga0501033_0000553 3300049570 Bacteria 34827
496 Ga0501033_0050247 3300049570 Bacteria 3094
497 Ga0501034_0000892 3300049571 Bacteria 43725
498 Ga0501036_0000267 3300049572 Bacteria 35613
499 Ga0501036_0016285 3300049572 Bacteria 6211
500 Ga0501036_0065694 3300049572 Bacteria 3069
501 Ga0501037_0000257 3300049573 Bacteria 45676
502 Ga0501037_0006617 3300049573 Bacteria 8472
503 Ga0501038_0001535 3300049574 Bacteria 21306
504 Ga0501038_0004912 3300049574 Bacteria 12421
505 Ga0501038_0014599 3300049574 Bacteria 7158
506 Ga0501038_0059534 3300049574 Bacteria 3271
507 Ga0501039_0000488 3300049575 Bacteria 28748
508 Ga0501039_0002930 3300049575 Bacteria 12771
509 Ga0501042_0021357 3300049578 Bacteria 4511
510 Ga0501042_0025726 3300049578 Bacteria 4135
511 Ga0501043_0001660 3300049579 Bacteria 19307
512 Ga0501043_0003909 3300049579 Bacteria 12219
513 Ga0501043_0005331 3300049579 Bacteria 10393
514 Ga0501043_0006924 3300049579 Bacteria 9041
515 Ga0501043_0101724 3300049579 Bacteria 2258
516 Ga0501046_0006487 3300049580 Bacteria 10349
517 Ga0501046_0024923 3300049580 Bacteria 4900
518 Ga0501046_0039030 3300049580 Bacteria 3806
519 Ga0501046_0081404 3300049580 Bacteria 2500
520 Ga0501047_0000123 3300049581 Bacteria 95016
521 Ga0501047_0019457 3300049581 Bacteria 6512
522 Ga0501048_0000108 3300049582 Bacteria 46455
523 Ga0501048_0092763 3300049582 Bacteria 2130
524 Ga0501067_0000267 3300049583 Bacteria 28494
525 Ga0501068_0007488 3300049584 Bacteria 6042
526 Ga0501068_0112976 3300049584 Bacteria 1690
527 Ga0501069_0002404 3300049585 Bacteria 9510
528 Ga0501069_0075288 3300049585 Bacteria 1896
529 Ga0501070_0016149 3300049586 Bacteria 6275
530 Ga0501070_0024041 3300049586 Bacteria 5109
531 Ga0501071_0041215 3300049587 Bacteria 3307
532 Ga0501072_0000898 3300049588 Bacteria 21826
533 Ga0501073_0000014 3300049589 Bacteria 159719
534 Ga0501073_0008879 3300049589 Bacteria 7430
535 Ga0501074_0009185 3300049590 Bacteria 7181
536 Ga0501076_0165258 3300049592 Bacteria 1804
537 Ga0501080_0018899 3300049742 Bacteria 6381
538 Ga0501080_0031341 3300049742 Bacteria 4954
539 Ga0501080_0204945 3300049742 Bacteria 1809
540 Ga0501083_0000289 3300049744 Bacteria 31855
541 Ga0501083_0018277 3300049744 Bacteria 4886
542 Ga0501035_0000608 3300049822 Bacteria 39520
543 Ga0501035_0115601 3300049822 Bacteria 2348
544 Ga0501035_0143976 3300049822 Bacteria 2071
545 Ga0501044_0000344 3300049823 Bacteria 58547
546 Ga0501044_0070406 3300049823 Bacteria 3557
547 Ga0501044_0146266 3300049823 Bacteria 2348
548 Ga0501045_0005228 3300049824 Bacteria 8978
549 nmdc:mga06z11_1297_c1 3300050494 Bacteria 9247
550 nmdc:mga06z11_53375_c1 3300050494 Bacteria 2079
551 nmdc:mga05p37_52659_c1 3300050507 Bacteria 5004
552 nmdc:mga08y16_65892_c1 3300050511 Bacteria 3780
553 nmdc:mga0rr50_165411_c1 3300050513 Bacteria 1798
554 nmdc:mga0sz30_43742_c1 3300050516 Bacteria 1886
555 Ga0495612_0023374 3300053078 Bacteria 2480
556 Ga0500635_0003054 3300053080 Bacteria 4182
557 Ga0495595_0079663 3300053084 Bacteria 1558
558 Ga0495619_0014968 3300053085 Bacteria 4901
559 Ga0495619_0061030 3300053085 Bacteria 2507
560 Ga0500643_000319 3300053087 Bacteria 38698
561 Ga0500646_0007605 3300053090 Bacteria 2769
562 Ga0500583_0026742 3300053092 Bacteria 2482
563 Ga0500651_0001711 3300053093 Bacteria 11216
564 Ga0500566_0000117 3300053094 Bacteria 41371
565 Ga0500566_0001715 3300053094 Bacteria 12869
566 Ga0500640_000141 3300053095 Bacteria 13874
567 Ga0500641_0059093 3300053096 Bacteria 1593
568 Ga0500641_0067055 3300053096 Bacteria 1503
569 Ga0500554_000617 3300053102 Bacteria 7222
570 Ga0500555_003231 3300053103 Bacteria 4642
571 Ga0500556_0000002 3300053104 Bacteria 773626
572 Ga0500556_0009163 3300053104 Bacteria 2870
573 Ga0500557_000162 3300053105 Bacteria 14804
574 Ga0500572_000828 3300053111 Bacteria 9757
575 Ga0500572_001082 3300053111 Bacteria 8023
576 Ga0500592_007011 3300053116 Bacteria 1792
577 Ga0500595_001406 3300053119 Bacteria 12911
578 Ga0500595_001750 3300053119 Bacteria 11313
579 Ga0500595_023301 3300053119 Bacteria 2178
580 Ga0500608_043407 3300053122 Bacteria 2159
581 Ga0500614_000264 3300053123 Bacteria 13542
582 Ga0500618_003608 3300053125 Bacteria 5251
583 Ga0500642_0000057 3300053130 Bacteria 67011
584 Ga0500642_0000876 3300053130 Bacteria 8748
585 Ga0500652_000965 3300053131 Bacteria 9504
586 Ga0500658_0035161 3300053134 Bacteria 1981
587 Ga0500559_0000242 3300053136 Bacteria 43285
588 Ga0500559_0002978 3300053136 Bacteria 8498
589 Ga0500559_0012427 3300053136 Bacteria 3618
590 Ga0500568_0001500 3300053139 Bacteria 14911
591 Ga0500568_0013309 3300053139 Bacteria 3752
592 Ga0500568_0024271 3300053139 Bacteria 2569
593 Ga0500577_0000095 3300053142 Bacteria 21049
594 Ga0500590_035432 3300053148 Bacteria 2583
595 Ga0500603_000306 3300053150 Bacteria 12834
596 Ga0500603_000586 3300053150 Bacteria 9099
597 Ga0500604_0003637 3300053151 Bacteria 4145
598 Ga0500616_0000031 3300053153 Bacteria 415013
599 Ga0500616_0000034 3300053153 Bacteria 396651
600 Ga0500622_0005168 3300053156 Bacteria 7911
601 Ga0500622_0042459 3300053156 Bacteria 2362
602 Ga0500630_000221 3300053159 Bacteria 22394
603 Ga0500639_000041 3300053163 Bacteria 61893
604 Ga0500636_0000614 3300053177 Bacteria 19317
605 Ga0500636_0082173 3300053177 Bacteria 1854
606 Ga0500637_0000282 3300053178 Bacteria 18981
607 Ga0500637_0076481 3300053178 Bacteria 1930
608 Ga0500570_065323 3300053724 Bacteria 1734
609 Ga0500576_041784 3300053725 Bacteria 2061
610 Ga0500625_001494 3300053729 Bacteria 8078
611 Ga0500645_006818 3300053730 Bacteria 4037
612 Ga0500645_019623 3300053730 Bacteria 2101
613 Ga0500609_004321 3300053731 Bacteria 1970
614 Ga0500596_001100 3300053735 Bacteria 5443
615 Ga0500599_000137 3300053736 Bacteria 6696
616 Ga0500601_000052 3300053737 Bacteria 24522
617 Ga0500601_002092 3300053737 Bacteria 2141
618 Ga0501084_0001855 3300054114 Bacteria 16855
619 Ga0500661_000108 3300055283 Bacteria 13387
620 Ga0501082_0006680 3300060353 Bacteria 9981
621 Ga0501082_0085494 3300060353 Bacteria 2720
622 Ga0466962_0038186 3300061719 Bacteria 2300
623 2507507751 2507262055 Bacteria 8048963
624 2508541875 2508501009 Bacteria 7784016
625 2508692582 2508501042 Bacteria 8719808
626 2509149397 2508501128 Bacteria 8613869
627 2511398956 2511231028 Bacteria 8046582
628 2513622962 2513237092 Bacteria 8341956
629 2513642879 2513237094 Bacteria 8789602
630 2513647421 2513237095 Bacteria 8976980
631 2513653981 2513237096 Bacteria 8722461
632 2513676254 2513237098 Bacteria 9902361
633 2513695806 2513237101 Bacteria 7952346
634 2513699540 2513237102 Bacteria 7703324
635 2513719389 2513237104 Bacteria 10034502
636 2513856417 2513237137 Bacteria 9558895
637 2513878428 2513237139 Bacteria 8737671
638 2513891366 2513237141 Bacteria 8496279
639 2513918321 2513237145 Bacteria 8979722
640 2514009525 2513237161 Bacteria 8871253
641 2515625991 2515154112 Bacteria 8294334
642 2517104059 2517093001 Bacteria 9002274
643 2517891449 2517572143 Bacteria 9484767
644 2524436380 2524023205 Bacteria 8918781
645 2524470290 2524023210 Bacteria 9029266
646 2524538377 2524023228 Bacteria 10118060
647 2528849082 2528768022 Bacteria 10457665
648 2603861427 2602042107 Bacteria 6226103
649 2617346706 2617270735 Bacteria 9163226
650 2617372634 2617270741 Bacteria 8201522
651 2644291394 2643221651 Bacteria 4798932
652 2671118786 2667528175 Bacteria 7532676
653 2723847271 2721755755 Bacteria 8322773
654 2728750143 2728368998 Bacteria 8720350
655 2745080666 2744054633 Bacteria 8678936
656 2793064446 2791355196 Bacteria 7323613
657 2793066813 2791355197 Bacteria 8420563
658 2793084138
659 2805919149 2802429603 Bacteria 8777136
660 2818236457 2816332527 Bacteria 8933356
661 2824608238 2824600985 Bacteria 8488197
662 2824612960 2824609381 Bacteria 8672835
663 2824621915 2824617872 Bacteria 8814715
664 2824631617 2824626560 Bacteria 8813858
665 2824643956 2824635225 Bacteria 8785348
666 2824652921 2824644064 Bacteria 8743947
667 2824661363 2824653114 Bacteria 8493680
668 2824671226 2824661429 Bacteria 9877870
669 2824679504 2824671348 Bacteria 8369588
670 2824687787 2824679649 Bacteria 8248951
671 2824695855 2824687955 Bacteria 8360029
672 2824701773 2824696289 Bacteria 8335049
673 2824714581 2824704595 Bacteria 9667483
674 2824723674 2824714736 Bacteria 8717648
675 2824732780 2824723954 Bacteria 8758240
676 2824749796 2824746037 Bacteria 7911610
677 2824762400 2824753945 Bacteria 9787441
678 2824772694 2824763712 Bacteria 9792355
679 2824775221 2824773399 Bacteria 8360218
680 2838128893 2838122688 Bacteria 8803140
681 2841944960 2841941048 Bacteria 8688029
682 2841953383 2841949485 Bacteria 8680857
683 2841959789 2841957949 Bacteria 8652217
684 2841972145 2841966195 Bacteria 8673214
685 2841978109 2841974524 Bacteria 8931498
686 2841986268 2841983080 Bacteria 8395090
687 2842040557 2842038055 Bacteria 8002051
688 2842046497 2842045827 Bacteria 8006841
689 2844319923 2844315083 Bacteria 8138177
690 2847937232 2847930680 Bacteria 9342022
691 2847947646 2847939898 Bacteria 8606328
692 2849078499 2849076700 Bacteria 7039503
693 2857512858 2857509624 Bacteria 7472071
694 2857530202 2857524615 Bacteria 6615449
695 2874598860 2874590934 Bacteria 8299676
696 2874607290 2874604998 Bacteria 7834745
697 2874614670 2874612657 Bacteria 8252029
698 2874627984 2874620515 Bacteria 8290088
699 2874635127 2874628541 Bacteria 8630250
700 2874652316 2874645413 Bacteria 8214782
701 2876766189 2876761206 Bacteria 10111113
702 2876778899 2876771140 Bacteria 8287509
703 2876814526 2876808645 Bacteria 8824342
704 2876824206 2876818435 Bacteria 8274608
705 2879082692 2879074833 Bacteria 8279565
706 2879088459 2879083081 Bacteria 8587928
707 2879107039 2879099564 Bacteria 10442239
708 2879114622 2879110137 Bacteria 8907982
709 2879132147 2879127579 Bacteria 8294491
710 2879148326 2879142872 Bacteria 8267021
711 2881371551 2881364244 Bacteria 7710352
712 2881671847 2881665667 Bacteria 8175609
713 2885369878 2885366525 Bacteria 8326213
714 2885378295 2885374607 Bacteria 8927485
715 2885388296 2885383462 Bacteria 9473874
716 2885412285 2885409591 Bacteria 9235467
717 2888385356 2888378607 Bacteria 9652610
718 2888392894 2888388044 Bacteria 7304136
719 2888425494 2888419890 Bacteria 7857137
720 2889038115 2889033259 Bacteria 9099371
721 2893066092 2893066018 Bacteria 6158120
722 2903730404 2903727486 Bacteria 8281579
723 2903749032 2903748898 Bacteria 9972761
724 2903775891 2903768456 Bacteria 9749579
725 2904674398 2904666416 Bacteria 8226587
726 2904691292 2904690495 Bacteria 9412302
727 2904704887
728 2904712077 2904711408 Bacteria 9771557
729 2906604663 2906602504 Bacteria 8295279
730 2906616621
731 2906627439 2906626472 Bacteria 8826946
732 2906635405 2906635258 Bacteria 8601019
733 2906649357 2906643746 Bacteria 8722424
734 2906666951 2906660503 Bacteria 8595048
735 2908741788 2908739725 Bacteria 8628932
736 2908759067 2908756301 Bacteria 8864324
737 2908781080 2908775508 Bacteria 8092255
738 2919079527 2919073203 Bacteria 6531949
739 2922368583 2922361189 Bacteria 7436256
740 2922372508
741 2922387444 2922386360 Bacteria 7017218
742 2922397161 2922393267 Bacteria 8285685
743 2922431358
744 2929620928 2929615660 Bacteria 9193770
745 2929626241 2929624759 Bacteria 9339455
746 2932784880 2932784394 Bacteria 9704911
747 2932795247 2932794094 Bacteria 7915132
748 2932805778 2932801729 Bacteria 7987968
749 2932809914 2932809354 Bacteria 9135765
750 2932818343 2932818245 Bacteria 9955613
751 2932828717 2932828146 Bacteria 9745859
752 2933583202 2933577622 Bacteria 9116884
753 2935609736 2935608549 Bacteria 8203142
754 2935619863 2935616580 Bacteria 9032984
755 2935633954 2935630451 Bacteria 8169952
756 2935638845 2935638405 Bacteria 10015038
757 2935654217 2935648319 Bacteria 8801166
758 2935663090 2935656913 Bacteria 8965014
759 2935666305 2935665750 Bacteria 9571747
760 2935676651 2935675223 Bacteria 9928132
761 2935685033 2935684952 Bacteria 9590419
762 2935694729 2935694250 Bacteria 9291695
763 2935703850 2935703347 Bacteria 10242284
764 2935713586 2935713505 Bacteria 9608509
765 2935724206 2935722832 Bacteria 9608746
766 2935733436 2935732158 Bacteria 9706831
767 2935742815 2935741537 Bacteria 9707219
768 2935750998 2935750917 Bacteria 9590372
769 2935760473 2935760218 Bacteria 9817913
770 2935772036 2935769743 Bacteria 7878163
771 2935784211 2935777560 Bacteria 8077691
772 2935787576 2935785616 Bacteria 7962367
773 2935796208 2935793552 Bacteria 8012592
774 2935801987 2935801545 Bacteria 9301974
775 2935810756 2935810662 Bacteria 9401221
776 2935822898 2935819856 Bacteria 8261050
777 2935828339 2935827899 Bacteria 10038562
778 2935839754 2935837841 Bacteria 9454360
779 2935848480 2935847175 Bacteria 8228321
780 2935857822 2935855204 Bacteria 9035059
781 2935868836 2935864058 Bacteria 9784707
782 2935874251 2935873716 Bacteria 9632195
783 2935883852 2935883170 Bacteria 7964738
784 2935909715 2935908558 Bacteria 8568796
785 2935917439 2935916978 Bacteria 9113783
786 2935927196 2935926038 Bacteria 8601059
787 2935936960 2935934488 Bacteria 8602579
788 2935944737 2935942939 Bacteria 8599779
789 2935953174 2935951376 Bacteria 8602333
790 2935961317 2935959822 Bacteria 7869783
791 2935970014 2935967501 Bacteria 8603075
792 2935980299 2935975950 Bacteria 8347125
793 2935986936 2935984226 Bacteria 8302647
794 2935992824 2935992306 Bacteria 9802711
795 2936002737 2936002035 Bacteria 9362176
796 2936017246 2936011229 Bacteria 8801034
797 2936025748 2936019824 Bacteria 8804134
798 2936034597 2936028420 Bacteria 8965941
799 2936037824 2936037263 Bacteria 9446081
800 2936052654 2936046547 Bacteria 8903709
801 2936062063 2936055302 Bacteria 8785755
802 2940558199 2940556831 Bacteria 9590747
803 2941510743 2941507105 Bacteria 8166816
804 2941518127 2941515067 Bacteria 8166720
805 2941527002 2941523033 Bacteria 8169134
806 2941531107 2941531003 Bacteria 7653939
807 2941540905 2941538514 Bacteria 9402094
808 3005481149 3005474847 Bacteria 9259049
809 3005484887 3005483717 Bacteria 7877331
810 3005508515 3005506211 Bacteria 6943378
811 3005587166 3005587118 Bacteria 7794411
812 3005600202 3005594810 Bacteria 8716512
813 3005715714 3005710791 Bacteria 7622528
814 3005723062 3005718088 Bacteria 8283608
815 8006930885 8006926726 Bacteria 6749210
816 8006939558 8006933436 Bacteria 10410654
817 8006968366 8006964411 Bacteria 8966052
818 8006979309 8006973647 Bacteria 10679141
819 8006989202 8006984368 Bacteria 9651211
820 8006994814 8006994254 Bacteria 8309700
821 8016528792 8016522445 Bacteria 8156687
822 8016547201 8016539877 Bacteria 8155419
823 8016554928 8016548790 Bacteria 8155074
824 8016563295 8016557553 Bacteria 8154380
825 8016576497 8016575299 Bacteria 8154085
826 8016594204 8016583857 Bacteria 10421953
827 8016601047 8016595262 Bacteria 8149947
828 8016615502 8016613128 Bacteria 8794220
829 8016625720 8016622563 Bacteria 7999408
830 8016639281 8016630954 Bacteria 9217207
831 8017064825 8017057580 Bacteria 10023680
832 8019533746 8019530166 Bacteria 8155624
833 8019545922 8019538911 Bacteria 7872763
834 8019552805 8019547302 Bacteria 7996444
835 8019565451 8019555841 Bacteria 9642137
836 8019575543 8019565922 Bacteria 9639779
837 8019599328 8019597564 Bacteria 10041141
838 8019609030 8019608314 Bacteria 10042931
839 8019619718 8019619141 Bacteria 9218857
840 8019633397 8019629233 Bacteria 8687553
841 8019649249 8019648815 Bacteria 10014479
842 8019661281 8019659431 Bacteria 8577854
843 8019670822 8019668869 Bacteria 8791617
844 8019685377 8019678201 Bacteria 8863603
845 8019690969 8019687851 Bacteria 8712826
846 8055745209 8055742211 Bacteria 9226248
847 8056681014 8056673599 Bacteria 7871253
848 8056684905 8056681323 Bacteria 8472857
849 8056693412 8056689827 Bacteria 6712655
850 8056975171 8056967851 Bacteria 9038162
851 Ga0500586_019666
852 JGI25406J46586_10000034
853 JGI25406J46586_10003494
854 JGI25153J46596_10006205
855 JGI25153J46596_10008275
856 JGI25160J50197_1004954
857 JGI25404J52841_10006160
858 Ga0055543_1003802
859 Ga0065165_1002181
860 Ga0065165_1002644
861 Ga0065165_1013018
862 Ga0070658_10077056
863 Ga0070683_100016132
864 Ga0070680_100016901
865 Ga0070680_100027944
866 Ga0070682_100024159
867 Ga0068868_100016332
868 Ga0070674_100053656
869 Ga0070674_100126772
870 Ga0070659_100058474
871 Ga0070659_100171022
872 Ga0070659_100259197
873 Ga0070667_100101821
874 Ga0070709_10000376
875 Ga0070714_100071962
876 Ga0070713_100093072
877 Ga0070710_10000497
878 Ga0070710_10011859
879 Ga0070710_10093308
880 Ga0070711_100023752
881 Ga0070711_100028927
882 Ga0070711_100031162
883 Ga0070711_100057504
884 Ga0070663_100014414
885 Ga0070663_100034654
886 Ga0070678_100081258
887 Ga0070662_100223020
888 Ga0070681_10042647
889 Ga0070698_100065850
890 Ga0070679_100022990
891 Ga0070679_100040520
892 Ga0070679_100046635
893 Ga0070684_100090204
894 Ga0068853_100016983
895 Ga0068855_100053112
896 Ga0068855_100094442
897 Ga0068855_100291560
898 Ga0068857_100014724
899 Ga0068857_100023313
900 Ga0068854_100003845
901 Ga0068854_100036066
902 Ga0068856_100000061
903 Ga0068856_100005538
904 Ga0068856_100011815
905 Ga0068856_100050178
906 Ga0068852_100002580
907 Ga0068852_100016848
908 Ga0068852_100049351
909 Ga0068852_100090084
910 Ga0068859_100147849
911 Ga0068861_100179594
912 Ga0068851_10006584
913 Ga0068863_100033056
914 Ga0068860_100001652
915 Ga0068862_100080072
916 Ga0081455_10000577
917 Ga0081455_10001359
918 Ga0081455_10006207
919 Ga0081455_10043382
920 Ga0081455_10075981
921 Ga0081540_1000575
922 Ga0081540_1006111
923 Ga0081540_1006404
924 Ga0081540_1011696
925 Ga0081540_1012437
926 Ga0081540_1017871
927 Ga0081540_1035952
928 Ga0081539_10000113
929 Ga0081539_10000341
930 Ga0081539_10087132
931 Ga0070717_10051048
932 Ga0070717_10163017
933 Ga0070717_10287549
934 Ga0075365_10032771
935 Ga0075365_10119454
936 Ga0075365_10128669
937 Ga0075363_100082159
938 Ga0075364_10028026
939 Ga0070716_100045989
940 Ga0070712_100003491
941 Ga0070712_100093737
942 Ga0075367_10001858
943 Ga0075367_10019050
944 Ga0075369_10007616
945 Ga0075369_10022057
946 Ga0075370_10037604
947 Ga0075431_100212076
948 Ga0068865_100201048
949 Ga0097620_100147857
950 Ga0099825_1026117
951 Ga0099824_1005536
952 Ga0099824_1015819
953 Ga0099794_10010045
954 Ga0099794_10058269
955 Ga0105240_10013705
956 Ga0105240_10016135
957 Ga0105240_10022923
958 Ga0105240_10084733
959 Ga0111539_10091707
960 Ga0105245_10141381
961 Ga0114129_10052838
962 Ga0105241_10001401
963 Ga0105241_10054655
964 Ga0105242_10088105
965 Ga0105248_10223486
966 Ga0105237_10008696
967 Ga0105237_10025027
968 Ga0105237_10058120
969 Ga0105237_10070560
970 Ga0105237_10233551
971 Ga0105238_10006652
972 Ga0105238_10011666
973 Ga0105238_10051276
974 Ga0105238_10071644
975 Ga0105249_10107809
976 Ga0105239_10034156
977 Ga0105239_10040516
978 Ga0105239_10054806
979 Ga0105239_10058442
980 Ga0157370_10188643
981 Ga0157369_10003682
982 Ga0157369_10004083
983 Ga0157378_10009387
984 Ga0157372_10043633
985 Ga0157372_10177915
986 Ga0157375_10011128
987 Ga0157380_10013986
988 Ga0157376_10008594
989 Ga0214544_1000368
990 Ga0214542_1002192
991 Ga0214545_1000203
992 Ga0214543_1000322
993 Ga0213876_10000898
994 Ga0209563_100727
995 Ga0209677_100437
996 Ga0209677_104304
997 Ga0209148_1000180
998 Ga0209233_1004255
999 Ga0209455_1007803
1000 Ga0209564_1001937
1001 Ga0209758_1000011
1002 Ga0209758_1000359
1003 Ga0209758_1000365
1004 Ga0209758_1000530
1005 Ga0209758_1004237
1006 Ga0209758_1005198
1007 Ga0209758_1027110
1008 Ga0209256_1003423
1009 Ga0207426_1000429
1010 Ga0207426_1000998
1011 Ga0207426_1020516
1012 Ga0209257_1001196
1013 Ga0207692_10000915
1014 Ga0207692_10075490
1015 Ga0207688_10049442
1016 Ga0207647_10022267
1017 Ga0207647_10118780
1018 Ga0207699_10001327
1019 Ga0207699_10010250
1020 Ga0207699_10019793
1021 Ga0207705_10057946
1022 Ga0207684_10086326
1023 Ga0207654_10000411
1024 Ga0207707_10001362
1025 Ga0207707_10016091
1026 Ga0207707_10109082
1027 Ga0207695_10000008
1028 Ga0207695_10000424
1029 Ga0207695_10035687
1030 Ga0207671_10016997
1031 Ga0207693_10008179
1032 Ga0207663_10028587
1033 Ga0207663_10111602
1034 Ga0207663_10145865
1035 Ga0207660_10020110
1036 Ga0207660_10092897
1037 Ga0207657_10006063
1038 Ga0207652_10009418
1039 Ga0207681_10048754
1040 Ga0207694_10000347
1041 Ga0207694_10046201
1042 Ga0207694_10056360
1043 Ga0207650_10096336
1044 Ga0207687_10073302
1045 Ga0207664_10044500
1046 Ga0207664_10059216
1047 Ga0207644_10031587
1048 Ga0207669_10014040
1049 Ga0207704_10078578
1050 Ga0207665_10005475
1051 Ga0207711_10025944
1052 Ga0207661_10000647
1053 Ga0207661_10161451
1054 Ga0207667_10050734
1055 Ga0207667_10257860
1056 Ga0207668_10074081
1057 Ga0207640_10017736
1058 Ga0207640_10086180
1059 Ga0207677_10021930
1060 Ga0207703_10088661
1061 Ga0207678_10015346
1062 Ga0207678_10039799
1063 Ga0207678_10078914
1064 Ga0207678_10089106
1065 Ga0207678_10097100
1066 Ga0207708_10048033
1067 Ga0207702_10000002
1068 Ga0207702_10000243
1069 Ga0207702_10011407
1070 Ga0207702_10191830
1071 Ga0207674_10003854
1072 Ga0207674_10009561
1073 Ga0207675_100029871
1074 Ga0207675_100048223
1075 Ga0207675_100130941
1076 Ga0207683_10046044
1077 Ga0207683_10070990
1078 Ga0207698_10026014
1079 Ga0209389_1000001
1080 Ga0209389_1000134
1081 Ga0209589_1000014
1082 Ga0209589_1000033
1083 Ga0209489_100014
1084 Ga0209489_100040
1085 Ga0209489_119453
1086 Ga0209489_119748
1087 Ga0209700_100007
1088 Ga0209700_100024
1089 Ga0268266_10036645
1090 Ga0268266_10073800
1091 Ga0268266_10105326
1092 Ga0268265_10069583
1093 Ga0268264_10000048
1094 Ga0265337_1009505
1095 Ga0265326_10016163
1096 Ga0265319_1005194
1097 Ga0265334_10003849
1098 Ga0265323_10001021
1099 Ga0265336_10000397
1100 Ga0307517_10001507
1101 Ga0307515_10056013
1102 Ga0265338_10000034
1103 Ga0265325_10015311
1104 Ga0265340_10001084
1105 Ga0265339_10020405
1106 Ga0265331_10016991
1107 Ga0307509_10143252
1108 Ga0307508_10000249
1109 Ga0307508_10107568
1110 Ga0265314_10014031
1111 Ga0265342_10003896
1112 Ga0307516_10005695
1113 Ga0307516_10055077
1114 Ga0307516_10089715
1115 Ga0307405_10047565
1116 Ga0307405_10105036
1117 Ga0307507_10080724
1118 Ga0307510_10008055
1119 Ga0307510_10017631
1120 Ga0307510_10024060
1121 Ga0307510_10133015
1122 Ga0315911_1000002
1123 Ga0373926_0004912
1124 Ga0373923_0006495
1125 Ga0373936_0006011
1126 Ga0373945_0005674
1127 Ga0373954_0007067
1128 Ga0373943_0008537
1129 Ga0373946_0002265
1130 Ga0373946_0013981
1131 Ga0373955_0005896
1132 Ga0373935_0000681
1133 Ga0373935_0028648
1134 Ga0373927_0000985
1135 Ga0373927_0002439
1136 Ga0373927_0031836
1137 Ga0373933_0001176
1138 Ga0373947_0000118
1139 Ga0373947_0025523
1140 Ga0373937_0069070
1141 Ga0373937_0130575
1142 Ga0373925_0001151
1143 Ga0373925_0093688
1144 Ga0395899_0056072
1145 Ga0395900_0001529
1146 Ga0395900_0083776
1147 Ga0395898_0014173
1148 Ga0395898_0042524
1149 Ga0395905_0009682
1150 Ga0395905_0014127
1151 Ga0436364_1112623
1152 Ga0395901_0011625
1153 Ga0395901_0109013
1154 Ga0395901_0140309
1155 Ga0436365_0191965
1156 Ga0436363_0996694
1157 Ga0439465_0005851
1158 Ga0466969_0022064
1159 Ga0466972_0000200
1160 Ga0466965_0076660
1161 Ga0466961_0000050
1162 Ga0466961_0076880
1163 Ga0466963_0014914
1164 Ga0466964_0038812
1165 Ga0466957_0017874
1166 Ga0466957_0045999
1167 Ga0466959_0003216
1168 Ga0466959_0063305
1169 Ga0466967_0006745
1170 Ga0466967_0077106
1171 Ga0495592_0028302
1172 Ga0495592_0033732
1173 Ga0495603_0000053
1174 Ga0495603_0011237
1175 Ga0495603_0014491
1176 Ga0495629_0008916
1177 Ga0495629_0018227
1178 Ga0495629_0045223
1179 Ga0495629_0085573
1180 Ga0495638_0001532
1181 Ga0495638_0051184
1182 Ga0495638_0060740
1183 Ga0495638_0086418
1184 Ga0495641_0010050
1185 Ga0495651_0001520
1186 Ga0495651_0050024
1187 Ga0495651_0051215
1188 Ga0495651_0067192
1189 Ga0495651_0095975
1190 Ga0495653_0057882
1191 Ga0495580_0001877
1192 Ga0495582_0000186
1193 Ga0495639_0000078
1194 Ga0495639_0022927
1195 Ga0495662_0001326
1196 Ga0495664_0008167
1197 Ga0495664_0011159
1198 Ga0495594_0000103
1199 Ga0495594_0030010
1200 Ga0495583_0040787
1201 Ga0495606_0004866
1202 Ga0495608_0017545
1203 Ga0495608_0031044
1204 Ga0495618_0117514
1205 Ga0495618_0120901
1206 Ga0495628_0014211
1207 Ga0495630_0003505
1208 Ga0495630_0153994
1209 Ga0495631_0042068
1210 Ga0495631_0043587
1211 Ga0495643_0099939
1212 Ga0495644_0026973
1213 Ga0495648_0002554
1214 Ga0495648_0007789
1215 Ga0495648_0024700
1216 Ga0495666_0093854
1217 Ga0495652_0004137
1218 Ga0495652_0131261
1219 Ga0495652_0166790
1220 Ga0495665_0000190
1221 Ga0495640_0001905
1222 Ga0495640_0087702
1223 Ga0495622_0005230
1224 Ga0495622_0015848
1225 Ga0495667_0006001
1226 Ga0495667_0009435
1227 Ga0495656_0060531
1228 Ga0495634_0001169
1229 Ga0495634_0064194
1230 Ga0495625_0053578
1231 Ga0495635_0000211
1232 Ga0495635_0000985
1233 Ga0495635_0015479
1234 Ga0495588_0001447
1235 Ga0495588_0033733
1236 Ga0495588_0054544
1237 Ga0495657_0000889
1238 Ga0495657_0013750
1239 Ga0495599_0000957
1240 Ga0495599_0083621
1241 Ga0495623_0005834
1242 Ga0495623_0005846
1243 Ga0495646_0022073
1244 Ga0495647_0028522
1245 Ga0495658_0000108
1246 Ga0495658_0013308
1247 Ga0495669_0001878
1248 Ga0495613_0010887
1249 Ga0495613_0105927
1250 Ga0495624_0003469
1251 Ga0495600_0001856
1252 Ga0495600_0009971
1253 Ga0495600_0036170
1254 Ga0495581_0000501
1255 Ga0495581_0013051
1256 Ga0495581_0127441
1257 Ga0495604_0015222
1258 Ga0495604_0025993
1259 Ga0495674_0000228
1260 Ga0495674_0008379
1261 Ga0495674_0070755
1262 Ga0495672_0011909
1263 Ga0495676_0152454
1264 Ga0495680_0002530
1265 Ga0495673_0012247
1266 Ga0495684_0018149
1267 Ga0495684_0143545
1268 Ga0495686_0008845
1269 Ga0495593_0002763
1270 Ga0495593_0056534
1271 Ga0495593_0084435
1272 Ga0495602_0003401
1273 Ga0496100_0041350
1274 Ga0496101_0039152
1275 Ga0496101_0081029
1276 Ga0496102_0008501
1277 Ga0496103_0016380
1278 Ga0496103_0157513
1279 Ga0496104_0000281
1280 Ga0496104_0005754
1281 Ga0496104_0008421
1282 Ga0496104_0025549
1283 Ga0496105_0011220
1284 Ga0496105_0043844
1285 Ga0496106_0005076
1286 Ga0496106_0131349
1287 Ga0496107_0070819
1288 Ga0496108_0000845
1289 Ga0496109_0000592
1290 Ga0496109_0298042
1291 Ga0496110_0011293
1292 Ga0496110_0023231
1293 Ga0496110_0245293
1294 Ga0496111_0031284
1295 Ga0496112_0000017
1296 Ga0496112_0001178
1297 Ga0496112_0079384
1298 Ga0496113_0011677
1299 Ga0496113_0053320
1300 Ga0496115_0022242
1301 Ga0496116_0022752
1302 Ga0496116_0054476
1303 Ga0496116_0130238
1304 Ga0496117_0132713
1305 Ga0496118_0003113
1306 Ga0496118_0053861
1307 Ga0496118_0126482
1308 Ga0496119_0005325
1309 Ga0496119_0049769
1310 Ga0496120_0001511
1311 Ga0496120_0055680
1312 Ga0496121_0000886
1313 Ga0496121_0002017
1314 Ga0496121_0002694
1315 Ga0496121_0013709
1316 Ga0496121_0017276
1317 Ga0496121_0026234
1318 Ga0496121_0041651
1319 Ga0496121_0042521
1320 Ga0496121_0056125
1321 Ga0496121_0081237
1322 Ga0496122_0014132
1323 Ga0496122_0079207
1324 Ga0496123_0068394
1325 Ga0496124_0096800
1326 Ga0496125_0000040
1327 Ga0496125_0002027
1328 Ga0496125_0005006
1329 Ga0496125_0054179
1330 Ga0496126_0008257
1331 Ga0496126_0017486
1332 Ga0496126_0025006
1333 Ga0496126_0028691
1334 Ga0496126_0046030
1335 Ga0496126_0058006
1336 Ga0496126_0062123
1337 Ga0496126_0121969
1338 Ga0496126_0205544
1339 Ga0501031_0010139
1340 Ga0501032_0007050
1341 Ga0501032_0027533
1342 Ga0501032_0113009
1343 Ga0501032_0123021
1344 Ga0501033_0000250
1345 Ga0501033_0000553
1346 Ga0501033_0050247
1347 Ga0501034_0000892
1348 Ga0501036_0000267
1349 Ga0501036_0016285
1350 Ga0501036_0065694
1351 Ga0501037_0000257
1352 Ga0501037_0006617
1353 Ga0501038_0001535
1354 Ga0501038_0004912
1355 Ga0501038_0014599
1356 Ga0501038_0059534
1357 Ga0501039_0000488
1358 Ga0501039_0002930
1359 Ga0501042_0021357
1360 Ga0501042_0025726
1361 Ga0501043_0001660
1362 Ga0501043_0003909
1363 Ga0501043_0005331
1364 Ga0501043_0006924
1365 Ga0501043_0101724
1366 Ga0501046_0006487
1367 Ga0501046_0024923
1368 Ga0501046_0039030
1369 Ga0501046_0081404
1370 Ga0501047_0000123
1371 Ga0501047_0019457
1372 Ga0501048_0000108
1373 Ga0501048_0092763
1374 Ga0501067_0000267
1375 Ga0501068_0007488
1376 Ga0501068_0112976
1377 Ga0501069_0002404
1378 Ga0501069_0075288
1379 Ga0501070_0016149
1380 Ga0501070_0024041
1381 Ga0501071_0041215
1382 Ga0501072_0000898
1383 Ga0501073_0000014
1384 Ga0501073_0008879
1385 Ga0501074_0009185
1386 Ga0501076_0165258
1387 Ga0501080_0018899
1388 Ga0501080_0031341
1389 Ga0501080_0204945
1390 Ga0501083_0000289
1391 Ga0501083_0018277
1392 Ga0501035_0000608
1393 Ga0501035_0115601
1394 Ga0501035_0143976
1395 Ga0501044_0000344
1396 Ga0501044_0070406
1397 Ga0501044_0146266
1398 Ga0501045_0005228
1399 nmdc:mga06z11_1297_c1
1400 nmdc:mga06z11_53375_c1
1401 nmdc:mga05p37_52659_c1
1402 nmdc:mga08y16_65892_c1
1403 nmdc:mga0rr50_165411_c1
1404 nmdc:mga0sz30_43742_c1
1405 Ga0495612_0023374
1406 Ga0500635_0003054
1407 Ga0495595_0079663
1408 Ga0495619_0014968
1409 Ga0495619_0061030
1410 Ga0500643_000319
1411 Ga0500646_0007605
1412 Ga0500583_0026742
1413 Ga0500651_0001711
1414 Ga0500566_0000117
1415 Ga0500566_0001715
1416 Ga0500640_000141
1417 Ga0500641_0059093
1418 Ga0500641_0067055
1419 Ga0500554_000617
1420 Ga0500555_003231
1421 Ga0500556_0000002
1422 Ga0500556_0009163
1423 Ga0500557_000162
1424 Ga0500572_000828
1425 Ga0500572_001082
1426 Ga0500592_007011
1427 Ga0500595_001406
1428 Ga0500595_001750
1429 Ga0500595_023301
1430 Ga0500608_043407
1431 Ga0500614_000264
1432 Ga0500618_003608
1433 Ga0500642_0000057
1434 Ga0500642_0000876
1435 Ga0500652_000965
1436 Ga0500658_0035161
1437 Ga0500559_0000242
1438 Ga0500559_0002978
1439 Ga0500559_0012427
1440 Ga0500568_0001500
1441 Ga0500568_0013309
1442 Ga0500568_0024271
1443 Ga0500577_0000095
1444 Ga0500590_035432
1445 Ga0500603_000306
1446 Ga0500603_000586
1447 Ga0500604_0003637
1448 Ga0500616_0000031
1449 Ga0500616_0000034
1450 Ga0500622_0005168
1451 Ga0500622_0042459
1452 Ga0500630_000221
1453 Ga0500639_000041
1454 Ga0500636_0000614
1455 Ga0500636_0082173
1456 Ga0500637_0000282
1457 Ga0500637_0076481
1458 Ga0500570_065323
1459 Ga0500576_041784
1460 Ga0500625_001494
1461 Ga0500645_006818
1462 Ga0500645_019623
1463 Ga0500609_004321
1464 Ga0500596_001100
1465 Ga0500599_000137
1466 Ga0500601_000052
1467 Ga0500601_002092
1468 Ga0501084_0001855
1469 Ga0500661_000108
1470 Ga0501082_0006680
1471 Ga0501082_0085494
1472 Ga0466962_0038186
1473 2507507751
1474 2508541875
1475 2508692582
1476 2509149397
1477 2511398956
1478 2513622962
1479 2513642879
1480 2513647421
1481 2513653981
1482 2513676254
1483 2513695806
1484 2513699540
1485 2513719389
1486 2513856417
1487 2513878428
1488 2513891366
1489 2513918321
1490 2514009525
1491 2515625991
1492 2517104059
1493 2517891449
1494 2524436380
1495 2524470290
1496 2524538377
1497 2528849082
1498 2603861427
1499 2617346706
1500 2617372634
1501 2644291394
1502 2671118786
1503 2723847271
1504 2728750143
1505 2745080666
1506 2793064446
1507 2793066813
1508 2793084138
1509 2805919149
1510 2818236457
1511 2824608238
1512 2824612960
1513 2824621915
1514 2824631617
1515 2824643956
1516 2824652921
1517 2824661363
1518 2824671226
1519 2824679504
1520 2824687787
1521 2824695855
1522 2824701773
1523 2824714581
1524 2824723674
1525 2824732780
1526 2824749796
1527 2824762400
1528 2824772694
1529 2824775221
1530 2838128893
1531 2841944960
1532 2841953383
1533 2841959789
1534 2841972145
1535 2841978109
1536 2841986268
1537 2842040557
1538 2842046497
1539 2844319923
1540 2847937232
1541 2847947646
1542 2849078499
1543 2857512858
1544 2857530202
1545 2874598860
1546 2874607290
1547 2874614670
1548 2874627984
1549 2874635127
1550 2874652316
1551 2876766189
1552 2876778899
1553 2876814526
1554 2876824206
1555 2879082692
1556 2879088459
1557 2879107039
1558 2879114622
1559 2879132147
1560 2879148326
1561 2881371551
1562 2881671847
1563 2885369878
1564 2885378295
1565 2885388296
1566 2885412285
1567 2888385356
1568 2888392894
1569 2888425494
1570 2889038115
1571 2893066092
1572 2903730404
1573 2903749032
1574 2903775891
1575 2904674398
1576 2904691292
1577 2904704887
1578 2904712077
1579 2906604663
1580 2906616621
1581 2906627439
1582 2906635405
1583 2906649357
1584 2906666951
1585 2908741788
1586 2908759067
1587 2908781080
1588 2919079527
1589 2922368583
1590 2922372508
1591 2922387444
1592 2922397161
1593 2922431358
1594 2929620928
1595 2929626241
1596 2932784880
1597 2932795247
1598 2932805778
1599 2932809914
1600 2932818343
1601 2932828717
1602 2933583202
1603 2935609736
1604 2935619863
1605 2935633954
1606 2935638845
1607 2935654217
1608 2935663090
1609 2935666305
1610 2935676651
1611 2935685033
1612 2935694729
1613 2935703850
1614 2935713586
1615 2935724206
1616 2935733436
1617 2935742815
1618 2935750998
1619 2935760473
1620 2935772036
1621 2935784211
1622 2935787576
1623 2935796208
1624 2935801987
1625 2935810756
1626 2935822898
1627 2935828339
1628 2935839754
1629 2935848480
1630 2935857822
1631 2935868836
1632 2935874251
1633 2935883852
1634 2935909715
1635 2935917439
1636 2935927196
1637 2935936960
1638 2935944737
1639 2935953174
1640 2935961317
1641 2935970014
1642 2935980299
1643 2935986936
1644 2935992824
1645 2936002737
1646 2936017246
1647 2936025748
1648 2936034597
1649 2936037824
1650 2936052654
1651 2936062063
1652 2940558199
1653 2941510743
1654 2941518127
1655 2941527002
1656 2941531107
1657 2941540905
1658 3005481149
1659 3005484887
1660 3005508515
1661 3005587166
1662 3005600202
1663 3005715714
1664 3005723062
1665 8006930885
1666 8006939558
1667 8006968366
1668 8006979309
1669 8006989202
1670 8006994814
1671 8016528792
1672 8016547201
1673 8016554928
1674 8016563295
1675 8016576497
1676 8016594204
1677 8016601047
1678 8016615502
1679 8016625720
1680 8016639281
1681 8017064825
1682 8019533746
1683 8019545922
1684 8019552805
1685 8019565451
1686 8019575543
1687 8019599328
1688 8019609030
1689 8019619718
1690 8019633397
1691 8019649249
1692 8019661281
1693 8019670822
1694 8019685377
1695 8019690969
1696 8055745209
1697 8056681014
1698 8056684905
1699 8056693412
1700 8056975171

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05048

NosD

Periplasmic copper-binding protein (NosD)

164

300

0.85

PF13229

Beta_helix

Right handed beta helix region

165

267

0.83

PF13229

Beta_helix

Right handed beta helix region

213

454

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c7d-assembly2.cif.gz_B crystal structure of the catalytic unit of thermostable gh87 alpha-1,3-glucanase from streptomyces thermodiastaticus strain hf3-3 0.6718 38 434
5lw3-assembly1.cif.gz_A azotobacter vinelandii mannuronan c-5 epimerase alge6 a-module 0.6699 38 434
5lw3-assembly1.cif.gz_A azotobacter vinelandii mannuronan c-5 epimerase alge6 a-module 0.6634 38 434
4nk8-assembly1.cif.gz_A crystal structure of the periplasmic alginate epimerase algg d317a mutant 0.6287 68 434
6k0m-assembly1.cif.gz_A catalytic domain of gh87 alpha-1,3-glucanase from paenibacillus glycanilyticus fh11 0.6221 46 430
ID Description Score Start End Superfamily
4nk8A00 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.6292 70 434 2.160.20.10
af_A0A0R0G6S6_12_359_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.6234 38 357 2.160.20.10
af_P9WFD9_1_145_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5926 55 82 3.40.50.620
af_A0A0R0G6S6_12_359_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.5779 38 357 2.160.20.10
3gq9A01 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.5766 39 401 2.160.20.10
ID Description Score Start End GO Terms
AF-A0A3C1NEA4-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9664 46 260
AF-A0A529U5T8-F1-model_v4 deleted 0.9595 39 151
AF-A0A532AJ08-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9503 145 247
AF-A0A3C1NEA4-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9446 46 260
AF-A0A352VVS1-F1-model_v4 Rhamnogalacturonase A/B/Epimerase-like pectate lyase domain-containing protein 0.9435 39 80

Map