F483445

General Info

Members Datasets Scaffolds Average Seq Length
851 341 1702 140

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10033474|rootL2_100334744
Length 161
Sequence MRFDLPDDKKLTYQMIIPIRWGDMDAMGHVNNTIYFRYLEIIRLEWLYKVGATTDRASTGPVIVNAFCNFIKQLEFPGDVLAKHYVANPGRSSFDTYITLERTDDPGVVYASGGAKTVWVNYAQQQSVPLPEWLRALIVSEPETSTAADQVPFGLMGSRSS

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
90 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
207 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
208 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
209 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
210 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
211 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
212 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
213 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
222 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
223 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
224 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
225 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
226 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
227 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
228 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
229 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
291 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
292 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
298 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
299 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
300 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
303 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
304 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
305 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
314 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
322 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
323 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
324 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
325 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
326 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
327 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
328 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
329 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
330 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
331 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
332 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
333 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
334 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
335 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
336 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
337 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
341 2831864461 Roseateles noduli HZ7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.28
Nodule 0.12
Rhizoplane 2.82
Rhizosphere 82.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10033474 3300003322 Bacteria 3680
2 Ga0055526_1012714 3300003771 Bacteria 3641
3 Ga0065165_1000449 3300005262 Bacteria 64652
4 Ga0070658_10590914 3300005327 Bacteria 962
5 Ga0070658_10613018 3300005327 Bacteria 943
6 Ga0070658_11112721 3300005327 Bacteria 687
7 Ga0070676_10000967 3300005328 Bacteria 14303
8 Ga0070676_10136658 3300005328 Bacteria 1556
9 Ga0070683_100904792 3300005329 Bacteria 846
10 Ga0070683_102230556 3300005329 Bacteria 526
11 Ga0070690_100002198 3300005330 Bacteria 10434
12 Ga0070690_100285862 3300005330 Bacteria 1178
13 Ga0070670_100011824 3300005331 Bacteria 7464
14 Ga0070670_100017606 3300005331 Bacteria 6132
15 Ga0070670_100049024 3300005331 Bacteria 3633
16 Ga0070670_100072801 3300005331 Bacteria 2951
17 Ga0070670_100098984 3300005331 Bacteria 2509
18 Ga0070670_100215092 3300005331 Bacteria 1671
19 Ga0070670_100390869 3300005331 Bacteria 1226
20 Ga0070670_100564031 3300005331 Bacteria 1016
21 Ga0070677_10092549 3300005333 Bacteria 1318
22 Ga0070677_10107157 3300005333 Bacteria 1242
23 Ga0070677_10163663 3300005333 Bacteria 1046
24 Ga0070677_10298659 3300005333 Bacteria 818
25 Ga0068869_100008823 3300005334 Bacteria 6523
26 Ga0068869_100035574 3300005334 Bacteria 3530
27 Ga0070666_10006161 3300005335 Bacteria 7374
28 Ga0070666_10026526 3300005335 Bacteria 3787
29 Ga0070666_10247718 3300005335 Bacteria 1261
30 Ga0070666_10270583 3300005335 Bacteria 1206
31 Ga0070666_11458174 3300005335 Bacteria 512
32 Ga0070680_100103902 3300005336 Bacteria 2360
33 Ga0068868_100007098 3300005338 Bacteria 7964
34 Ga0068868_100013553 3300005338 Bacteria 5982
35 Ga0068868_100027139 3300005338 Bacteria 4367
36 Ga0068868_100044531 3300005338 Bacteria 3469
37 Ga0068868_100633145 3300005338 Bacteria 951
38 Ga0070660_100556690 3300005339 Bacteria 957
39 Ga0070660_100597452 3300005339 Bacteria 923
40 Ga0070689_100101440 3300005340 Bacteria 2278
41 Ga0070689_100356132 3300005340 Bacteria 1229
42 Ga0070687_100213947 3300005343 Bacteria 1176
43 Ga0070661_100120688 3300005344 Bacteria 1963
44 Ga0070661_100130589 3300005344 Bacteria 1886
45 Ga0070661_100147852 3300005344 Bacteria 1775
46 Ga0070661_100714038 3300005344 Bacteria 817
47 Ga0070692_10104138 3300005345 Bacteria 1560
48 Ga0070668_100090225 3300005347 Bacteria 2414
49 Ga0070668_100174614 3300005347 Bacteria 1751
50 Ga0070669_100000946 3300005353 Bacteria 21193
51 Ga0070669_100020703 3300005353 Bacteria 4700
52 Ga0070669_100200875 3300005353 Bacteria 1568
53 Ga0070669_100661378 3300005353 Bacteria 880
54 Ga0070669_100730891 3300005353 Bacteria 838
55 Ga0070669_100803065 3300005353 Bacteria 800
56 Ga0070675_100008295 3300005354 Bacteria 8061
57 Ga0070675_100014275 3300005354 Bacteria 6263
58 Ga0070675_100037215 3300005354 Bacteria 3963
59 Ga0070675_100082739 3300005354 Bacteria 2678
60 Ga0070675_100175081 3300005354 Bacteria 1852
61 Ga0070675_100877900 3300005354 Bacteria 821
62 Ga0070675_100987962 3300005354 Bacteria 773
63 Ga0070671_100008962 3300005355 Bacteria 8028
64 Ga0070671_100011128 3300005355 Bacteria 7226
65 Ga0070671_100017122 3300005355 Bacteria 5864
66 Ga0070671_100101990 3300005355 Bacteria 2408
67 Ga0070671_100283727 3300005355 Bacteria 1409
68 Ga0070671_100329261 3300005355 Bacteria 1302
69 Ga0070671_100443298 3300005355 Bacteria 1113
70 Ga0070671_100479894 3300005355 Bacteria 1068
71 Ga0070671_100548362 3300005355 Bacteria 997
72 Ga0070671_101001870 3300005355 Bacteria 732
73 Ga0070674_100012121 3300005356 Bacteria 5283
74 Ga0070674_100033663 3300005356 Bacteria 3413
75 Ga0070674_101116460 3300005356 Bacteria 697
76 Ga0070673_100026508 3300005364 Bacteria 4281
77 Ga0070673_100026514 3300005364 Bacteria 4281
78 Ga0070673_100244228 3300005364 Bacteria 1562
79 Ga0070673_100955031 3300005364 Bacteria 797
80 Ga0070688_100038432 3300005365 Bacteria 2923
81 Ga0070688_100931759 3300005365 Bacteria 687
82 Ga0070659_101183217 3300005366 Bacteria 676
83 Ga0070667_100000838 3300005367 Bacteria 28602
84 Ga0070667_100017170 3300005367 Bacteria 5994
85 Ga0070667_100300113 3300005367 Bacteria 1446
86 Ga0070667_100651188 3300005367 Bacteria 973
87 Ga0070667_100843539 3300005367 Bacteria 852
88 Ga0070701_10092090 3300005438 Bacteria 1663
89 Ga0070701_10203352 3300005438 Bacteria 1172
90 Ga0070700_100084057 3300005441 Bacteria 2062
91 Ga0070708_101257119 3300005445 Bacteria 692
92 Ga0070663_100442628 3300005455 Bacteria 1070
93 Ga0070678_100008031 3300005456 Bacteria 6292
94 Ga0070678_100046726 3300005456 Bacteria 3106
95 Ga0070678_100048676 3300005456 Bacteria 3055
96 Ga0070678_100058748 3300005456 Bacteria 2824
97 Ga0070678_100148975 3300005456 Bacteria 1883
98 Ga0070678_100186720 3300005456 Bacteria 1701
99 Ga0070678_100398733 3300005456 Bacteria 1195
100 Ga0070662_100010330 3300005457 Bacteria 6120
101 Ga0070662_100030591 3300005457 Bacteria 3769
102 Ga0070662_100706907 3300005457 Bacteria 853
103 Ga0068867_100018562 3300005459 Bacteria 4943
104 Ga0068867_100044264 3300005459 Bacteria 3260
105 Ga0068867_100054576 3300005459 Bacteria 2952
106 Ga0068867_100154791 3300005459 Bacteria 1803
107 Ga0068867_100287863 3300005459 Bacteria 1350
108 Ga0068867_100987346 3300005459 Bacteria 763
109 Ga0070685_10288847 3300005466 Bacteria 1101
110 Ga0070707_102027726 3300005468 Bacteria 543
111 Ga0070679_100019248 3300005530 Bacteria 6634
112 Ga0070684_100640130 3300005535 Bacteria 989
113 Ga0070684_100955814 3300005535 Bacteria 803
114 Ga0068853_100451930 3300005539 Bacteria 1208
115 Ga0068853_100569999 3300005539 Bacteria 1074
116 Ga0070672_100000222 3300005543 Bacteria 31542
117 Ga0070672_100001613 3300005543 Bacteria 14020
118 Ga0070672_100023405 3300005543 Bacteria 4554
119 Ga0070672_100040505 3300005543 Bacteria 3575
120 Ga0070672_100064145 3300005543 Bacteria 2902
121 Ga0070672_100120093 3300005543 Bacteria 2151
122 Ga0070672_100122310 3300005543 Bacteria 2132
123 Ga0070672_100383952 3300005543 Bacteria 1202
124 Ga0070672_100466735 3300005543 Bacteria 1089
125 Ga0070672_101604325 3300005543 Bacteria 584
126 Ga0070686_100101554 3300005544 Bacteria 1944
127 Ga0070693_100164108 3300005547 Bacteria 1417
128 Ga0070665_100031694 3300005548 Bacteria 5320
129 Ga0070665_100378045 3300005548 Bacteria 1424
130 Ga0070665_101263834 3300005548 Bacteria 748
131 Ga0070665_101390512 3300005548 Bacteria 711
132 Ga0068855_100430824 3300005563 Bacteria 1442
133 Ga0070664_100021811 3300005564 Bacteria 5280
134 Ga0070664_100078943 3300005564 Bacteria 2832
135 Ga0070664_100080686 3300005564 Bacteria 2802
136 Ga0070664_100087764 3300005564 Bacteria 2689
137 Ga0070664_100218724 3300005564 Bacteria 1704
138 Ga0070664_100337822 3300005564 Bacteria 1368
139 Ga0070664_100375655 3300005564 Bacteria 1296
140 Ga0070664_100486661 3300005564 Bacteria 1136
141 Ga0070664_100678333 3300005564 Bacteria 959
142 Ga0068854_100156399 3300005578 Bacteria 1762
143 Ga0068854_100214065 3300005578 Bacteria 1521
144 Ga0068856_100032509 3300005614 Bacteria 5108
145 Ga0068856_101095995 3300005614 Bacteria 814
146 Ga0070702_100175699 3300005615 Bacteria 1397
147 Ga0068852_100009386 3300005616 Bacteria 7265
148 Ga0068852_100371942 3300005616 Bacteria 1400
149 Ga0068852_100388278 3300005616 Bacteria 1371
150 Ga0068852_100644999 3300005616 Bacteria 1066
151 Ga0068852_100676503 3300005616 Bacteria 1041
152 Ga0068852_101114605 3300005616 Bacteria 809
153 Ga0068852_101314700 3300005616 Bacteria 745
154 Ga0068859_100008408 3300005617 Bacteria 10459
155 Ga0068859_100133886 3300005617 Bacteria 2550
156 Ga0068859_100228669 3300005617 Bacteria 1948
157 Ga0068859_100434691 3300005617 Bacteria 1409
158 Ga0068864_100002444 3300005618 Bacteria 15359
159 Ga0068864_100006343 3300005618 Bacteria 9699
160 Ga0068864_100006794 3300005618 Bacteria 9370
161 Ga0068864_100013840 3300005618 Bacteria 6684
162 Ga0068864_100036184 3300005618 Bacteria 4206
163 Ga0068866_10001018 3300005718 Bacteria 12328
164 Ga0068866_10130898 3300005718 Bacteria 1427
165 Ga0068866_10434170 3300005718 Bacteria 855
166 Ga0068866_10931940 3300005718 Bacteria 613
167 Ga0068861_100006498 3300005719 Bacteria 7970
168 Ga0068861_100090097 3300005719 Bacteria 2418
169 Ga0068861_100314013 3300005719 Bacteria 1363
170 Ga0068851_10021380 3300005834 Bacteria 3141
171 Ga0068851_10029522 3300005834 Bacteria 2715
172 Ga0068851_10038384 3300005834 Bacteria 2402
173 Ga0068851_10299856 3300005834 Bacteria 924
174 Ga0068851_10329714 3300005834 Bacteria 884
175 Ga0068851_10455915 3300005834 Bacteria 760
176 Ga0068851_10902446 3300005834 Bacteria 554
177 Ga0068870_10050213 3300005840 Bacteria 2203
178 Ga0068870_10348335 3300005840 Bacteria 950
179 Ga0068870_10489430 3300005840 Bacteria 818
180 Ga0068863_100004558 3300005841 Bacteria 13661
181 Ga0068863_100014569 3300005841 Bacteria 7569
182 Ga0068863_100020978 3300005841 Bacteria 6241
183 Ga0068863_100063509 3300005841 Bacteria 3492
184 Ga0068863_100079616 3300005841 Bacteria 3103
185 Ga0068863_100193478 3300005841 Bacteria 1955
186 Ga0068863_101600409 3300005841 Bacteria 661
187 Ga0068858_100000796 3300005842 Bacteria 32979
188 Ga0068858_100001242 3300005842 Bacteria 26336
189 Ga0068858_100007494 3300005842 Bacteria 10548
190 Ga0068860_100000958 3300005843 Bacteria 31908
191 Ga0068860_100109811 3300005843 Bacteria 2636
192 Ga0068860_100321949 3300005843 Bacteria 1518
193 Ga0068860_100351521 3300005843 Bacteria 1450
194 Ga0068860_100730640 3300005843 Bacteria 1001
195 Ga0068860_101049140 3300005843 Bacteria 834
196 Ga0068860_102089898 3300005843 Bacteria 588
197 Ga0068862_100006310 3300005844 Bacteria 9857
198 Ga0068862_100123076 3300005844 Bacteria 2288
199 Ga0075365_10280807 3300006038 Bacteria 1172
200 Ga0075368_10019648 3300006042 Bacteria 2551
201 Ga0075363_100027103 3300006048 Bacteria 2935
202 Ga0075363_100317027 3300006048 Bacteria 907
203 Ga0075364_10361508 3300006051 Bacteria 990
204 Ga0070715_10373480 3300006163 Bacteria 785
205 Ga0070716_100163740 3300006173 Bacteria 1444
206 Ga0075362_10001661 3300006177 Bacteria 7212
207 Ga0075367_10001231 3300006178 Bacteria 10751
208 Ga0075369_10008026 3300006186 Bacteria 4045
209 Ga0075366_10000633 3300006195 Bacteria 16535
210 Ga0075366_10010279 3300006195 Bacteria 5250
211 Ga0075366_10012074 3300006195 Bacteria 4892
212 Ga0075366_10024445 3300006195 Bacteria 3524
213 Ga0075366_10027546 3300006195 Bacteria 3334
214 Ga0075366_10062073 3300006195 Bacteria 2222
215 Ga0075366_10086716 3300006195 Bacteria 1873
216 Ga0075366_10190091 3300006195 Bacteria 1248
217 Ga0075366_10247733 3300006195 Bacteria 1087
218 Ga0075366_10307402 3300006195 Bacteria 970
219 Ga0075366_10544211 3300006195 Bacteria 719
220 Ga0097621_100017120 3300006237 Bacteria 5498
221 Ga0097621_100026744 3300006237 Bacteria 4530
222 Ga0097621_100068077 3300006237 Bacteria 2935
223 Ga0097621_100070755 3300006237 Bacteria 2881
224 Ga0097621_100134112 3300006237 Bacteria 2110
225 Ga0097621_100200616 3300006237 Bacteria 1732
226 Ga0097621_100280442 3300006237 Bacteria 1467
227 Ga0097621_100903754 3300006237 Bacteria 822
228 Ga0097621_101173502 3300006237 Bacteria 722
229 Ga0075370_10000477 3300006353 Bacteria 15073
230 Ga0075370_10007016 3300006353 Bacteria 5712
231 Ga0075370_10008737 3300006353 Bacteria 5226
232 Ga0075370_10030137 3300006353 Bacteria 3026
233 Ga0075370_10132138 3300006353 Bacteria 1457
234 Ga0075370_10910111 3300006353 Bacteria 538
235 Ga0068871_100008787 3300006358 Bacteria 7274
236 Ga0068871_100028656 3300006358 Bacteria 4368
237 Ga0068871_100031059 3300006358 Bacteria 4209
238 Ga0068871_100041402 3300006358 Bacteria 3694
239 Ga0068871_100089456 3300006358 Bacteria 2563
240 Ga0068871_100116575 3300006358 Bacteria 2252
241 Ga0068871_100122595 3300006358 Bacteria 2197
242 Ga0068871_100235396 3300006358 Bacteria 1591
243 Ga0068871_100240898 3300006358 Bacteria 1572
244 Ga0068871_100786968 3300006358 Bacteria 876
245 Ga0068871_101332820 3300006358 Bacteria 676
246 Ga0068871_101540047 3300006358 Bacteria 629
247 Ga0075433_10791548 3300006852 Bacteria 829
248 Ga0075434_100376281 3300006871 Bacteria 1441
249 Ga0075429_100004495 3300006880 Bacteria 11996
250 Ga0068865_100002708 3300006881 Bacteria 10510
251 Ga0068865_100275942 3300006881 Bacteria 1336
252 Ga0068865_100294329 3300006881 Bacteria 1297
253 Ga0097620_100008408 3300006931 Bacteria 10459
254 Ga0097620_100133889 3300006931 Bacteria 2550
255 Ga0097620_100228697 3300006931 Bacteria 1948
256 Ga0097620_100434680 3300006931 Bacteria 1409
257 Ga0105240_12212917 3300009093 Bacteria 570
258 Ga0105245_10033187 3300009098 Bacteria 4574
259 Ga0105245_10080149 3300009098 Bacteria 2982
260 Ga0105245_10407856 3300009098 Bacteria 1359
261 Ga0105245_10461667 3300009098 Bacteria 1280
262 Ga0105245_10625111 3300009098 Bacteria 1105
263 Ga0105245_10720477 3300009098 Bacteria 1032
264 Ga0105245_12190319 3300009098 Bacteria 606
265 Ga0105247_10782566 3300009101 Bacteria 726
266 Ga0114129_10189607 3300009147 Bacteria 2793
267 Ga0105243_10013186 3300009148 Bacteria 6249
268 Ga0105243_10112380 3300009148 Bacteria 2282
269 Ga0105243_10320201 3300009148 Bacteria 1413
270 Ga0105243_10361525 3300009148 Bacteria 1336
271 Ga0105243_11659639 3300009148 Bacteria 667
272 Ga0105241_10016683 3300009174 Bacteria 5389
273 Ga0105242_10020381 3300009176 Bacteria 5198
274 Ga0105242_10030143 3300009176 Bacteria 4331
275 Ga0105248_10006497 3300009177 Bacteria 12823
276 Ga0105248_10014520 3300009177 Bacteria 8671
277 Ga0105248_10029979 3300009177 Bacteria 6072
278 Ga0105248_10030248 3300009177 Bacteria 6045
279 Ga0105248_10044394 3300009177 Bacteria 4984
280 Ga0105248_10052970 3300009177 Bacteria 4553
281 Ga0105248_10148283 3300009177 Bacteria 2647
282 Ga0105248_10194829 3300009177 Bacteria 2283
283 Ga0105237_10423695 3300009545 Bacteria 1336
284 Ga0105237_11804946 3300009545 Bacteria 619
285 Ga0105238_10088357 3300009551 Bacteria 3086
286 Ga0105238_10352573 3300009551 Bacteria 1460
287 Ga0105238_10501608 3300009551 Bacteria 1214
288 Ga0105238_12213842 3300009551 Bacteria 584
289 Ga0105249_10007575 3300009553 Bacteria 9472
290 Ga0105249_10018462 3300009553 Bacteria 6206
291 Ga0105249_10020255 3300009553 Bacteria 5945
292 Ga0105249_12921760 3300009553 Bacteria 548
293 Ga0157323_1024816 3300012495 Bacteria 598
294 Ga0157345_1026116 3300012498 Bacteria 627
295 Ga0157371_10076681 3300013102 Bacteria 2367
296 Ga0157369_10022114 3300013105 Bacteria 7104
297 Ga0157369_10940451 3300013105 Bacteria 886
298 Ga0157374_10023261 3300013296 Bacteria 5540
299 Ga0157374_10031456 3300013296 Bacteria 4824
300 Ga0157374_10187836 3300013296 Bacteria 2021
301 Ga0157378_10034405 3300013297 Bacteria 4481
302 Ga0157378_10309831 3300013297 Bacteria 1531
303 Ga0163162_10002005 3300013306 Bacteria 19153
304 Ga0163162_10018451 3300013306 Bacteria 6836
305 Ga0163162_10022372 3300013306 Bacteria 6230
306 Ga0163162_10029567 3300013306 Bacteria 5423
307 Ga0163162_10042947 3300013306 Bacteria 4526
308 Ga0163162_10127808 3300013306 Bacteria 2649
309 Ga0163162_12196054 3300013306 Bacteria 634
310 Ga0157372_10015916 3300013307 Bacteria 8068
311 Ga0157372_10082645 3300013307 Bacteria 3637
312 Ga0157372_10485185 3300013307 Bacteria 1441
313 Ga0157372_11324313 3300013307 Bacteria 831
314 Ga0157375_10004207 3300013308 Bacteria 12491
315 Ga0157375_10007498 3300013308 Bacteria 9543
316 Ga0157375_10013615 3300013308 Bacteria 7248
317 Ga0157375_10016840 3300013308 Bacteria 6580
318 Ga0157375_10121805 3300013308 Bacteria 2718
319 Ga0157375_10226776 3300013308 Bacteria 2027
320 Ga0157375_10266047 3300013308 Bacteria 1876
321 Ga0157375_10285839 3300013308 Bacteria 1812
322 Ga0157375_10475293 3300013308 Bacteria 1415
323 Ga0157375_11186384 3300013308 Bacteria 895
324 Ga0157375_11258824 3300013308 Bacteria 869
325 Ga0157375_11448742 3300013308 Bacteria 810
326 Ga0163163_10024475 3300014325 Bacteria 5747
327 Ga0163163_10421210 3300014325 Bacteria 1394
328 Ga0163163_10591235 3300014325 Bacteria 1173
329 Ga0163163_10945094 3300014325 Bacteria 925
330 Ga0163163_12010577 3300014325 Bacteria 638
331 Ga0157380_10000899 3300014326 Bacteria 18719
332 Ga0157380_10278005 3300014326 Bacteria 1530
333 Ga0157380_10393204 3300014326 Bacteria 1312
334 Ga0157380_10627874 3300014326 Bacteria 1068
335 Ga0157380_10668775 3300014326 Bacteria 1039
336 Ga0157380_11795012 3300014326 Bacteria 672
337 Ga0157377_10094076 3300014745 Bacteria 1775
338 Ga0157379_10006624 3300014968 Bacteria 9990
339 Ga0157379_10037855 3300014968 Bacteria 4302
340 Ga0157379_10068132 3300014968 Bacteria 3182
341 Ga0157379_10089909 3300014968 Bacteria 2755
342 Ga0157379_10112543 3300014968 Bacteria 2446
343 Ga0157379_10297592 3300014968 Bacteria 1470
344 Ga0157379_10452148 3300014968 Bacteria 1186
345 Ga0157376_10007878 3300014969 Bacteria 7640
346 Ga0157376_10011518 3300014969 Bacteria 6523
347 Ga0157376_10022426 3300014969 Bacteria 4922
348 Ga0157376_10070657 3300014969 Bacteria 2964
349 Ga0157376_10100203 3300014969 Bacteria 2529
350 Ga0157376_10136636 3300014969 Bacteria 2195
351 Ga0157376_10662460 3300014969 Bacteria 1045
352 Ga0157376_11204158 3300014969 Bacteria 786
353 Ga0157376_11690941 3300014969 Bacteria 668
354 Ga0182005_1237432 3300015265 Bacteria 560
355 Ga0163161_10174820 3300017792 Bacteria 1644
356 Ga0163161_10247259 3300017792 Bacteria 1389
357 Ga0163161_10524189 3300017792 Bacteria 968
358 Ga0163161_11046920 3300017792 Bacteria 699
359 Ga0213875_10369959 3300021388 Bacteria 682
360 Ga0207425_1041337 3300025245 Bacteria 876
361 Ga0209673_1032691 3300025273 Bacteria 1599
362 Ga0209564_1000005 3300025295 Bacteria 1147192
363 Ga0209256_1046809 3300025299 Bacteria 1068
364 Ga0209257_1029775 3300025304 Bacteria 1772
365 Ga0207656_10062008 3300025321 Bacteria 1642
366 Ga0207656_10189011 3300025321 Bacteria 991
367 Ga0207682_10001858 3300025893 Bacteria 9618
368 Ga0207682_10134933 3300025893 Bacteria 1104
369 Ga0207642_10009009 3300025899 Bacteria 3454
370 Ga0207688_10064549 3300025901 Bacteria 2068
371 Ga0207680_10003535 3300025903 Bacteria 7356
372 Ga0207680_10136106 3300025903 Bacteria 1624
373 Ga0207680_10166238 3300025903 Bacteria 1483
374 Ga0207680_10370148 3300025903 Bacteria 1009
375 Ga0207647_10125660 3300025904 Bacteria 1509
376 Ga0207645_10001892 3300025907 Bacteria 16893
377 Ga0207645_10002132 3300025907 Bacteria 15814
378 Ga0207645_10112287 3300025907 Bacteria 1765
379 Ga0207643_10494922 3300025908 Bacteria 781
380 Ga0207705_10112134 3300025909 Bacteria 2016
381 Ga0207705_10472657 3300025909 Bacteria 973
382 Ga0207654_10185413 3300025911 Bacteria 1360
383 Ga0207707_10464432 3300025912 Bacteria 1082
384 Ga0207671_10371364 3300025914 Bacteria 1136
385 Ga0207662_10055896 3300025918 Bacteria 2356
386 Ga0207662_10280254 3300025918 Bacteria 1103
387 Ga0207657_10392660 3300025919 Bacteria 1092
388 Ga0207657_10876402 3300025919 Bacteria 692
389 Ga0207649_10378791 3300025920 Bacteria 1054
390 Ga0207649_10475508 3300025920 Bacteria 947
391 Ga0207652_10080170 3300025921 Bacteria 2853
392 Ga0207652_11887522 3300025921 Bacteria 503
393 Ga0207681_10001182 3300025923 Bacteria 16814
394 Ga0207681_10148132 3300025923 Bacteria 1756
395 Ga0207681_10282769 3300025923 Bacteria 1307
396 Ga0207681_10405799 3300025923 Bacteria 1101
397 Ga0207694_10155762 3300025924 Bacteria 1843
398 Ga0207694_10517432 3300025924 Bacteria 1000
399 Ga0207694_11585184 3300025924 Bacteria 552
400 Ga0207650_10010632 3300025925 Bacteria 6320
401 Ga0207650_10028913 3300025925 Bacteria 3979
402 Ga0207650_10091718 3300025925 Bacteria 2322
403 Ga0207650_10134087 3300025925 Bacteria 1941
404 Ga0207650_10437193 3300025925 Bacteria 1087
405 Ga0207650_10504728 3300025925 Bacteria 1011
406 Ga0207650_10534057 3300025925 Bacteria 982
407 Ga0207659_10004627 3300025926 Bacteria 8330
408 Ga0207659_10047679 3300025926 Bacteria 3031
409 Ga0207659_10233911 3300025926 Bacteria 1483
410 Ga0207659_10870644 3300025926 Bacteria 774
411 Ga0207659_11412116 3300025926 Bacteria 597
412 Ga0207687_10028704 3300025927 Bacteria 3739
413 Ga0207687_10094679 3300025927 Bacteria 2186
414 Ga0207687_10145771 3300025927 Bacteria 1801
415 Ga0207687_10162622 3300025927 Bacteria 1715
416 Ga0207687_10335628 3300025927 Bacteria 1227
417 Ga0207644_10001148 3300025931 Bacteria 16970
418 Ga0207644_10151826 3300025931 Bacteria 1793
419 Ga0207644_10183845 3300025931 Bacteria 1640
420 Ga0207644_10324317 3300025931 Bacteria 1246
421 Ga0207644_10595524 3300025931 Bacteria 918
422 Ga0207644_10683964 3300025931 Bacteria 855
423 Ga0207644_10907645 3300025931 Bacteria 738
424 Ga0207690_10025759 3300025932 Bacteria 3697
425 Ga0207706_10005014 3300025933 Bacteria 12365
426 Ga0207706_10008944 3300025933 Bacteria 9219
427 Ga0207706_10136914 3300025933 Bacteria 2154
428 Ga0207706_10649949 3300025933 Bacteria 903
429 Ga0207706_10757959 3300025933 Bacteria 827
430 Ga0207686_10010195 3300025934 Bacteria 5109
431 Ga0207686_10111026 3300025934 Bacteria 1849
432 Ga0207686_10449941 3300025934 Bacteria 990
433 Ga0207709_10120440 3300025935 Bacteria 1771
434 Ga0207709_10253064 3300025935 Bacteria 1288
435 Ga0207670_10311952 3300025936 Bacteria 1235
436 Ga0207669_10001551 3300025937 Bacteria 9799
437 Ga0207669_10005388 3300025937 Bacteria 5736
438 Ga0207704_10001559 3300025938 Bacteria 10283
439 Ga0207704_10158231 3300025938 Bacteria 1608
440 Ga0207704_10284818 3300025938 Bacteria 1258
441 Ga0207691_10006775 3300025940 Bacteria 11048
442 Ga0207691_10035486 3300025940 Bacteria 4627
443 Ga0207691_10128626 3300025940 Bacteria 2239
444 Ga0207691_10158509 3300025940 Bacteria 1987
445 Ga0207691_10176906 3300025940 Bacteria 1866
446 Ga0207691_10195662 3300025940 Bacteria 1762
447 Ga0207691_10249057 3300025940 Bacteria 1534
448 Ga0207691_10371934 3300025940 Bacteria 1221
449 Ga0207711_10008158 3300025941 Bacteria 8767
450 Ga0207711_10014403 3300025941 Bacteria 6566
451 Ga0207711_10023311 3300025941 Bacteria 5180
452 Ga0207711_10080962 3300025941 Bacteria 2837
453 Ga0207711_10178426 3300025941 Bacteria 1930
454 Ga0207689_10000434 3300025942 Bacteria 39188
455 Ga0207689_10019028 3300025942 Bacteria 5791
456 Ga0207689_10037894 3300025942 Bacteria 3996
457 Ga0207679_10020114 3300025945 Bacteria 4500
458 Ga0207679_10022827 3300025945 Bacteria 4266
459 Ga0207679_10116461 3300025945 Bacteria 2119
460 Ga0207679_10190137 3300025945 Bacteria 1706
461 Ga0207679_10460384 3300025945 Bacteria 1129
462 Ga0207679_10562894 3300025945 Bacteria 1024
463 Ga0207679_10844934 3300025945 Bacteria 836
464 Ga0207679_11202578 3300025945 Bacteria 696
465 Ga0207651_10012882 3300025960 Bacteria 4756
466 Ga0207651_10019729 3300025960 Bacteria 4049
467 Ga0207651_10020801 3300025960 Bacteria 3970
468 Ga0207712_10013091 3300025961 Bacteria 5315
469 Ga0207712_10196530 3300025961 Bacteria 1596
470 Ga0207668_10126619 3300025972 Bacteria 1943
471 Ga0207668_10142600 3300025972 Bacteria 1844
472 Ga0207668_10585821 3300025972 Bacteria 970
473 Ga0207640_10268981 3300025981 Bacteria 1332
474 Ga0207640_11294810 3300025981 Bacteria 650
475 Ga0207658_10000919 3300025986 Bacteria 24357
476 Ga0207658_10112311 3300025986 Bacteria 2156
477 Ga0207658_10168813 3300025986 Bacteria 1800
478 Ga0207658_10220243 3300025986 Bacteria 1596
479 Ga0207658_10251038 3300025986 Bacteria 1503
480 Ga0207658_10907389 3300025986 Bacteria 802
481 Ga0207658_11125277 3300025986 Bacteria 717
482 Ga0207658_11342568 3300025986 Bacteria 654
483 Ga0207677_10017839 3300026023 Bacteria 4245
484 Ga0207677_10033861 3300026023 Bacteria 3301
485 Ga0207677_10035225 3300026023 Bacteria 3249
486 Ga0207677_10035376 3300026023 Bacteria 3244
487 Ga0207677_10280794 3300026023 Bacteria 1367
488 Ga0207677_10488076 3300026023 Bacteria 1063
489 Ga0207677_10684453 3300026023 Bacteria 908
490 Ga0207703_10001261 3300026035 Bacteria 23644
491 Ga0207703_10001970 3300026035 Bacteria 18125
492 Ga0207703_10002373 3300026035 Bacteria 16378
493 Ga0207703_10988335 3300026035 Bacteria 807
494 Ga0207639_10802253 3300026041 Bacteria 877
495 Ga0207639_11420215 3300026041 Bacteria 651
496 Ga0207678_10001398 3300026067 Bacteria 22186
497 Ga0207678_10379050 3300026067 Bacteria 1223
498 Ga0207678_10898111 3300026067 Bacteria 783
499 Ga0207708_10061204 3300026075 Bacteria 2874
500 Ga0207702_10052485 3300026078 Bacteria 3450
501 Ga0207641_10016987 3300026088 Bacteria 5958
502 Ga0207641_10044666 3300026088 Bacteria 3727
503 Ga0207641_10114930 3300026088 Bacteria 2392
504 Ga0207641_10173790 3300026088 Bacteria 1968
505 Ga0207641_11393028 3300026088 Bacteria 702
506 Ga0207641_11827148 3300026088 Bacteria 609
507 Ga0207648_10008112 3300026089 Bacteria 10223
508 Ga0207648_10018309 3300026089 Bacteria 6345
509 Ga0207648_10080262 3300026089 Bacteria 2846
510 Ga0207648_10115638 3300026089 Bacteria 2357
511 Ga0207648_10125461 3300026089 Bacteria 2258
512 Ga0207648_10180609 3300026089 Bacteria 1868
513 Ga0207648_10492564 3300026089 Bacteria 1121
514 Ga0207648_10650040 3300026089 Bacteria 974
515 Ga0207648_11842755 3300026089 Bacteria 567
516 Ga0207676_10007534 3300026095 Bacteria 7723
517 Ga0207676_10282964 3300026095 Bacteria 1506
518 Ga0207676_10342121 3300026095 Bacteria 1380
519 Ga0207676_10793842 3300026095 Bacteria 923
520 Ga0207676_11439886 3300026095 Bacteria 685
521 Ga0207674_10102261 3300026116 Bacteria 2846
522 Ga0207675_100003404 3300026118 Bacteria 15531
523 Ga0207675_100004173 3300026118 Bacteria 13984
524 Ga0207675_100129706 3300026118 Bacteria 2390
525 Ga0207675_100185788 3300026118 Bacteria 1992
526 Ga0207675_100484809 3300026118 Bacteria 1229
527 Ga0207683_10009152 3300026121 Bacteria 8438
528 Ga0207683_10016268 3300026121 Bacteria 6329
529 Ga0207683_10025042 3300026121 Bacteria 5145
530 Ga0207683_10032049 3300026121 Bacteria 4564
531 Ga0207683_10196031 3300026121 Bacteria 1835
532 Ga0207683_10205685 3300026121 Bacteria 1790
533 Ga0207683_10258835 3300026121 Bacteria 1589
534 Ga0207683_10524385 3300026121 Bacteria 1095
535 Ga0207698_10139615 3300026142 Bacteria 2085
536 Ga0207698_10213165 3300026142 Bacteria 1739
537 Ga0207698_10310966 3300026142 Bacteria 1471
538 Ga0207698_10549872 3300026142 Bacteria 1131
539 Ga0207698_10698483 3300026142 Bacteria 1009
540 Ga0207698_11272170 3300026142 Bacteria 750
541 Ga0207698_11884530 3300026142 Bacteria 613
542 Ga0209996_1040118 3300027395 Bacteria 695
543 Ga0209813_10095307 3300027866 Bacteria 1005
544 Ga0209974_10141354 3300027876 Bacteria 864
545 Ga0268266_10021697 3300028379 Bacteria 5472
546 Ga0268265_10116371 3300028380 Bacteria 2193
547 Ga0268265_10280671 3300028380 Bacteria 1490
548 Ga0268265_11405320 3300028380 Bacteria 700
549 Ga0268265_12332343 3300028380 Bacteria 542
550 Ga0268264_10221171 3300028381 Bacteria 1743
551 Ga0268264_11008959 3300028381 Bacteria 839
552 Ga0268264_11150216 3300028381 Bacteria 785
553 Ga0307517_10003945 3300028786 Bacteria 22979
554 Ga0307517_10202620 3300028786 Bacteria 1237
555 Ga0307517_10217429 3300028786 Bacteria 1167
556 Ga0307517_10219250 3300028786 Bacteria 1159
557 Ga0307517_10433658 3300028786 Bacteria 686
558 Ga0307517_10541296 3300028786 Bacteria 584
559 Ga0307515_10001963 3300028794 Bacteria 45524
560 Ga0307515_10123383 3300028794 Bacteria 2914
561 Ga0307515_10125314 3300028794 Bacteria 2875
562 Ga0307515_10316895 3300028794 Bacteria 1229
563 Ga0307515_10706779 3300028794 Bacteria 624
564 Ga0307512_10145574 3300030522 Bacteria 1434
565 Ga0265332_10000005 3300031238 Bacteria 377525
566 Ga0265328_10299365 3300031239 Bacteria 621
567 Ga0265327_10145225 3300031251 Bacteria 1106
568 Ga0307513_10008993 3300031456 Bacteria 12672
569 Ga0307513_10092040 3300031456 Bacteria 3088
570 Ga0307513_10397128 3300031456 Bacteria 1114
571 Ga0307513_10578682 3300031456 Bacteria 833
572 Ga0307509_10000120 3300031507 Bacteria 114238
573 Ga0307509_10103774 3300031507 Bacteria 2870
574 Ga0307509_10167235 3300031507 Bacteria 2085
575 Ga0307508_10001852 3300031616 Bacteria 23364
576 Ga0307508_10331187 3300031616 Bacteria 1114
577 Ga0307514_10001234 3300031649 Bacteria 33757
578 Ga0307514_10454863 3300031649 Bacteria 628
579 Ga0307516_10000446 3300031730 Bacteria 54416
580 Ga0307516_10003308 3300031730 Bacteria 20859
581 Ga0307516_10004343 3300031730 Bacteria 17529
582 Ga0307516_10058266 3300031730 Bacteria 3760
583 Ga0307516_10164988 3300031730 Bacteria 1961
584 Ga0307405_10491856 3300031731 Bacteria 981
585 Ga0307405_11203498 3300031731 Bacteria 655
586 Ga0307413_10001777 3300031824 Bacteria 8441
587 Ga0307413_11952654 3300031824 Bacteria 528
588 Ga0307410_10017890 3300031852 Bacteria 4268
589 Ga0307410_10423699 3300031852 Bacteria 1080
590 Ga0307410_11007349 3300031852 Bacteria 718
591 Ga0307406_10054426 3300031901 Bacteria 2554
592 Ga0307406_10065314 3300031901 Bacteria 2365
593 Ga0307406_11172875 3300031901 Bacteria 666
594 Ga0307412_10009110 3300031911 Bacteria 5688
595 Ga0307412_10133515 3300031911 Bacteria 1807
596 Ga0307412_10756166 3300031911 Bacteria 839
597 Ga0307409_100096492 3300031995 Bacteria 2439
598 Ga0307409_100328405 3300031995 Bacteria 1434
599 Ga0307416_100108492 3300032002 Bacteria 2439
600 Ga0307416_100129798 3300032002 Bacteria 2266
601 Ga0307416_100338551 3300032002 Bacteria 1516
602 Ga0307416_100650413 3300032002 Bacteria 1139
603 Ga0307416_100707612 3300032002 Bacteria 1097
604 Ga0307414_10022421 3300032004 Bacteria 3982
605 Ga0307414_10155880 3300032004 Bacteria 1808
606 Ga0307414_10425722 3300032004 Bacteria 1159
607 Ga0307414_10784864 3300032004 Bacteria 868
608 Ga0307411_10019646 3300032005 Bacteria 3908
609 Ga0307411_10070010 3300032005 Bacteria 2372
610 Ga0307415_100277927 3300032126 Bacteria 1375
611 Ga0307510_10042231 3300033180 Bacteria 4971
612 Ga0307510_10057893 3300033180 Bacteria 4017
613 Ga0307510_10215446 3300033180 Bacteria 1438
614 Ga0373940_0330400 3300035088 Bacteria 531
615 Ga0373949_0150133 3300035090 Bacteria 673
616 Ga0373952_0107137 3300035092 Bacteria 744
617 Ga0373923_0067015 3300035111 Bacteria 1535
618 Ga0373932_0034596 3300035112 Bacteria 1424
619 Ga0373924_0092876 3300035410 Bacteria 1292
620 Ga0373931_0039742 3300035691 Bacteria 2465
621 Ga0373931_0125515 3300035691 Bacteria 1471
622 Ga0373935_0311509 3300035692 Bacteria 1115
623 Ga0373935_0675594 3300035692 Bacteria 759
624 Ga0373937_0194889 3300036401 Bacteria 1904
625 Ga0373925_0374545 3300037068 Bacteria 1159
626 Ga0373925_1426003 3300037068 Bacteria 567
627 Ga0395900_0000046 3300037418 Bacteria 230114
628 Ga0395898_0000337 3300037466 Bacteria 106044
629 Ga0395905_0008815 3300037471 Bacteria 9912
630 Ga0395905_0022756 3300037471 Bacteria 5925
631 Ga0395905_0024666 3300037471 Bacteria 5674
632 Ga0395905_0031032 3300037471 Bacteria 5033
633 Ga0395905_0373849 3300037471 Bacteria 1319
634 Ga0395905_0557239 3300037471 Bacteria 1047
635 Ga0436364_0740767 3300037853 Bacteria 1134
636 Ga0436360_0796923 3300039438 Bacteria 1127
637 Ga0436363_1352042 3300039450 Bacteria 800
638 Ga0439439_0036916 3300041406 Bacteria 1258
639 Ga0439461_0031277 3300041410 Bacteria 1111
640 Ga0451787_240345 3300041441 Bacteria 553
641 Ga0451797_0523275 3300041453 Bacteria 805
642 Ga0451795_1183208 3300041456 Bacteria 663
643 Ga0451800_0382937 3300041459 Bacteria 897
644 Ga0451802_0601236 3300041460 Bacteria 999
645 Ga0451804_0856991 3300041463 Bacteria 1752
646 Ga0451839_1418667 3300041496 Bacteria 1189
647 Ga0451851_0168290 3300041507 Bacteria 975
648 Ga0451853_0894190 3300041512 Bacteria 695
649 Ga0451853_2946434 3300041512 Bacteria 1593
650 Ga0451853_3917193 3300041512 Bacteria 1573
651 Ga0439431_0065654 3300041997 Bacteria 961
652 Ga0439448_0342442 3300042005 Bacteria 533
653 Ga0439432_141029 3300042006 Bacteria 709
654 Ga0439449_0009909 3300042007 Bacteria 3603
655 Ga0439449_0279172 3300042007 Bacteria 629
656 Ga0439450_046084 3300042008 Bacteria 1025
657 Ga0439462_0010920 3300042015 Bacteria 2307
658 Ga0450891_034854 3300042129 Bacteria 530
659 Ga0450896_007553 3300042133 Bacteria 1499
660 Ga0450898_049456 3300042134 Bacteria 810
661 Ga0450898_092279 3300042134 Bacteria 626
662 Ga0439446_0153071 3300042156 Bacteria 759
663 Ga0439434_0121858 3300042435 Bacteria 851
664 Ga0439464_0021007 3300042439 Bacteria 1790
665 Ga0450893_0052174 3300042532 Bacteria 768
666 Ga0451577_0013602 3300042876 Bacteria 7609
667 Ga0451577_0119176 3300042876 Bacteria 2364
668 Ga0451577_0301213 3300042876 Bacteria 1453
669 Ga0451577_0478789 3300042876 Bacteria 1130
670 Ga0451577_0858710 3300042876 Bacteria 818
671 Ga0451577_1601691 3300042876 Bacteria 574
672 Ga0466969_0021100 3300044656 Bacteria 3370
673 Ga0466972_0049033 3300044658 Bacteria 2040
674 Ga0466965_0017983 3300044683 Bacteria 3382
675 Ga0466965_0036684 3300044683 Bacteria 2405
676 Ga0466965_0076749 3300044683 Bacteria 1686
677 Ga0466965_0107680 3300044683 Bacteria 1430
678 Ga0466966_0038230 3300044684 Bacteria 3093
679 Ga0466961_0063794 3300044693 Bacteria 2341
680 Ga0466961_0128939 3300044693 Bacteria 1585
681 Ga0466961_0151746 3300044693 Bacteria 1446
682 Ga0466961_0987007 3300044693 Bacteria 500
683 Ga0466964_0005718 3300044706 Bacteria 4630
684 Ga0453684_0006975 3300044712 Bacteria 21145
685 Ga0453684_0118848 3300044712 Bacteria 3196
686 Ga0453684_0171320 3300044712 Bacteria 2558
687 Ga0453684_0598429 3300044712 Bacteria 1209
688 Ga0453684_0664533 3300044712 Bacteria 1136
689 Ga0466971_0025141 3300044719 Bacteria 2659
690 Ga0466970_0059902 3300044765 Bacteria 2039
691 Ga0466970_0086006 3300044765 Bacteria 1704
692 Ga0466970_0162247 3300044765 Bacteria 1236
693 Ga0466957_0018549 3300044842 Bacteria 4086
694 Ga0466960_0103044 3300044901 Bacteria 1473
695 Ga0466960_0295439 3300044901 Bacteria 911
696 Ga0466959_0000018 3300045049 Bacteria 136580
697 Ga0466959_0045352 3300045049 Bacteria 3237
698 Ga0466959_0392037 3300045049 Bacteria 944
699 Ga0451576_0005710 3300045051 Bacteria 15519
700 Ga0451576_0134527 3300045051 Bacteria 2578
701 Ga0451576_0249209 3300045051 Bacteria 1856
702 Ga0451576_0268416 3300045051 Bacteria 1784
703 Ga0451576_0323301 3300045051 Bacteria 1614
704 Ga0451576_0438495 3300045051 Bacteria 1371
705 Ga0451576_1011838 3300045051 Bacteria 871
706 Ga0466958_0043685 3300045836 Bacteria 2699
707 Ga0495592_0000222 3300046454 Bacteria 48902
708 Ga0495603_0316010 3300046455 Bacteria 897
709 Ga0495629_0114457 3300046459 Bacteria 1880
710 Ga0495629_0331275 3300046459 Bacteria 1040
711 Ga0495638_0061534 3300046460 Bacteria 2320
712 Ga0495653_0348008 3300046463 Bacteria 954
713 Ga0495606_0112453 3300046507 Bacteria 1641
714 Ga0495610_0029327 3300046512 Bacteria 2899
715 Ga0495610_0191618 3300046512 Bacteria 843
716 Ga0495630_0059525 3300046517 Bacteria 2866
717 Ga0495632_0028085 3300046519 Bacteria 2939
718 Ga0495632_0151470 3300046519 Bacteria 1072
719 Ga0495643_0532218 3300046522 Bacteria 502
720 Ga0495648_0117205 3300046524 Bacteria 1438
721 Ga0495648_0129470 3300046524 Bacteria 1344
722 Ga0495648_0166761 3300046524 Bacteria 1133
723 Ga0495648_0173678 3300046524 Bacteria 1102
724 Ga0495648_0192493 3300046524 Bacteria 1028
725 Ga0495666_0276048 3300046526 Bacteria 762
726 Ga0495645_0040413 3300046543 Bacteria 3403
727 Ga0495667_0717763 3300046559 Bacteria 619
728 Ga0495668_0039775 3300046616 Bacteria 2625
729 Ga0495611_0118144 3300046648 Bacteria 1236
730 Ga0495611_0285957 3300046648 Bacteria 761
731 Ga0495611_0448433 3300046648 Bacteria 588
732 Ga0495625_0043197 3300046660 Bacteria 3270
733 Ga0495625_0630614 3300046660 Bacteria 640
734 Ga0495647_0051148 3300046681 Bacteria 1605
735 Ga0495647_0211049 3300046681 Bacteria 854
736 Ga0495658_0057562 3300046683 Bacteria 2221
737 Ga0495658_0283031 3300046683 Bacteria 1046
738 Ga0495658_0530966 3300046683 Bacteria 753
739 Ga0495613_0038393 3300046689 Bacteria 3550
740 Ga0495624_0272275 3300046690 Bacteria 1023
741 Ga0495624_0460748 3300046690 Bacteria 761
742 Ga0495624_0511130 3300046690 Bacteria 718
743 Ga0495671_0232569 3300046692 Bacteria 891
744 Ga0495649_0005310 3300046694 Bacteria 8223
745 Ga0495649_0308844 3300046694 Bacteria 804
746 Ga0495660_0033400 3300046810 Bacteria 2885
747 Ga0495581_0401021 3300047315 Bacteria 800
748 Ga0495676_0007289 3300047321 Bacteria 10143
749 Ga0495687_005082 3300047443 Bacteria 8538
750 Ga0495687_005169 3300047443 Bacteria 8445
751 Ga0495675_0265118 3300047444 Bacteria 1028
752 Ga0495602_0767344 3300048088 Bacteria 650
753 Ga0495626_0101951 3300048091 Bacteria 1250
754 Ga0496101_0230655 3300048904 Bacteria 1439
755 Ga0496101_0427006 3300048904 Bacteria 1045
756 Ga0496101_0797537 3300048904 Bacteria 745
757 Ga0496104_0270186 3300048907 Bacteria 1613
758 Ga0496105_1011913 3300048908 Bacteria 621
759 Ga0496106_0137256 3300048909 Bacteria 1922
760 Ga0496108_0072318 3300048911 Bacteria 2911
761 Ga0496109_0086583 3300048912 Bacteria 2894
762 Ga0496109_0232679 3300048912 Bacteria 1734
763 Ga0496109_0606459 3300048912 Bacteria 1031
764 Ga0496109_0930198 3300048912 Bacteria 807
765 Ga0496110_0177965 3300048913 Bacteria 1931
766 Ga0496110_0187253 3300048913 Bacteria 1879
767 Ga0496110_0866084 3300048913 Bacteria 809
768 Ga0496113_0420182 3300048916 Bacteria 1074
769 Ga0496114_0030618 3300048917 Bacteria 4429
770 Ga0496114_0451962 3300048917 Bacteria 1138
771 Ga0496114_1398560 3300048917 Bacteria 587
772 Ga0496118_0258953 3300048921 Bacteria 983
773 Ga0496121_0114878 3300048924 Bacteria 2045
774 Ga0496122_0062528 3300048925 Bacteria 2725
775 Ga0496124_0001079 3300048927 Bacteria 43104
776 Ga0496125_0300251 3300048928 Bacteria 984
777 Ga0496126_0052580 3300048929 Bacteria 3701
778 Ga0501292_004551 3300049515 Bacteria 1899
779 Ga0501294_005745 3300049517 Bacteria 1178
780 Ga0501298_020690 3300049521 Bacteria 1228
781 Ga0501043_0000112 3300049579 Bacteria 76249
782 Ga0501046_0000146 3300049580 Bacteria 74204
783 Ga0501047_0000192 3300049581 Bacteria 74300
784 Ga0501048_0000494 3300049582 Bacteria 27525
785 Ga0501199_034415 3300049650 Bacteria 636
786 Ga0501206_024501 3300049653 Bacteria 874
787 Ga0501222_004039 3300049662 Bacteria 1988
788 Ga0501261_103603 3300049690 Bacteria 544
789 Ga0501079_1000169 3300049741 Bacteria 659
790 Ga0501241_110953 3300049758 Bacteria 600
791 Ga0501265_000654 3300049762 Bacteria 3761
792 Ga0501265_041189 3300049762 Bacteria 699
793 Ga0501272_014406 3300049769 Bacteria 913
794 Ga0501273_019133 3300049770 Bacteria 916
795 Ga0501045_0033249 3300049824 Bacteria 3739
796 nmdc:mga03683_29781_c1 3300050489 Bacteria 2180
797 nmdc:mga03n38_231673_c1 3300050490 Bacteria 968
798 nmdc:mga03n38_29635_c1 3300050490 Bacteria 2293
799 nmdc:mga00v17_168316_c1 3300050491 Bacteria 1412
800 nmdc:mga0yw44_250244_c1 3300050492 Bacteria 1179
801 nmdc:mga0k408_14694_c1 3300050493 Bacteria 4319
802 nmdc:mga0k408_16418_c1 3300050493 Bacteria 4109
803 nmdc:mga0k408_186398_c1 3300050493 Bacteria 1238
804 nmdc:mga0k408_278_c1 3300050493 Bacteria 27806
805 nmdc:mga0k408_347916_c1 3300050493 Bacteria 884
806 nmdc:mga0k408_413551_c1 3300050493 Bacteria 802
807 nmdc:mga0k408_45047_c1 3300050493 Bacteria 2545
808 nmdc:mga0k408_4561_c1 3300050493 Bacteria 7355
809 nmdc:mga0k408_531509_c1 3300050493 Bacteria 696
810 nmdc:mga0k408_673_c1 3300050493 Bacteria 14077
811 nmdc:mga0k408_81267_c1 3300050493 Bacteria 1897
812 nmdc:mga06z11_10569_c1 3300050494 Bacteria 3941
813 nmdc:mga06z11_174586_c1 3300050494 Bacteria 1236
814 nmdc:mga04h51_112706_c1 3300050495 Bacteria 1005
815 nmdc:mga04h51_212232_c1 3300050495 Bacteria 764
816 nmdc:mga07m45_164377_c1 3300050496 Bacteria 1289
817 nmdc:mga07m45_175678_c1 3300050496 Bacteria 1245
818 nmdc:mga07m45_1841_c1 3300050496 Bacteria 9795
819 nmdc:mga07m45_202_c1 3300050496 Bacteria 23538
820 nmdc:mga07m45_3252_c1 3300050496 Bacteria 5604
821 nmdc:mga07m45_34102_c1 3300050496 Bacteria 2828
822 nmdc:mga07m45_806385_c1 3300050496 Bacteria 538
823 nmdc:mga09592_3023_c1 3300050508 Bacteria 13643
824 nmdc:mga0rr50_920498_c1 3300050513 Bacteria 745
825 nmdc:mga0a205_696905_c1 3300050515 Bacteria 865
826 nmdc:mga0sz30_1130_c1 3300050516 Bacteria 9568
827 Ga0495601_0936045 3300053077 Bacteria 546
828 Ga0495619_0080902 3300053085 Bacteria 2187
829 Ga0500578_0429904 3300053086 Bacteria 755
830 Ga0500644_0008551 3300053088 Bacteria 2704
831 Ga0500646_0103674 3300053090 Bacteria 896
832 Ga0500647_0201828 3300053091 Bacteria 901
833 Ga0500651_0101424 3300053093 Bacteria 1764
834 Ga0500651_0126939 3300053093 Bacteria 1545
835 Ga0500556_0149119 3300053104 Bacteria 921
836 Ga0500614_270478 3300053123 Bacteria 531
837 Ga0500658_0016475 3300053134 Bacteria 2753
838 Ga0500559_0000011 3300053136 Bacteria 164751
839 Ga0500568_0080668 3300053139 Bacteria 1235
840 Ga0500622_0001778 3300053156 Bacteria 16474
841 Ga0500622_0008597 3300053156 Bacteria 5700
842 Ga0500627_0033373 3300053158 Bacteria 2175
843 Ga0500636_0139679 3300053177 Bacteria 1342
844 Ga0500645_007629 3300053730 Bacteria 3751
845 Ga0500587_004482 3300053739 Bacteria 1916
846 Ga0500661_030516 3300055283 Bacteria 952
847 Ga0590071_007255 3300059421 Bacteria 2624
848 Ga0501082_0517732 3300060353 Bacteria 1043
849 Ga0466962_0009549 3300061719 Bacteria 4652
850 2644304763 2643221654 Bacteria 5273570
851 2831868206 2831864461 Bacteria 6502356
852 rootL2_10033474
853 Ga0055526_1012714
854 Ga0065165_1000449
855 Ga0070658_10590914
856 Ga0070658_10613018
857 Ga0070658_11112721
858 Ga0070676_10000967
859 Ga0070676_10136658
860 Ga0070683_100904792
861 Ga0070683_102230556
862 Ga0070690_100002198
863 Ga0070690_100285862
864 Ga0070670_100011824
865 Ga0070670_100017606
866 Ga0070670_100049024
867 Ga0070670_100072801
868 Ga0070670_100098984
869 Ga0070670_100215092
870 Ga0070670_100390869
871 Ga0070670_100564031
872 Ga0070677_10092549
873 Ga0070677_10107157
874 Ga0070677_10163663
875 Ga0070677_10298659
876 Ga0068869_100008823
877 Ga0068869_100035574
878 Ga0070666_10006161
879 Ga0070666_10026526
880 Ga0070666_10247718
881 Ga0070666_10270583
882 Ga0070666_11458174
883 Ga0070680_100103902
884 Ga0068868_100007098
885 Ga0068868_100013553
886 Ga0068868_100027139
887 Ga0068868_100044531
888 Ga0068868_100633145
889 Ga0070660_100556690
890 Ga0070660_100597452
891 Ga0070689_100101440
892 Ga0070689_100356132
893 Ga0070687_100213947
894 Ga0070661_100120688
895 Ga0070661_100130589
896 Ga0070661_100147852
897 Ga0070661_100714038
898 Ga0070692_10104138
899 Ga0070668_100090225
900 Ga0070668_100174614
901 Ga0070669_100000946
902 Ga0070669_100020703
903 Ga0070669_100200875
904 Ga0070669_100661378
905 Ga0070669_100730891
906 Ga0070669_100803065
907 Ga0070675_100008295
908 Ga0070675_100014275
909 Ga0070675_100037215
910 Ga0070675_100082739
911 Ga0070675_100175081
912 Ga0070675_100877900
913 Ga0070675_100987962
914 Ga0070671_100008962
915 Ga0070671_100011128
916 Ga0070671_100017122
917 Ga0070671_100101990
918 Ga0070671_100283727
919 Ga0070671_100329261
920 Ga0070671_100443298
921 Ga0070671_100479894
922 Ga0070671_100548362
923 Ga0070671_101001870
924 Ga0070674_100012121
925 Ga0070674_100033663
926 Ga0070674_101116460
927 Ga0070673_100026508
928 Ga0070673_100026514
929 Ga0070673_100244228
930 Ga0070673_100955031
931 Ga0070688_100038432
932 Ga0070688_100931759
933 Ga0070659_101183217
934 Ga0070667_100000838
935 Ga0070667_100017170
936 Ga0070667_100300113
937 Ga0070667_100651188
938 Ga0070667_100843539
939 Ga0070701_10092090
940 Ga0070701_10203352
941 Ga0070700_100084057
942 Ga0070708_101257119
943 Ga0070663_100442628
944 Ga0070678_100008031
945 Ga0070678_100046726
946 Ga0070678_100048676
947 Ga0070678_100058748
948 Ga0070678_100148975
949 Ga0070678_100186720
950 Ga0070678_100398733
951 Ga0070662_100010330
952 Ga0070662_100030591
953 Ga0070662_100706907
954 Ga0068867_100018562
955 Ga0068867_100044264
956 Ga0068867_100054576
957 Ga0068867_100154791
958 Ga0068867_100287863
959 Ga0068867_100987346
960 Ga0070685_10288847
961 Ga0070707_102027726
962 Ga0070679_100019248
963 Ga0070684_100640130
964 Ga0070684_100955814
965 Ga0068853_100451930
966 Ga0068853_100569999
967 Ga0070672_100000222
968 Ga0070672_100001613
969 Ga0070672_100023405
970 Ga0070672_100040505
971 Ga0070672_100064145
972 Ga0070672_100120093
973 Ga0070672_100122310
974 Ga0070672_100383952
975 Ga0070672_100466735
976 Ga0070672_101604325
977 Ga0070686_100101554
978 Ga0070693_100164108
979 Ga0070665_100031694
980 Ga0070665_100378045
981 Ga0070665_101263834
982 Ga0070665_101390512
983 Ga0068855_100430824
984 Ga0070664_100021811
985 Ga0070664_100078943
986 Ga0070664_100080686
987 Ga0070664_100087764
988 Ga0070664_100218724
989 Ga0070664_100337822
990 Ga0070664_100375655
991 Ga0070664_100486661
992 Ga0070664_100678333
993 Ga0068854_100156399
994 Ga0068854_100214065
995 Ga0068856_100032509
996 Ga0068856_101095995
997 Ga0070702_100175699
998 Ga0068852_100009386
999 Ga0068852_100371942
1000 Ga0068852_100388278
1001 Ga0068852_100644999
1002 Ga0068852_100676503
1003 Ga0068852_101114605
1004 Ga0068852_101314700
1005 Ga0068859_100008408
1006 Ga0068859_100133886
1007 Ga0068859_100228669
1008 Ga0068859_100434691
1009 Ga0068864_100002444
1010 Ga0068864_100006343
1011 Ga0068864_100006794
1012 Ga0068864_100013840
1013 Ga0068864_100036184
1014 Ga0068866_10001018
1015 Ga0068866_10130898
1016 Ga0068866_10434170
1017 Ga0068866_10931940
1018 Ga0068861_100006498
1019 Ga0068861_100090097
1020 Ga0068861_100314013
1021 Ga0068851_10021380
1022 Ga0068851_10029522
1023 Ga0068851_10038384
1024 Ga0068851_10299856
1025 Ga0068851_10329714
1026 Ga0068851_10455915
1027 Ga0068851_10902446
1028 Ga0068870_10050213
1029 Ga0068870_10348335
1030 Ga0068870_10489430
1031 Ga0068863_100004558
1032 Ga0068863_100014569
1033 Ga0068863_100020978
1034 Ga0068863_100063509
1035 Ga0068863_100079616
1036 Ga0068863_100193478
1037 Ga0068863_101600409
1038 Ga0068858_100000796
1039 Ga0068858_100001242
1040 Ga0068858_100007494
1041 Ga0068860_100000958
1042 Ga0068860_100109811
1043 Ga0068860_100321949
1044 Ga0068860_100351521
1045 Ga0068860_100730640
1046 Ga0068860_101049140
1047 Ga0068860_102089898
1048 Ga0068862_100006310
1049 Ga0068862_100123076
1050 Ga0075365_10280807
1051 Ga0075368_10019648
1052 Ga0075363_100027103
1053 Ga0075363_100317027
1054 Ga0075364_10361508
1055 Ga0070715_10373480
1056 Ga0070716_100163740
1057 Ga0075362_10001661
1058 Ga0075367_10001231
1059 Ga0075369_10008026
1060 Ga0075366_10000633
1061 Ga0075366_10010279
1062 Ga0075366_10012074
1063 Ga0075366_10024445
1064 Ga0075366_10027546
1065 Ga0075366_10062073
1066 Ga0075366_10086716
1067 Ga0075366_10190091
1068 Ga0075366_10247733
1069 Ga0075366_10307402
1070 Ga0075366_10544211
1071 Ga0097621_100017120
1072 Ga0097621_100026744
1073 Ga0097621_100068077
1074 Ga0097621_100070755
1075 Ga0097621_100134112
1076 Ga0097621_100200616
1077 Ga0097621_100280442
1078 Ga0097621_100903754
1079 Ga0097621_101173502
1080 Ga0075370_10000477
1081 Ga0075370_10007016
1082 Ga0075370_10008737
1083 Ga0075370_10030137
1084 Ga0075370_10132138
1085 Ga0075370_10910111
1086 Ga0068871_100008787
1087 Ga0068871_100028656
1088 Ga0068871_100031059
1089 Ga0068871_100041402
1090 Ga0068871_100089456
1091 Ga0068871_100116575
1092 Ga0068871_100122595
1093 Ga0068871_100235396
1094 Ga0068871_100240898
1095 Ga0068871_100786968
1096 Ga0068871_101332820
1097 Ga0068871_101540047
1098 Ga0075433_10791548
1099 Ga0075434_100376281
1100 Ga0075429_100004495
1101 Ga0068865_100002708
1102 Ga0068865_100275942
1103 Ga0068865_100294329
1104 Ga0097620_100008408
1105 Ga0097620_100133889
1106 Ga0097620_100228697
1107 Ga0097620_100434680
1108 Ga0105240_12212917
1109 Ga0105245_10033187
1110 Ga0105245_10080149
1111 Ga0105245_10407856
1112 Ga0105245_10461667
1113 Ga0105245_10625111
1114 Ga0105245_10720477
1115 Ga0105245_12190319
1116 Ga0105247_10782566
1117 Ga0114129_10189607
1118 Ga0105243_10013186
1119 Ga0105243_10112380
1120 Ga0105243_10320201
1121 Ga0105243_10361525
1122 Ga0105243_11659639
1123 Ga0105241_10016683
1124 Ga0105242_10020381
1125 Ga0105242_10030143
1126 Ga0105248_10006497
1127 Ga0105248_10014520
1128 Ga0105248_10029979
1129 Ga0105248_10030248
1130 Ga0105248_10044394
1131 Ga0105248_10052970
1132 Ga0105248_10148283
1133 Ga0105248_10194829
1134 Ga0105237_10423695
1135 Ga0105237_11804946
1136 Ga0105238_10088357
1137 Ga0105238_10352573
1138 Ga0105238_10501608
1139 Ga0105238_12213842
1140 Ga0105249_10007575
1141 Ga0105249_10018462
1142 Ga0105249_10020255
1143 Ga0105249_12921760
1144 Ga0157323_1024816
1145 Ga0157345_1026116
1146 Ga0157371_10076681
1147 Ga0157369_10022114
1148 Ga0157369_10940451
1149 Ga0157374_10023261
1150 Ga0157374_10031456
1151 Ga0157374_10187836
1152 Ga0157378_10034405
1153 Ga0157378_10309831
1154 Ga0163162_10002005
1155 Ga0163162_10018451
1156 Ga0163162_10022372
1157 Ga0163162_10029567
1158 Ga0163162_10042947
1159 Ga0163162_10127808
1160 Ga0163162_12196054
1161 Ga0157372_10015916
1162 Ga0157372_10082645
1163 Ga0157372_10485185
1164 Ga0157372_11324313
1165 Ga0157375_10004207
1166 Ga0157375_10007498
1167 Ga0157375_10013615
1168 Ga0157375_10016840
1169 Ga0157375_10121805
1170 Ga0157375_10226776
1171 Ga0157375_10266047
1172 Ga0157375_10285839
1173 Ga0157375_10475293
1174 Ga0157375_11186384
1175 Ga0157375_11258824
1176 Ga0157375_11448742
1177 Ga0163163_10024475
1178 Ga0163163_10421210
1179 Ga0163163_10591235
1180 Ga0163163_10945094
1181 Ga0163163_12010577
1182 Ga0157380_10000899
1183 Ga0157380_10278005
1184 Ga0157380_10393204
1185 Ga0157380_10627874
1186 Ga0157380_10668775
1187 Ga0157380_11795012
1188 Ga0157377_10094076
1189 Ga0157379_10006624
1190 Ga0157379_10037855
1191 Ga0157379_10068132
1192 Ga0157379_10089909
1193 Ga0157379_10112543
1194 Ga0157379_10297592
1195 Ga0157379_10452148
1196 Ga0157376_10007878
1197 Ga0157376_10011518
1198 Ga0157376_10022426
1199 Ga0157376_10070657
1200 Ga0157376_10100203
1201 Ga0157376_10136636
1202 Ga0157376_10662460
1203 Ga0157376_11204158
1204 Ga0157376_11690941
1205 Ga0182005_1237432
1206 Ga0163161_10174820
1207 Ga0163161_10247259
1208 Ga0163161_10524189
1209 Ga0163161_11046920
1210 Ga0213875_10369959
1211 Ga0207425_1041337
1212 Ga0209673_1032691
1213 Ga0209564_1000005
1214 Ga0209256_1046809
1215 Ga0209257_1029775
1216 Ga0207656_10062008
1217 Ga0207656_10189011
1218 Ga0207682_10001858
1219 Ga0207682_10134933
1220 Ga0207642_10009009
1221 Ga0207688_10064549
1222 Ga0207680_10003535
1223 Ga0207680_10136106
1224 Ga0207680_10166238
1225 Ga0207680_10370148
1226 Ga0207647_10125660
1227 Ga0207645_10001892
1228 Ga0207645_10002132
1229 Ga0207645_10112287
1230 Ga0207643_10494922
1231 Ga0207705_10112134
1232 Ga0207705_10472657
1233 Ga0207654_10185413
1234 Ga0207707_10464432
1235 Ga0207671_10371364
1236 Ga0207662_10055896
1237 Ga0207662_10280254
1238 Ga0207657_10392660
1239 Ga0207657_10876402
1240 Ga0207649_10378791
1241 Ga0207649_10475508
1242 Ga0207652_10080170
1243 Ga0207652_11887522
1244 Ga0207681_10001182
1245 Ga0207681_10148132
1246 Ga0207681_10282769
1247 Ga0207681_10405799
1248 Ga0207694_10155762
1249 Ga0207694_10517432
1250 Ga0207694_11585184
1251 Ga0207650_10010632
1252 Ga0207650_10028913
1253 Ga0207650_10091718
1254 Ga0207650_10134087
1255 Ga0207650_10437193
1256 Ga0207650_10504728
1257 Ga0207650_10534057
1258 Ga0207659_10004627
1259 Ga0207659_10047679
1260 Ga0207659_10233911
1261 Ga0207659_10870644
1262 Ga0207659_11412116
1263 Ga0207687_10028704
1264 Ga0207687_10094679
1265 Ga0207687_10145771
1266 Ga0207687_10162622
1267 Ga0207687_10335628
1268 Ga0207644_10001148
1269 Ga0207644_10151826
1270 Ga0207644_10183845
1271 Ga0207644_10324317
1272 Ga0207644_10595524
1273 Ga0207644_10683964
1274 Ga0207644_10907645
1275 Ga0207690_10025759
1276 Ga0207706_10005014
1277 Ga0207706_10008944
1278 Ga0207706_10136914
1279 Ga0207706_10649949
1280 Ga0207706_10757959
1281 Ga0207686_10010195
1282 Ga0207686_10111026
1283 Ga0207686_10449941
1284 Ga0207709_10120440
1285 Ga0207709_10253064
1286 Ga0207670_10311952
1287 Ga0207669_10001551
1288 Ga0207669_10005388
1289 Ga0207704_10001559
1290 Ga0207704_10158231
1291 Ga0207704_10284818
1292 Ga0207691_10006775
1293 Ga0207691_10035486
1294 Ga0207691_10128626
1295 Ga0207691_10158509
1296 Ga0207691_10176906
1297 Ga0207691_10195662
1298 Ga0207691_10249057
1299 Ga0207691_10371934
1300 Ga0207711_10008158
1301 Ga0207711_10014403
1302 Ga0207711_10023311
1303 Ga0207711_10080962
1304 Ga0207711_10178426
1305 Ga0207689_10000434
1306 Ga0207689_10019028
1307 Ga0207689_10037894
1308 Ga0207679_10020114
1309 Ga0207679_10022827
1310 Ga0207679_10116461
1311 Ga0207679_10190137
1312 Ga0207679_10460384
1313 Ga0207679_10562894
1314 Ga0207679_10844934
1315 Ga0207679_11202578
1316 Ga0207651_10012882
1317 Ga0207651_10019729
1318 Ga0207651_10020801
1319 Ga0207712_10013091
1320 Ga0207712_10196530
1321 Ga0207668_10126619
1322 Ga0207668_10142600
1323 Ga0207668_10585821
1324 Ga0207640_10268981
1325 Ga0207640_11294810
1326 Ga0207658_10000919
1327 Ga0207658_10112311
1328 Ga0207658_10168813
1329 Ga0207658_10220243
1330 Ga0207658_10251038
1331 Ga0207658_10907389
1332 Ga0207658_11125277
1333 Ga0207658_11342568
1334 Ga0207677_10017839
1335 Ga0207677_10033861
1336 Ga0207677_10035225
1337 Ga0207677_10035376
1338 Ga0207677_10280794
1339 Ga0207677_10488076
1340 Ga0207677_10684453
1341 Ga0207703_10001261
1342 Ga0207703_10001970
1343 Ga0207703_10002373
1344 Ga0207703_10988335
1345 Ga0207639_10802253
1346 Ga0207639_11420215
1347 Ga0207678_10001398
1348 Ga0207678_10379050
1349 Ga0207678_10898111
1350 Ga0207708_10061204
1351 Ga0207702_10052485
1352 Ga0207641_10016987
1353 Ga0207641_10044666
1354 Ga0207641_10114930
1355 Ga0207641_10173790
1356 Ga0207641_11393028
1357 Ga0207641_11827148
1358 Ga0207648_10008112
1359 Ga0207648_10018309
1360 Ga0207648_10080262
1361 Ga0207648_10115638
1362 Ga0207648_10125461
1363 Ga0207648_10180609
1364 Ga0207648_10492564
1365 Ga0207648_10650040
1366 Ga0207648_11842755
1367 Ga0207676_10007534
1368 Ga0207676_10282964
1369 Ga0207676_10342121
1370 Ga0207676_10793842
1371 Ga0207676_11439886
1372 Ga0207674_10102261
1373 Ga0207675_100003404
1374 Ga0207675_100004173
1375 Ga0207675_100129706
1376 Ga0207675_100185788
1377 Ga0207675_100484809
1378 Ga0207683_10009152
1379 Ga0207683_10016268
1380 Ga0207683_10025042
1381 Ga0207683_10032049
1382 Ga0207683_10196031
1383 Ga0207683_10205685
1384 Ga0207683_10258835
1385 Ga0207683_10524385
1386 Ga0207698_10139615
1387 Ga0207698_10213165
1388 Ga0207698_10310966
1389 Ga0207698_10549872
1390 Ga0207698_10698483
1391 Ga0207698_11272170
1392 Ga0207698_11884530
1393 Ga0209996_1040118
1394 Ga0209813_10095307
1395 Ga0209974_10141354
1396 Ga0268266_10021697
1397 Ga0268265_10116371
1398 Ga0268265_10280671
1399 Ga0268265_11405320
1400 Ga0268265_12332343
1401 Ga0268264_10221171
1402 Ga0268264_11008959
1403 Ga0268264_11150216
1404 Ga0307517_10003945
1405 Ga0307517_10202620
1406 Ga0307517_10217429
1407 Ga0307517_10219250
1408 Ga0307517_10433658
1409 Ga0307517_10541296
1410 Ga0307515_10001963
1411 Ga0307515_10123383
1412 Ga0307515_10125314
1413 Ga0307515_10316895
1414 Ga0307515_10706779
1415 Ga0307512_10145574
1416 Ga0265332_10000005
1417 Ga0265328_10299365
1418 Ga0265327_10145225
1419 Ga0307513_10008993
1420 Ga0307513_10092040
1421 Ga0307513_10397128
1422 Ga0307513_10578682
1423 Ga0307509_10000120
1424 Ga0307509_10103774
1425 Ga0307509_10167235
1426 Ga0307508_10001852
1427 Ga0307508_10331187
1428 Ga0307514_10001234
1429 Ga0307514_10454863
1430 Ga0307516_10000446
1431 Ga0307516_10003308
1432 Ga0307516_10004343
1433 Ga0307516_10058266
1434 Ga0307516_10164988
1435 Ga0307405_10491856
1436 Ga0307405_11203498
1437 Ga0307413_10001777
1438 Ga0307413_11952654
1439 Ga0307410_10017890
1440 Ga0307410_10423699
1441 Ga0307410_11007349
1442 Ga0307406_10054426
1443 Ga0307406_10065314
1444 Ga0307406_11172875
1445 Ga0307412_10009110
1446 Ga0307412_10133515
1447 Ga0307412_10756166
1448 Ga0307409_100096492
1449 Ga0307409_100328405
1450 Ga0307416_100108492
1451 Ga0307416_100129798
1452 Ga0307416_100338551
1453 Ga0307416_100650413
1454 Ga0307416_100707612
1455 Ga0307414_10022421
1456 Ga0307414_10155880
1457 Ga0307414_10425722
1458 Ga0307414_10784864
1459 Ga0307411_10019646
1460 Ga0307411_10070010
1461 Ga0307415_100277927
1462 Ga0307510_10042231
1463 Ga0307510_10057893
1464 Ga0307510_10215446
1465 Ga0373940_0330400
1466 Ga0373949_0150133
1467 Ga0373952_0107137
1468 Ga0373923_0067015
1469 Ga0373932_0034596
1470 Ga0373924_0092876
1471 Ga0373931_0039742
1472 Ga0373931_0125515
1473 Ga0373935_0311509
1474 Ga0373935_0675594
1475 Ga0373937_0194889
1476 Ga0373925_0374545
1477 Ga0373925_1426003
1478 Ga0395900_0000046
1479 Ga0395898_0000337
1480 Ga0395905_0008815
1481 Ga0395905_0022756
1482 Ga0395905_0024666
1483 Ga0395905_0031032
1484 Ga0395905_0373849
1485 Ga0395905_0557239
1486 Ga0436364_0740767
1487 Ga0436360_0796923
1488 Ga0436363_1352042
1489 Ga0439439_0036916
1490 Ga0439461_0031277
1491 Ga0451787_240345
1492 Ga0451797_0523275
1493 Ga0451795_1183208
1494 Ga0451800_0382937
1495 Ga0451802_0601236
1496 Ga0451804_0856991
1497 Ga0451839_1418667
1498 Ga0451851_0168290
1499 Ga0451853_0894190
1500 Ga0451853_2946434
1501 Ga0451853_3917193
1502 Ga0439431_0065654
1503 Ga0439448_0342442
1504 Ga0439432_141029
1505 Ga0439449_0009909
1506 Ga0439449_0279172
1507 Ga0439450_046084
1508 Ga0439462_0010920
1509 Ga0450891_034854
1510 Ga0450896_007553
1511 Ga0450898_049456
1512 Ga0450898_092279
1513 Ga0439446_0153071
1514 Ga0439434_0121858
1515 Ga0439464_0021007
1516 Ga0450893_0052174
1517 Ga0451577_0013602
1518 Ga0451577_0119176
1519 Ga0451577_0301213
1520 Ga0451577_0478789
1521 Ga0451577_0858710
1522 Ga0451577_1601691
1523 Ga0466969_0021100
1524 Ga0466972_0049033
1525 Ga0466965_0017983
1526 Ga0466965_0036684
1527 Ga0466965_0076749
1528 Ga0466965_0107680
1529 Ga0466966_0038230
1530 Ga0466961_0063794
1531 Ga0466961_0128939
1532 Ga0466961_0151746
1533 Ga0466961_0987007
1534 Ga0466964_0005718
1535 Ga0453684_0006975
1536 Ga0453684_0118848
1537 Ga0453684_0171320
1538 Ga0453684_0598429
1539 Ga0453684_0664533
1540 Ga0466971_0025141
1541 Ga0466970_0059902
1542 Ga0466970_0086006
1543 Ga0466970_0162247
1544 Ga0466957_0018549
1545 Ga0466960_0103044
1546 Ga0466960_0295439
1547 Ga0466959_0000018
1548 Ga0466959_0045352
1549 Ga0466959_0392037
1550 Ga0451576_0005710
1551 Ga0451576_0134527
1552 Ga0451576_0249209
1553 Ga0451576_0268416
1554 Ga0451576_0323301
1555 Ga0451576_0438495
1556 Ga0451576_1011838
1557 Ga0466958_0043685
1558 Ga0495592_0000222
1559 Ga0495603_0316010
1560 Ga0495629_0114457
1561 Ga0495629_0331275
1562 Ga0495638_0061534
1563 Ga0495653_0348008
1564 Ga0495606_0112453
1565 Ga0495610_0029327
1566 Ga0495610_0191618
1567 Ga0495630_0059525
1568 Ga0495632_0028085
1569 Ga0495632_0151470
1570 Ga0495643_0532218
1571 Ga0495648_0117205
1572 Ga0495648_0129470
1573 Ga0495648_0166761
1574 Ga0495648_0173678
1575 Ga0495648_0192493
1576 Ga0495666_0276048
1577 Ga0495645_0040413
1578 Ga0495667_0717763
1579 Ga0495668_0039775
1580 Ga0495611_0118144
1581 Ga0495611_0285957
1582 Ga0495611_0448433
1583 Ga0495625_0043197
1584 Ga0495625_0630614
1585 Ga0495647_0051148
1586 Ga0495647_0211049
1587 Ga0495658_0057562
1588 Ga0495658_0283031
1589 Ga0495658_0530966
1590 Ga0495613_0038393
1591 Ga0495624_0272275
1592 Ga0495624_0460748
1593 Ga0495624_0511130
1594 Ga0495671_0232569
1595 Ga0495649_0005310
1596 Ga0495649_0308844
1597 Ga0495660_0033400
1598 Ga0495581_0401021
1599 Ga0495676_0007289
1600 Ga0495687_005082
1601 Ga0495687_005169
1602 Ga0495675_0265118
1603 Ga0495602_0767344
1604 Ga0495626_0101951
1605 Ga0496101_0230655
1606 Ga0496101_0427006
1607 Ga0496101_0797537
1608 Ga0496104_0270186
1609 Ga0496105_1011913
1610 Ga0496106_0137256
1611 Ga0496108_0072318
1612 Ga0496109_0086583
1613 Ga0496109_0232679
1614 Ga0496109_0606459
1615 Ga0496109_0930198
1616 Ga0496110_0177965
1617 Ga0496110_0187253
1618 Ga0496110_0866084
1619 Ga0496113_0420182
1620 Ga0496114_0030618
1621 Ga0496114_0451962
1622 Ga0496114_1398560
1623 Ga0496118_0258953
1624 Ga0496121_0114878
1625 Ga0496122_0062528
1626 Ga0496124_0001079
1627 Ga0496125_0300251
1628 Ga0496126_0052580
1629 Ga0501292_004551
1630 Ga0501294_005745
1631 Ga0501298_020690
1632 Ga0501043_0000112
1633 Ga0501046_0000146
1634 Ga0501047_0000192
1635 Ga0501048_0000494
1636 Ga0501199_034415
1637 Ga0501206_024501
1638 Ga0501222_004039
1639 Ga0501261_103603
1640 Ga0501079_1000169
1641 Ga0501241_110953
1642 Ga0501265_000654
1643 Ga0501265_041189
1644 Ga0501272_014406
1645 Ga0501273_019133
1646 Ga0501045_0033249
1647 nmdc:mga03683_29781_c1
1648 nmdc:mga03n38_231673_c1
1649 nmdc:mga03n38_29635_c1
1650 nmdc:mga00v17_168316_c1
1651 nmdc:mga0yw44_250244_c1
1652 nmdc:mga0k408_14694_c1
1653 nmdc:mga0k408_16418_c1
1654 nmdc:mga0k408_186398_c1
1655 nmdc:mga0k408_278_c1
1656 nmdc:mga0k408_347916_c1
1657 nmdc:mga0k408_413551_c1
1658 nmdc:mga0k408_45047_c1
1659 nmdc:mga0k408_4561_c1
1660 nmdc:mga0k408_531509_c1
1661 nmdc:mga0k408_673_c1
1662 nmdc:mga0k408_81267_c1
1663 nmdc:mga06z11_10569_c1
1664 nmdc:mga06z11_174586_c1
1665 nmdc:mga04h51_112706_c1
1666 nmdc:mga04h51_212232_c1
1667 nmdc:mga07m45_164377_c1
1668 nmdc:mga07m45_175678_c1
1669 nmdc:mga07m45_1841_c1
1670 nmdc:mga07m45_202_c1
1671 nmdc:mga07m45_3252_c1
1672 nmdc:mga07m45_34102_c1
1673 nmdc:mga07m45_806385_c1
1674 nmdc:mga09592_3023_c1
1675 nmdc:mga0rr50_920498_c1
1676 nmdc:mga0a205_696905_c1
1677 nmdc:mga0sz30_1130_c1
1678 Ga0495601_0936045
1679 Ga0495619_0080902
1680 Ga0500578_0429904
1681 Ga0500644_0008551
1682 Ga0500646_0103674
1683 Ga0500647_0201828
1684 Ga0500651_0101424
1685 Ga0500651_0126939
1686 Ga0500556_0149119
1687 Ga0500614_270478
1688 Ga0500658_0016475
1689 Ga0500559_0000011
1690 Ga0500568_0080668
1691 Ga0500622_0001778
1692 Ga0500622_0008597
1693 Ga0500627_0033373
1694 Ga0500636_0139679
1695 Ga0500645_007629
1696 Ga0500587_004482
1697 Ga0500661_030516
1698 Ga0590071_007255
1699 Ga0501082_0517732
1700 Ga0466962_0009549
1701 2644304763
1702 2831868206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

27

109

0.96

PF13279

4HBT_2

Thioesterase-like superfamily

19

138

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dio-assembly1.cif.gz_B-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9504 14 138
5byu-assembly1.cif.gz_D crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila 0.9395 13 119
5dio-assembly1.cif.gz_A-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9374 7 138
3qy3-assembly1.cif.gz_A pa2801 protein, a putative thioesterase from pseudomonas aeruginosa 0.9336 10 136
5byu-assembly1.cif.gz_D crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila 0.9309 13 119
ID Description Score Start End Superfamily
5dioB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9504 14 138 3.10.129.10
5byuD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9395 13 119 3.10.129.10
3qy3A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9329 10 136 3.10.129.10
5byuD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9309 13 119 3.10.129.10
5dioB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9264 14 138 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A315C8M0-F1-model_v4 deleted 0.9792 1 138
AF-A0A2D0IHC4-F1-model_v4 Thioesterase 0.9788 1 139 GO:0047617
AF-A0A1M3JV01-F1-model_v4 deleted 0.9766 32 141
AF-A0A2D0IHC4-F1-model_v4 Thioesterase 0.972 1 139 GO:0047617
AF-A0A1M3JV01-F1-model_v4 deleted 0.9679 32 141

Map