F483453
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 851 | 427 | 1702 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100815857|Ga0068855_1008158573 |
| Length | 167 |
| Sequence | MADRVSIQAADFNLADEIDALRADDKRVGAVCSFVGTVRQGHEGNNGPPVLEMELEHYPGMTEKSIEAMIDEARRRFDIYAARVIHRIGVLQPGDQIVMVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKEHTPEGARWVDARSSDDAAIARWGITAGNAPPVVPDP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 80 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 93 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 198 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 199 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 215 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 216 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 226 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 227 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 228 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 236 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 239 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 240 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 241 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 242 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 243 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 244 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 245 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 246 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 247 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 248 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 249 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 250 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 251 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 252 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 253 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 254 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 257 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 258 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 259 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 260 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 332 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 333 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 334 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 335 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 336 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 337 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 342 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 343 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 344 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 345 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 346 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 357 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 358 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 359 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 363 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 364 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 365 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 366 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 368 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 369 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 371 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 375 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 376 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 377 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 379 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 381 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 383 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 384 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 385 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 386 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 387 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 388 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 389 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 390 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 391 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 392 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 393 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 394 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 395 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 396 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 397 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 398 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 399 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 400 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 401 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 402 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 403 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 404 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 405 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 406 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 407 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 408 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 409 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 410 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 411 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 412 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 413 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 414 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 415 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 416 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 417 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 418 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 419 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 420 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 421 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 422 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 423 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 424 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 425 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 426 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 427 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.36 |
| Metatranscriptomes | 0.35 |
| Isolates | 5.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 30.79 |
| Nodule | 0.82 |
| Rhizoplane | 3.17 |
| Rhizosphere | 54.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068855_100815857 | 3300005563 | Bacteria | 991 |
| 2 | JGI24741J21665_1001445 | 3300001915 | Bacteria | 6805 |
| 3 | JGI24740J21852_10000319 | 3300001979 | Bacteria | 20469 |
| 4 | JGI24740J21852_10007091 | 3300001979 | Bacteria | 4591 |
| 5 | JGI24739J22299_10005364 | 3300001989 | Bacteria | 4881 |
| 6 | JGI25155J39150_1000074 | 3300002704 | Bacteria | 62438 |
| 7 | JGI25156J39149_1000002 | 3300002705 | Bacteria | 343501 |
| 8 | JGI25154J39366_1000010 | 3300002738 | Bacteria | 297985 |
| 9 | JGI25158J39367_1003721 | 3300002739 | Bacteria | 2330 |
| 10 | JGI25157J39369_1000001 | 3300002741 | Bacteria | 363277 |
| 11 | JGI25150J39212_1001101 | 3300002774 | Bacteria | 8146 |
| 12 | JGI25150J39212_1001868 | 3300002774 | Bacteria | 5553 |
| 13 | JGI25150J39212_1009272 | 3300002774 | Bacteria | 1885 |
| 14 | JGI25159J45721_1000465 | 3300002987 | Bacteria | 18688 |
| 15 | JGI25159J45721_1002893 | 3300002987 | Bacteria | 6270 |
| 16 | JGI25159J45721_1017298 | 3300002987 | Bacteria | 1497 |
| 17 | JGI25151J46595_10015217 | 3300003187 | Bacteria | 3401 |
| 18 | rootH2_10194452 | 3300003320 | Bacteria | 2027 |
| 19 | JGI25160J50197_1000192 | 3300003354 | Bacteria | 51376 |
| 20 | JGI25160J50197_1018502 | 3300003354 | Bacteria | 2169 |
| 21 | JGI25160J50197_1059988 | 3300003354 | Bacteria | 764 |
| 22 | JGI25161J50226_1000043 | 3300003374 | Bacteria | 120741 |
| 23 | Ga0055538_1001079 | 3300003751 | Bacteria | 5990 |
| 24 | Ga0055538_1011084 | 3300003751 | Bacteria | 677 |
| 25 | Ga0055539_1000123 | 3300003752 | Bacteria | 83036 |
| 26 | Ga0055533_1002174 | 3300003756 | Bacteria | 4672 |
| 27 | Ga0055533_1002613 | 3300003756 | Bacteria | 4010 |
| 28 | Ga0055533_1003314 | 3300003756 | Bacteria | 3277 |
| 29 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 30 | Ga0055532_1000029 | 3300003758 | Bacteria | 232900 |
| 31 | Ga0055525_1000345 | 3300003759 | Bacteria | 33665 |
| 32 | Ga0055542_1001189 | 3300003762 | Bacteria | 14846 |
| 33 | Ga0055529_1000062 | 3300003763 | Bacteria | 183782 |
| 34 | Ga0055526_1000441 | 3300003771 | Bacteria | 33073 |
| 35 | Ga0055526_1003998 | 3300003771 | Bacteria | 9074 |
| 36 | Ga0055526_1004562 | 3300003771 | Bacteria | 8269 |
| 37 | Ga0055537_1000259 | 3300003773 | Bacteria | 38671 |
| 38 | Ga0055537_1001161 | 3300003773 | Bacteria | 11265 |
| 39 | Ga0055537_1004429 | 3300003773 | Bacteria | 4020 |
| 40 | Ga0055537_1009409 | 3300003773 | Bacteria | 2159 |
| 41 | Ga0055524_1000156 | 3300003775 | Bacteria | 79669 |
| 42 | Ga0055524_1009658 | 3300003775 | Bacteria | 3900 |
| 43 | Ga0055536_1000270 | 3300003781 | Bacteria | 39711 |
| 44 | Ga0055536_1003726 | 3300003781 | Bacteria | 8079 |
| 45 | Ga0055536_1009172 | 3300003781 | Bacteria | 4134 |
| 46 | Ga0055534_1001138 | 3300003784 | Bacteria | 11269 |
| 47 | Ga0055534_1003028 | 3300003784 | Bacteria | 5517 |
| 48 | Ga0055534_1006217 | 3300003784 | Bacteria | 3047 |
| 49 | Ga0055534_1006824 | 3300003784 | Bacteria | 2816 |
| 50 | Ga0055534_1029829 | 3300003784 | Bacteria | 846 |
| 51 | Ga0055528_1008541 | 3300003790 | Bacteria | 4370 |
| 52 | Ga0055528_1020328 | 3300003790 | Bacteria | 2159 |
| 53 | Ga0055530_10000408 | 3300003791 | Bacteria | 38218 |
| 54 | Ga0055530_10003951 | 3300003791 | Bacteria | 8020 |
| 55 | Ga0055530_10009348 | 3300003791 | Bacteria | 3781 |
| 56 | Ga0055530_10033474 | 3300003791 | Bacteria | 1325 |
| 57 | Ga0055540_1000033 | 3300003792 | Bacteria | 172048 |
| 58 | Ga0055540_1003778 | 3300003792 | Bacteria | 7139 |
| 59 | Ga0055540_1004106 | 3300003792 | Bacteria | 6743 |
| 60 | Ga0055540_1004580 | 3300003792 | Bacteria | 6150 |
| 61 | Ga0055540_1073622 | 3300003792 | Bacteria | 664 |
| 62 | Ga0055531_10000273 | 3300003794 | Bacteria | 53570 |
| 63 | Ga0055531_10004865 | 3300003794 | Bacteria | 8006 |
| 64 | Ga0055531_10009016 | 3300003794 | Bacteria | 5158 |
| 65 | Ga0055531_10046577 | 3300003794 | Bacteria | 1190 |
| 66 | Ga0055541_1000208 | 3300003841 | Bacteria | 24817 |
| 67 | Ga0055541_1001170 | 3300003841 | Bacteria | 5863 |
| 68 | Ga0055541_1018967 | 3300003841 | Bacteria | 839 |
| 69 | Ga0055541_1018975 | 3300003841 | Bacteria | 839 |
| 70 | Ga0055543_1000127 | 3300004625 | Bacteria | 63245 |
| 71 | Ga0055543_1003299 | 3300004625 | Bacteria | 4843 |
| 72 | Ga0065165_1028859 | 3300005262 | Bacteria | 1785 |
| 73 | Ga0065165_1067279 | 3300005262 | Bacteria | 961 |
| 74 | Ga0065704_10140698 | 3300005289 | Bacteria | 1521 |
| 75 | Ga0065704_10292894 | 3300005289 | Bacteria | 900 |
| 76 | Ga0070676_10691508 | 3300005328 | Bacteria | 744 |
| 77 | Ga0070670_100587130 | 3300005331 | Bacteria | 996 |
| 78 | Ga0070677_10004622 | 3300005333 | Bacteria | 4502 |
| 79 | Ga0068869_100042886 | 3300005334 | Bacteria | 3246 |
| 80 | Ga0068869_100144770 | 3300005334 | Bacteria | 1838 |
| 81 | Ga0070680_100154059 | 3300005336 | Bacteria | 1930 |
| 82 | Ga0070680_100327448 | 3300005336 | Bacteria | 1301 |
| 83 | Ga0068868_100092735 | 3300005338 | Bacteria | 2434 |
| 84 | Ga0068868_100301613 | 3300005338 | Bacteria | 1361 |
| 85 | Ga0070660_100063427 | 3300005339 | Bacteria | 2873 |
| 86 | Ga0070661_100001595 | 3300005344 | Bacteria | 15734 |
| 87 | Ga0070661_100551136 | 3300005344 | Bacteria | 928 |
| 88 | Ga0070661_101649227 | 3300005344 | Bacteria | 543 |
| 89 | Ga0070668_100436175 | 3300005347 | Bacteria | 1124 |
| 90 | Ga0070669_100049588 | 3300005353 | Bacteria | 3065 |
| 91 | Ga0070675_100000158 | 3300005354 | Bacteria | 41146 |
| 92 | Ga0070675_100048670 | 3300005354 | Bacteria | 3477 |
| 93 | Ga0070671_100004317 | 3300005355 | Bacteria | 11249 |
| 94 | Ga0070671_100213572 | 3300005355 | Bacteria | 1636 |
| 95 | Ga0070674_100011597 | 3300005356 | Bacteria | 5372 |
| 96 | Ga0070674_100157791 | 3300005356 | Bacteria | 1718 |
| 97 | Ga0070673_100041500 | 3300005364 | Bacteria | 3539 |
| 98 | Ga0070673_100046916 | 3300005364 | Bacteria | 3358 |
| 99 | Ga0070659_100018367 | 3300005366 | Bacteria | 5278 |
| 100 | Ga0070667_100015538 | 3300005367 | Bacteria | 6292 |
| 101 | Ga0070667_100068522 | 3300005367 | Bacteria | 3019 |
| 102 | Ga0070667_100174663 | 3300005367 | Bacteria | 1898 |
| 103 | Ga0070714_100375116 | 3300005435 | Bacteria | 1340 |
| 104 | Ga0070663_100000011 | 3300005455 | Bacteria | 146097 |
| 105 | Ga0070663_100007541 | 3300005455 | Bacteria | 6628 |
| 106 | Ga0070678_100031759 | 3300005456 | Bacteria | 3647 |
| 107 | Ga0070678_100064383 | 3300005456 | Bacteria | 2717 |
| 108 | Ga0070662_100131317 | 3300005457 | Bacteria | 1931 |
| 109 | Ga0068867_100000092 | 3300005459 | Bacteria | 57643 |
| 110 | Ga0068867_100002736 | 3300005459 | Bacteria | 12430 |
| 111 | Ga0068867_100003562 | 3300005459 | Bacteria | 10954 |
| 112 | Ga0068867_100018629 | 3300005459 | Bacteria | 4936 |
| 113 | Ga0068867_100631262 | 3300005459 | Bacteria | 938 |
| 114 | Ga0068853_100099468 | 3300005539 | Bacteria | 2569 |
| 115 | Ga0068853_100232269 | 3300005539 | Bacteria | 1688 |
| 116 | Ga0068853_101853500 | 3300005539 | Bacteria | 585 |
| 117 | Ga0070672_100047628 | 3300005543 | Bacteria | 3327 |
| 118 | Ga0070672_100116863 | 3300005543 | Bacteria | 2180 |
| 119 | Ga0070672_100187081 | 3300005543 | Bacteria | 1727 |
| 120 | Ga0070665_100161485 | 3300005548 | Bacteria | 2243 |
| 121 | Ga0070665_100796843 | 3300005548 | Bacteria | 958 |
| 122 | Ga0070665_101285026 | 3300005548 | Bacteria | 742 |
| 123 | Ga0070665_101285386 | 3300005548 | Bacteria | 742 |
| 124 | Ga0068855_100076757 | 3300005563 | Bacteria | 3876 |
| 125 | Ga0068855_100089079 | 3300005563 | Bacteria | 3563 |
| 126 | Ga0068855_100146314 | 3300005563 | Bacteria | 2689 |
| 127 | Ga0070664_100000008 | 3300005564 | Bacteria | 173734 |
| 128 | Ga0070664_100013869 | 3300005564 | Bacteria | 6570 |
| 129 | Ga0068857_100002038 | 3300005577 | Bacteria | 16379 |
| 130 | Ga0068857_100223425 | 3300005577 | Bacteria | 1721 |
| 131 | Ga0068857_100318117 | 3300005577 | Bacteria | 1437 |
| 132 | Ga0068854_100000052 | 3300005578 | Bacteria | 85499 |
| 133 | Ga0068856_100000009 | 3300005614 | Bacteria | 181448 |
| 134 | Ga0068856_100439570 | 3300005614 | Bacteria | 1325 |
| 135 | Ga0068852_100148447 | 3300005616 | Bacteria | 2177 |
| 136 | Ga0068852_100168505 | 3300005616 | Bacteria | 2051 |
| 137 | Ga0068851_10092729 | 3300005834 | Bacteria | 1592 |
| 138 | Ga0068862_100068756 | 3300005844 | Bacteria | 3056 |
| 139 | Ga0068862_101290497 | 3300005844 | Bacteria | 731 |
| 140 | Ga0075365_10245891 | 3300006038 | Bacteria | 1256 |
| 141 | Ga0075363_100083557 | 3300006048 | Bacteria | 1749 |
| 142 | Ga0075363_100187166 | 3300006048 | Bacteria | 1180 |
| 143 | Ga0075364_10025580 | 3300006051 | Bacteria | 3758 |
| 144 | Ga0075364_10459791 | 3300006051 | Bacteria | 870 |
| 145 | Ga0075432_10007261 | 3300006058 | Bacteria | 3773 |
| 146 | Ga0075432_10007774 | 3300006058 | Bacteria | 3654 |
| 147 | Ga0075362_10003943 | 3300006177 | Bacteria | 5271 |
| 148 | Ga0075362_10014025 | 3300006177 | Bacteria | 3224 |
| 149 | Ga0075362_10026155 | 3300006177 | Bacteria | 2490 |
| 150 | Ga0075362_10060691 | 3300006177 | Bacteria | 1709 |
| 151 | Ga0075362_10324345 | 3300006177 | Bacteria | 767 |
| 152 | Ga0075362_10611600 | 3300006177 | Bacteria | 564 |
| 153 | Ga0075367_10183859 | 3300006178 | Bacteria | 1303 |
| 154 | Ga0075366_10011492 | 3300006195 | Bacteria | 5001 |
| 155 | Ga0075366_10051211 | 3300006195 | Bacteria | 2453 |
| 156 | Ga0075366_10069431 | 3300006195 | Bacteria | 2097 |
| 157 | Ga0075366_10089703 | 3300006195 | Bacteria | 1841 |
| 158 | Ga0075366_10156187 | 3300006195 | Bacteria | 1382 |
| 159 | Ga0075366_10287610 | 3300006195 | Bacteria | 1005 |
| 160 | Ga0075366_10336508 | 3300006195 | Bacteria | 925 |
| 161 | Ga0075366_10386789 | 3300006195 | Bacteria | 860 |
| 162 | Ga0075366_10590118 | 3300006195 | Bacteria | 689 |
| 163 | Ga0097621_101230416 | 3300006237 | Bacteria | 706 |
| 164 | Ga0097621_101454490 | 3300006237 | Bacteria | 650 |
| 165 | Ga0075370_10000322 | 3300006353 | Bacteria | 17253 |
| 166 | Ga0075370_10000738 | 3300006353 | Bacteria | 13029 |
| 167 | Ga0075370_10046321 | 3300006353 | Bacteria | 2461 |
| 168 | Ga0075370_10107198 | 3300006353 | Bacteria | 1620 |
| 169 | Ga0075370_10173015 | 3300006353 | Bacteria | 1270 |
| 170 | Ga0075370_10197097 | 3300006353 | Bacteria | 1187 |
| 171 | Ga0075370_10501225 | 3300006353 | Bacteria | 733 |
| 172 | Ga0068871_100173810 | 3300006358 | Bacteria | 1848 |
| 173 | Ga0075430_100021936 | 3300006846 | Bacteria | 5427 |
| 174 | Ga0075429_100010391 | 3300006880 | Bacteria | 8056 |
| 175 | Ga0075429_100760561 | 3300006880 | Bacteria | 849 |
| 176 | Ga0079104_1016127 | 3300006946 | Bacteria | 2193 |
| 177 | Ga0079104_1020241 | 3300006946 | Bacteria | 1838 |
| 178 | Ga0079104_1036670 | 3300006946 | Bacteria | 1175 |
| 179 | Ga0099826_10008499 | 3300006948 | Bacteria | 7640 |
| 180 | Ga0099826_10444032 | 3300006948 | Bacteria | 619 |
| 181 | Ga0105244_10003000 | 3300009036 | Bacteria | 12386 |
| 182 | Ga0105244_10326503 | 3300009036 | Bacteria | 708 |
| 183 | Ga0105240_10004043 | 3300009093 | Bacteria | 22563 |
| 184 | Ga0105240_10010244 | 3300009093 | Bacteria | 13194 |
| 185 | Ga0105240_10027063 | 3300009093 | Bacteria | 7516 |
| 186 | Ga0105245_10273025 | 3300009098 | Bacteria | 1650 |
| 187 | Ga0105245_10323309 | 3300009098 | Bacteria | 1520 |
| 188 | Ga0105243_10003757 | 3300009148 | Bacteria | 12169 |
| 189 | Ga0105243_10009638 | 3300009148 | Bacteria | 7353 |
| 190 | Ga0105243_10009706 | 3300009148 | Bacteria | 7329 |
| 191 | Ga0105243_10022421 | 3300009148 | Bacteria | 4799 |
| 192 | Ga0105242_10003000 | 3300009176 | Bacteria | 13209 |
| 193 | Ga0105242_10495201 | 3300009176 | Bacteria | 1161 |
| 194 | Ga0105242_10698787 | 3300009176 | Bacteria | 992 |
| 195 | Ga0105248_11123506 | 3300009177 | Bacteria | 888 |
| 196 | Ga0105237_10000945 | 3300009545 | Bacteria | 39046 |
| 197 | Ga0105237_10124271 | 3300009545 | Bacteria | 2575 |
| 198 | Ga0105237_11003981 | 3300009545 | Bacteria | 841 |
| 199 | Ga0105238_10081095 | 3300009551 | Bacteria | 3234 |
| 200 | Ga0105249_11186873 | 3300009553 | Bacteria | 834 |
| 201 | Ga0105239_10005802 | 3300010375 | Bacteria | 14404 |
| 202 | Ga0105239_10266673 | 3300010375 | Bacteria | 1925 |
| 203 | Ga0105239_11418942 | 3300010375 | Bacteria | 802 |
| 204 | Ga0105246_10035641 | 3300011119 | Bacteria | 3327 |
| 205 | Ga0105246_10913458 | 3300011119 | Bacteria | 788 |
| 206 | Ga0105246_11602204 | 3300011119 | Bacteria | 615 |
| 207 | Ga0157347_1002569 | 3300012502 | Bacteria | 1566 |
| 208 | Ga0157347_1003557 | 3300012502 | Bacteria | 1402 |
| 209 | Ga0157326_1000968 | 3300012513 | Bacteria | 3259 |
| 210 | Ga0157373_10010823 | 3300013100 | Bacteria | 6714 |
| 211 | Ga0157373_10023683 | 3300013100 | Bacteria | 4450 |
| 212 | Ga0157373_10345524 | 3300013100 | Bacteria | 1061 |
| 213 | Ga0157371_10000068 | 3300013102 | Bacteria | 168110 |
| 214 | Ga0157371_10310855 | 3300013102 | Bacteria | 1142 |
| 215 | Ga0157370_10010316 | 3300013104 | Bacteria | 9854 |
| 216 | Ga0157370_10072460 | 3300013104 | Bacteria | 3250 |
| 217 | Ga0157370_10367712 | 3300013104 | Bacteria | 1325 |
| 218 | Ga0157370_11167749 | 3300013104 | Bacteria | 695 |
| 219 | Ga0157369_10012328 | 3300013105 | Bacteria | 9710 |
| 220 | Ga0157374_11738372 | 3300013296 | Bacteria | 649 |
| 221 | Ga0157378_10076690 | 3300013297 | Bacteria | 3012 |
| 222 | Ga0157378_10298572 | 3300013297 | Bacteria | 1558 |
| 223 | Ga0163162_10165510 | 3300013306 | Bacteria | 2335 |
| 224 | Ga0163162_10707785 | 3300013306 | Bacteria | 1129 |
| 225 | Ga0157372_10000271 | 3300013307 | Bacteria | 57411 |
| 226 | Ga0157375_10298060 | 3300013308 | Bacteria | 1776 |
| 227 | Ga0157375_10598249 | 3300013308 | Bacteria | 1262 |
| 228 | Ga0157375_11140407 | 3300013308 | Bacteria | 913 |
| 229 | Ga0157380_10002034 | 3300014326 | Bacteria | 13517 |
| 230 | Ga0157380_10747942 | 3300014326 | Bacteria | 989 |
| 231 | Ga0182008_10001340 | 3300014497 | Bacteria | 16780 |
| 232 | Ga0182008_10002648 | 3300014497 | Bacteria | 11114 |
| 233 | Ga0182008_10016053 | 3300014497 | Bacteria | 3897 |
| 234 | Ga0182008_10044379 | 3300014497 | Bacteria | 2211 |
| 235 | Ga0182008_10053246 | 3300014497 | Bacteria | 2004 |
| 236 | Ga0157377_10000163 | 3300014745 | Bacteria | 39681 |
| 237 | Ga0157377_10234269 | 3300014745 | Bacteria | 1182 |
| 238 | Ga0157379_10423334 | 3300014968 | Bacteria | 1226 |
| 239 | Ga0157376_10148287 | 3300014969 | Bacteria | 2113 |
| 240 | Ga0157376_10335114 | 3300014969 | Bacteria | 1443 |
| 241 | Ga0157376_11077177 | 3300014969 | Bacteria | 829 |
| 242 | Ga0182006_1001145 | 3300015261 | Bacteria | 16830 |
| 243 | Ga0182006_1012267 | 3300015261 | Bacteria | 3749 |
| 244 | Ga0182006_1029708 | 3300015261 | Bacteria | 2212 |
| 245 | Ga0182006_1147247 | 3300015261 | Bacteria | 800 |
| 246 | Ga0182007_10008474 | 3300015262 | Bacteria | 4222 |
| 247 | Ga0182005_1012041 | 3300015265 | Bacteria | 2450 |
| 248 | Ga0182005_1140321 | 3300015265 | Bacteria | 698 |
| 249 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 250 | Ga0163161_10000166 | 3300017792 | Bacteria | 60327 |
| 251 | Ga0163161_10017700 | 3300017792 | Bacteria | 4993 |
| 252 | Ga0163161_10017854 | 3300017792 | Bacteria | 4971 |
| 253 | Ga0206351_10253009 | 3300020077 | Bacteria | 7729 |
| 254 | Ga0206350_10481412 | 3300020080 | Bacteria | 961 |
| 255 | Ga0154015_1103548 | 3300020610 | Bacteria | 9590 |
| 256 | Ga0213872_10034267 | 3300021361 | Bacteria | 2324 |
| 257 | Ga0213876_10579543 | 3300021384 | Bacteria | 597 |
| 258 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 259 | Ga0209436_103077 | 3300025208 | Bacteria | 4593 |
| 260 | Ga0209436_104293 | 3300025208 | Bacteria | 3548 |
| 261 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 262 | Ga0209784_100482 | 3300025224 | Bacteria | 16070 |
| 263 | Ga0209784_100539 | 3300025224 | Bacteria | 13930 |
| 264 | Ga0209784_101093 | 3300025224 | Bacteria | 4521 |
| 265 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 266 | Ga0209566_100970 | 3300025225 | Bacteria | 12691 |
| 267 | Ga0209566_111096 | 3300025225 | Bacteria | 891 |
| 268 | Ga0209566_111097 | 3300025225 | Bacteria | 891 |
| 269 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 270 | Ga0209674_100229 | 3300025226 | Bacteria | 50211 |
| 271 | Ga0209674_101558 | 3300025226 | Bacteria | 5833 |
| 272 | Ga0209672_100052 | 3300025228 | Bacteria | 231179 |
| 273 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 274 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 275 | Ga0209563_106635 | 3300025230 | Bacteria | 1971 |
| 276 | Ga0209563_111006 | 3300025230 | Bacteria | 1294 |
| 277 | Ga0209563_114368 | 3300025230 | Bacteria | 1018 |
| 278 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 279 | Ga0207425_1000603 | 3300025245 | Bacteria | 20837 |
| 280 | Ga0207425_1001556 | 3300025245 | Bacteria | 9346 |
| 281 | Ga0207425_1002814 | 3300025245 | Bacteria | 5868 |
| 282 | Ga0207425_1010123 | 3300025245 | Bacteria | 2309 |
| 283 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 284 | Ga0209646_1000059 | 3300025246 | Bacteria | 256909 |
| 285 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 286 | Ga0209026_1008832 | 3300025250 | Bacteria | 2052 |
| 287 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 288 | Ga0209677_102838 | 3300025253 | Bacteria | 6123 |
| 289 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 290 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 291 | Ga0209759_1002389 | 3300025256 | Bacteria | 8282 |
| 292 | Ga0209759_1003853 | 3300025256 | Bacteria | 5811 |
| 293 | Ga0209759_1005426 | 3300025256 | Bacteria | 4469 |
| 294 | Ga0209129_1000071 | 3300025258 | Bacteria | 210729 |
| 295 | Ga0209565_1000120 | 3300025263 | Bacteria | 111458 |
| 296 | Ga0209565_1000326 | 3300025263 | Bacteria | 42448 |
| 297 | Ga0209565_1000774 | 3300025263 | Bacteria | 18648 |
| 298 | Ga0209565_1001593 | 3300025263 | Bacteria | 9641 |
| 299 | Ga0209565_1056566 | 3300025263 | Bacteria | 690 |
| 300 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 301 | Ga0209673_1000099 | 3300025273 | Bacteria | 193248 |
| 302 | Ga0209673_1000839 | 3300025273 | Bacteria | 40180 |
| 303 | Ga0209673_1001338 | 3300025273 | Bacteria | 24643 |
| 304 | Ga0209130_1000041 | 3300025284 | Bacteria | 261078 |
| 305 | Ga0209130_1000456 | 3300025284 | Bacteria | 43000 |
| 306 | Ga0209130_1000952 | 3300025284 | Bacteria | 22937 |
| 307 | Ga0209130_1001771 | 3300025284 | Bacteria | 12746 |
| 308 | Ga0209130_1003498 | 3300025284 | Bacteria | 6602 |
| 309 | Ga0209675_1000054 | 3300025291 | Bacteria | 193248 |
| 310 | Ga0209675_1000290 | 3300025291 | Bacteria | 47338 |
| 311 | Ga0209675_1001678 | 3300025291 | Bacteria | 12312 |
| 312 | Ga0209675_1008675 | 3300025291 | Bacteria | 3695 |
| 313 | Ga0209675_1014145 | 3300025291 | Bacteria | 2446 |
| 314 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 315 | Ga0209676_1000054 | 3300025292 | Bacteria | 365890 |
| 316 | Ga0209676_1000260 | 3300025292 | Bacteria | 111683 |
| 317 | Ga0209676_1002320 | 3300025292 | Bacteria | 13793 |
| 318 | Ga0209676_1006861 | 3300025292 | Bacteria | 5513 |
| 319 | Ga0209676_1012219 | 3300025292 | Bacteria | 3396 |
| 320 | Ga0209676_1026508 | 3300025292 | Bacteria | 1839 |
| 321 | Ga0209025_1001409 | 3300025294 | Bacteria | 31873 |
| 322 | Ga0209025_1010783 | 3300025294 | Bacteria | 6140 |
| 323 | Ga0209025_1013211 | 3300025294 | Bacteria | 5211 |
| 324 | Ga0209025_1014966 | 3300025294 | Bacteria | 4722 |
| 325 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 326 | Ga0209564_1000239 | 3300025295 | Bacteria | 119761 |
| 327 | Ga0209564_1000662 | 3300025295 | Bacteria | 50934 |
| 328 | Ga0209564_1000784 | 3300025295 | Bacteria | 44001 |
| 329 | Ga0209564_1000890 | 3300025295 | Bacteria | 39405 |
| 330 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 331 | Ga0209758_1010200 | 3300025297 | Bacteria | 5668 |
| 332 | Ga0209758_1050345 | 3300025297 | Bacteria | 1461 |
| 333 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 334 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 335 | Ga0209050_1000954 | 3300025298 | Bacteria | 37580 |
| 336 | Ga0209050_1004569 | 3300025298 | Bacteria | 9285 |
| 337 | Ga0209050_1016241 | 3300025298 | Bacteria | 3060 |
| 338 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 339 | Ga0209256_1000081 | 3300025299 | Bacteria | 222908 |
| 340 | Ga0209256_1024131 | 3300025299 | Bacteria | 1796 |
| 341 | Ga0209256_1059446 | 3300025299 | Bacteria | 895 |
| 342 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 343 | Ga0207426_1000061 | 3300025302 | Bacteria | 362507 |
| 344 | Ga0207426_1003593 | 3300025302 | Bacteria | 8238 |
| 345 | Ga0207426_1004649 | 3300025302 | Bacteria | 6602 |
| 346 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 347 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 348 | Ga0209051_1000319 | 3300025303 | Bacteria | 72894 |
| 349 | Ga0209051_1000619 | 3300025303 | Bacteria | 40839 |
| 350 | Ga0209051_1005714 | 3300025303 | Bacteria | 7182 |
| 351 | Ga0209051_1019179 | 3300025303 | Bacteria | 2996 |
| 352 | Ga0209051_1019880 | 3300025303 | Bacteria | 2916 |
| 353 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 354 | Ga0209257_1000873 | 3300025304 | Bacteria | 42738 |
| 355 | Ga0209257_1007556 | 3300025304 | Bacteria | 6522 |
| 356 | Ga0209257_1007934 | 3300025304 | Bacteria | 6227 |
| 357 | Ga0209257_1008583 | 3300025304 | Bacteria | 5754 |
| 358 | Ga0209257_1011066 | 3300025304 | Bacteria | 4422 |
| 359 | Ga0207697_10108593 | 3300025315 | Bacteria | 1187 |
| 360 | Ga0207656_10032769 | 3300025321 | Bacteria | 2160 |
| 361 | Ga0207655_1001368 | 3300025728 | Bacteria | 22829 |
| 362 | Ga0207682_10001652 | 3300025893 | Bacteria | 10224 |
| 363 | Ga0207682_10099945 | 3300025893 | Bacteria | 1267 |
| 364 | Ga0207688_10038678 | 3300025901 | Bacteria | 2648 |
| 365 | Ga0207680_10417892 | 3300025903 | Bacteria | 949 |
| 366 | Ga0207647_10254573 | 3300025904 | Bacteria | 1006 |
| 367 | Ga0207645_10055100 | 3300025907 | Bacteria | 2539 |
| 368 | Ga0207645_10063693 | 3300025907 | Bacteria | 2356 |
| 369 | Ga0207645_10446080 | 3300025907 | Bacteria | 873 |
| 370 | Ga0207705_10299096 | 3300025909 | Bacteria | 1234 |
| 371 | Ga0207695_10001909 | 3300025913 | Bacteria | 32457 |
| 372 | Ga0207695_10004148 | 3300025913 | Bacteria | 19891 |
| 373 | Ga0207695_10125685 | 3300025913 | Bacteria | 2527 |
| 374 | Ga0207695_10630993 | 3300025913 | Bacteria | 953 |
| 375 | Ga0207671_10123849 | 3300025914 | Bacteria | 1978 |
| 376 | Ga0207660_10038245 | 3300025917 | Bacteria | 3349 |
| 377 | Ga0207660_10311643 | 3300025917 | Bacteria | 1255 |
| 378 | Ga0207649_10001269 | 3300025920 | Bacteria | 15079 |
| 379 | Ga0207649_11270916 | 3300025920 | Bacteria | 582 |
| 380 | Ga0207681_10014932 | 3300025923 | Bacteria | 4837 |
| 381 | Ga0207694_10061134 | 3300025924 | Bacteria | 2932 |
| 382 | Ga0207694_10197807 | 3300025924 | Bacteria | 1634 |
| 383 | Ga0207650_10001711 | 3300025925 | Bacteria | 15569 |
| 384 | Ga0207659_10001143 | 3300025926 | Bacteria | 15778 |
| 385 | Ga0207659_10168409 | 3300025926 | Bacteria | 1726 |
| 386 | Ga0207687_10043205 | 3300025927 | Bacteria | 3104 |
| 387 | Ga0207687_10087175 | 3300025927 | Bacteria | 2268 |
| 388 | Ga0207664_11081393 | 3300025929 | Bacteria | 717 |
| 389 | Ga0207644_10003362 | 3300025931 | Bacteria | 10322 |
| 390 | Ga0207690_10014545 | 3300025932 | Bacteria | 4753 |
| 391 | Ga0207706_10017147 | 3300025933 | Bacteria | 6531 |
| 392 | Ga0207706_10918481 | 3300025933 | Bacteria | 739 |
| 393 | Ga0207709_10000230 | 3300025935 | Bacteria | 70768 |
| 394 | Ga0207709_10002452 | 3300025935 | Bacteria | 11648 |
| 395 | Ga0207709_10022627 | 3300025935 | Bacteria | 3566 |
| 396 | Ga0207669_10003638 | 3300025937 | Bacteria | 6692 |
| 397 | Ga0207669_10617448 | 3300025937 | Bacteria | 883 |
| 398 | Ga0207704_10162483 | 3300025938 | Bacteria | 1591 |
| 399 | Ga0207704_11228983 | 3300025938 | Bacteria | 639 |
| 400 | Ga0207691_10055060 | 3300025940 | Bacteria | 3627 |
| 401 | Ga0207691_10056335 | 3300025940 | Bacteria | 3580 |
| 402 | Ga0207691_10151133 | 3300025940 | Bacteria | 2041 |
| 403 | Ga0207691_10826383 | 3300025940 | Bacteria | 778 |
| 404 | Ga0207711_10463975 | 3300025941 | Bacteria | 1179 |
| 405 | Ga0207689_10025300 | 3300025942 | Bacteria | 4974 |
| 406 | Ga0207689_10285070 | 3300025942 | Bacteria | 1368 |
| 407 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 408 | Ga0207679_10008899 | 3300025945 | Bacteria | 6407 |
| 409 | Ga0207667_10088447 | 3300025949 | Bacteria | 3204 |
| 410 | Ga0207667_10224669 | 3300025949 | Bacteria | 1924 |
| 411 | Ga0207667_10479044 | 3300025949 | Bacteria | 1263 |
| 412 | Ga0207667_10663985 | 3300025949 | Bacteria | 1047 |
| 413 | Ga0207651_10008073 | 3300025960 | Bacteria | 5653 |
| 414 | Ga0207651_10346029 | 3300025960 | Bacteria | 1250 |
| 415 | Ga0207640_10000035 | 3300025981 | Bacteria | 111369 |
| 416 | Ga0207640_10315862 | 3300025981 | Bacteria | 1242 |
| 417 | Ga0207658_10000754 | 3300025986 | Bacteria | 27858 |
| 418 | Ga0207658_10060529 | 3300025986 | Bacteria | 2826 |
| 419 | Ga0207658_10178315 | 3300025986 | Bacteria | 1756 |
| 420 | Ga0207677_10072405 | 3300026023 | Bacteria | 2436 |
| 421 | Ga0207677_10196868 | 3300026023 | Bacteria | 1598 |
| 422 | Ga0207639_10350464 | 3300026041 | Bacteria | 1318 |
| 423 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 424 | Ga0207678_10002368 | 3300026067 | Bacteria | 17095 |
| 425 | Ga0207702_10008078 | 3300026078 | Bacteria | 8901 |
| 426 | Ga0207702_10541109 | 3300026078 | Bacteria | 1138 |
| 427 | Ga0207641_10151496 | 3300026088 | Bacteria | 2101 |
| 428 | Ga0207648_10001232 | 3300026089 | Bacteria | 28719 |
| 429 | Ga0207648_10005724 | 3300026089 | Bacteria | 12451 |
| 430 | Ga0207648_10027075 | 3300026089 | Bacteria | 5092 |
| 431 | Ga0207648_10038520 | 3300026089 | Bacteria | 4206 |
| 432 | Ga0207648_10271507 | 3300026089 | Bacteria | 1515 |
| 433 | Ga0207674_10012396 | 3300026116 | Bacteria | 9531 |
| 434 | Ga0207674_10250557 | 3300026116 | Bacteria | 1718 |
| 435 | Ga0207674_10353949 | 3300026116 | Bacteria | 1419 |
| 436 | Ga0207683_10014615 | 3300026121 | Bacteria | 6686 |
| 437 | Ga0207683_10070721 | 3300026121 | Bacteria | 3083 |
| 438 | Ga0207683_10071124 | 3300026121 | Bacteria | 3075 |
| 439 | Ga0207683_10221142 | 3300026121 | Bacteria | 1725 |
| 440 | Ga0207698_10060310 | 3300026142 | Bacteria | 2950 |
| 441 | Ga0207698_10099871 | 3300026142 | Bacteria | 2402 |
| 442 | Ga0207698_10326422 | 3300026142 | Bacteria | 1440 |
| 443 | Ga0209282_1000133 | 3300027666 | Bacteria | 44707 |
| 444 | Ga0209813_10164718 | 3300027866 | Bacteria | 802 |
| 445 | Ga0209974_10014445 | 3300027876 | Bacteria | 2628 |
| 446 | Ga0207428_10248181 | 3300027907 | Bacteria | 1328 |
| 447 | Ga0268266_10014251 | 3300028379 | Bacteria | 6837 |
| 448 | Ga0268266_10487016 | 3300028379 | Bacteria | 1176 |
| 449 | Ga0268266_11102064 | 3300028379 | Bacteria | 768 |
| 450 | Ga0268265_10042673 | 3300028380 | Bacteria | 3367 |
| 451 | Ga0307515_10001286 | 3300028794 | Bacteria | 56985 |
| 452 | Ga0307515_10001485 | 3300028794 | Bacteria | 52672 |
| 453 | Ga0307515_10026348 | 3300028794 | Bacteria | 10014 |
| 454 | Ga0307515_10046408 | 3300028794 | Bacteria | 6641 |
| 455 | Ga0307515_10172925 | 3300028794 | Bacteria | 2144 |
| 456 | Ga0307512_10068145 | 3300030522 | Bacteria | 2672 |
| 457 | Ga0314311_1134334 | 3300030733 | Bacteria | 4782 |
| 458 | Ga0316182_1071470 | 3300030745 | Bacteria | 1692 |
| 459 | Ga0265327_10002745 | 3300031251 | Bacteria | 17906 |
| 460 | Ga0307513_10000012 | 3300031456 | Bacteria | 328865 |
| 461 | Ga0307513_10000285 | 3300031456 | Bacteria | 73356 |
| 462 | Ga0307513_10061834 | 3300031456 | Bacteria | 3961 |
| 463 | Ga0307513_10131485 | 3300031456 | Bacteria | 2448 |
| 464 | Ga0307509_10032544 | 3300031507 | Bacteria | 5745 |
| 465 | Ga0307509_10034762 | 3300031507 | Bacteria | 5536 |
| 466 | Ga0307509_10061068 | 3300031507 | Bacteria | 3981 |
| 467 | Ga0307509_10361881 | 3300031507 | Bacteria | 1170 |
| 468 | Ga0307408_100000079 | 3300031548 | Bacteria | 108053 |
| 469 | Ga0307408_100022449 | 3300031548 | Bacteria | 4288 |
| 470 | Ga0307408_100037053 | 3300031548 | Bacteria | 3432 |
| 471 | Ga0307408_100060612 | 3300031548 | Bacteria | 2758 |
| 472 | Ga0307408_100101444 | 3300031548 | Bacteria | 2193 |
| 473 | Ga0307408_100344212 | 3300031548 | Bacteria | 1263 |
| 474 | Ga0307408_100515197 | 3300031548 | Bacteria | 1049 |
| 475 | Ga0307508_10000094 | 3300031616 | Bacteria | 104107 |
| 476 | Ga0307508_10176342 | 3300031616 | Bacteria | 1741 |
| 477 | Ga0307508_10440890 | 3300031616 | Bacteria | 894 |
| 478 | Ga0307514_10078672 | 3300031649 | Bacteria | 2448 |
| 479 | Ga0265314_10147622 | 3300031711 | Bacteria | 1446 |
| 480 | Ga0307516_10000525 | 3300031730 | Bacteria | 51244 |
| 481 | Ga0307516_10004265 | 3300031730 | Bacteria | 17778 |
| 482 | Ga0307516_10022750 | 3300031730 | Bacteria | 6434 |
| 483 | Ga0307516_10458109 | 3300031730 | Bacteria | 931 |
| 484 | Ga0307405_10265904 | 3300031731 | Bacteria | 1283 |
| 485 | Ga0307405_10328907 | 3300031731 | Bacteria | 1170 |
| 486 | Ga0307405_10596852 | 3300031731 | Bacteria | 900 |
| 487 | Ga0307405_10893644 | 3300031731 | Bacteria | 751 |
| 488 | Ga0307406_10000927 | 3300031901 | Bacteria | 16394 |
| 489 | Ga0307406_10009555 | 3300031901 | Bacteria | 5445 |
| 490 | Ga0307406_10074343 | 3300031901 | Bacteria | 2237 |
| 491 | Ga0307406_10534627 | 3300031901 | Bacteria | 956 |
| 492 | Ga0307412_10035354 | 3300031911 | Bacteria | 3191 |
| 493 | Ga0307412_10045864 | 3300031911 | Bacteria | 2860 |
| 494 | Ga0307412_10058510 | 3300031911 | Bacteria | 2578 |
| 495 | Ga0307412_10096532 | 3300031911 | Bacteria | 2080 |
| 496 | Ga0307412_10119539 | 3300031911 | Bacteria | 1895 |
| 497 | Ga0307412_10143813 | 3300031911 | Bacteria | 1750 |
| 498 | Ga0307412_10641112 | 3300031911 | Bacteria | 905 |
| 499 | Ga0307416_100044749 | 3300032002 | Bacteria | 3479 |
| 500 | Ga0307416_100089287 | 3300032002 | Bacteria | 2638 |
| 501 | Ga0307416_100200115 | 3300032002 | Bacteria | 1894 |
| 502 | Ga0307416_101286618 | 3300032002 | Bacteria | 837 |
| 503 | Ga0307416_101651287 | 3300032002 | Bacteria | 746 |
| 504 | Ga0307414_10405799 | 3300032004 | Bacteria | 1185 |
| 505 | Ga0307414_10411971 | 3300032004 | Bacteria | 1177 |
| 506 | Ga0307414_11509865 | 3300032004 | Bacteria | 625 |
| 507 | Ga0307411_10414179 | 3300032005 | Bacteria | 1117 |
| 508 | Ga0307411_11633047 | 3300032005 | Bacteria | 595 |
| 509 | Ga0307507_10096639 | 3300033179 | Bacteria | 2497 |
| 510 | Ga0307510_10054117 | 3300033180 | Bacteria | 4210 |
| 511 | Ga0307510_10108768 | 3300033180 | Bacteria | 2524 |
| 512 | Ga0373959_0042364 | 3300034820 | Bacteria | 959 |
| 513 | Ga0373931_0315990 | 3300035691 | Bacteria | 969 |
| 514 | Ga0373925_0824834 | 3300037068 | Bacteria | 764 |
| 515 | Ga0395899_0000344 | 3300037312 | Bacteria | 57423 |
| 516 | Ga0395899_0079887 | 3300037312 | Bacteria | 2382 |
| 517 | Ga0395900_0019446 | 3300037418 | Bacteria | 6924 |
| 518 | Ga0395900_0109112 | 3300037418 | Bacteria | 2843 |
| 519 | Ga0395898_0174190 | 3300037466 | Bacteria | 2057 |
| 520 | Ga0395905_0022085 | 3300037471 | Bacteria | 6019 |
| 521 | Ga0395905_0037501 | 3300037471 | Bacteria | 4550 |
| 522 | Ga0395905_0038248 | 3300037471 | Bacteria | 4502 |
| 523 | Ga0395905_0083297 | 3300037471 | Bacteria | 2996 |
| 524 | Ga0395905_0158898 | 3300037471 | Bacteria | 2125 |
| 525 | Ga0395901_0127946 | 3300038443 | Bacteria | 2670 |
| 526 | Ga0395901_0131188 | 3300038443 | Bacteria | 2633 |
| 527 | Ga0395901_0373732 | 3300038443 | Bacteria | 1468 |
| 528 | Ga0436365_1619585 | 3300039437 | Bacteria | 758 |
| 529 | Ga0436365_1868038 | 3300039437 | Bacteria | 716 |
| 530 | Ga0436361_0268202 | 3300039447 | Bacteria | 49775 |
| 531 | Ga0439436_0001379 | 3300041404 | Bacteria | 7004 |
| 532 | Ga0439436_0006229 | 3300041404 | Bacteria | 3662 |
| 533 | Ga0439439_0005352 | 3300041406 | Bacteria | 2928 |
| 534 | Ga0439439_0005369 | 3300041406 | Bacteria | 2924 |
| 535 | Ga0439439_0009655 | 3300041406 | Bacteria | 2299 |
| 536 | Ga0439461_0050938 | 3300041410 | Bacteria | 918 |
| 537 | Ga0439465_0000697 | 3300041413 | Bacteria | 10311 |
| 538 | Ga0451789_0337724 | 3300041443 | Bacteria | 560 |
| 539 | Ga0451791_1603068 | 3300041451 | Bacteria | 645 |
| 540 | Ga0451793_0018749 | 3300041452 | Bacteria | 1350 |
| 541 | Ga0451793_1463256 | 3300041452 | Bacteria | 564 |
| 542 | Ga0451800_0610257 | 3300041459 | Bacteria | 1592 |
| 543 | Ga0451807_0067919 | 3300041486 | Bacteria | 744 |
| 544 | Ga0451837_1700856 | 3300041494 | Bacteria | 756 |
| 545 | Ga0451841_1340995 | 3300041498 | Bacteria | 728 |
| 546 | Ga0451853_0112802 | 3300041512 | Bacteria | 1741 |
| 547 | Ga0451853_3547166 | 3300041512 | Bacteria | 654 |
| 548 | Ga0439431_0000916 | 3300041997 | Bacteria | 6385 |
| 549 | Ga0439431_0007247 | 3300041997 | Bacteria | 2470 |
| 550 | Ga0439433_0000360 | 3300041999 | Bacteria | 8072 |
| 551 | Ga0439442_009609 | 3300042002 | Bacteria | 1955 |
| 552 | Ga0439442_016402 | 3300042002 | Bacteria | 1527 |
| 553 | Ga0439445_0000835 | 3300042004 | Bacteria | 6503 |
| 554 | Ga0439432_003052 | 3300042006 | Bacteria | 6232 |
| 555 | Ga0439432_012101 | 3300042006 | Bacteria | 2960 |
| 556 | Ga0439432_095902 | 3300042006 | Bacteria | 890 |
| 557 | Ga0439449_0001800 | 3300042007 | Bacteria | 8435 |
| 558 | Ga0439449_0002084 | 3300042007 | Bacteria | 7861 |
| 559 | Ga0439449_0003898 | 3300042007 | Bacteria | 5783 |
| 560 | Ga0439449_0017753 | 3300042007 | Bacteria | 2671 |
| 561 | Ga0439452_006051 | 3300042010 | Bacteria | 3826 |
| 562 | Ga0439452_022075 | 3300042010 | Bacteria | 1651 |
| 563 | Ga0439457_008504 | 3300042014 | Bacteria | 2417 |
| 564 | Ga0439462_0004954 | 3300042015 | Bacteria | 3266 |
| 565 | Ga0439462_0008200 | 3300042015 | Bacteria | 2629 |
| 566 | Ga0439462_0012214 | 3300042015 | Bacteria | 2193 |
| 567 | Ga0450911_014976 | 3300042115 | Bacteria | 1028 |
| 568 | Ga0450920_022302 | 3300042122 | Bacteria | 1226 |
| 569 | Ga0450888_020205 | 3300042126 | Bacteria | 844 |
| 570 | Ga0450898_007204 | 3300042134 | Bacteria | 1728 |
| 571 | Ga0450906_002698 | 3300042145 | Bacteria | 3863 |
| 572 | Ga0450906_011020 | 3300042145 | Bacteria | 1698 |
| 573 | Ga0450907_034411 | 3300042146 | Bacteria | 864 |
| 574 | Ga0450910_015188 | 3300042147 | Bacteria | 1132 |
| 575 | Ga0450909_006505 | 3300042185 | Bacteria | 1684 |
| 576 | Ga0439434_0000980 | 3300042435 | Bacteria | 8236 |
| 577 | Ga0439434_0008390 | 3300042435 | Bacteria | 3029 |
| 578 | Ga0439434_0010643 | 3300042435 | Bacteria | 2712 |
| 579 | Ga0439434_0092514 | 3300042435 | Bacteria | 968 |
| 580 | Ga0450893_0008574 | 3300042532 | Bacteria | 1664 |
| 581 | Ga0466986_0061755 | 3300044650 | Bacteria | 2594 |
| 582 | Ga0466977_0153091 | 3300044666 | Bacteria | 1492 |
| 583 | Ga0466978_0022614 | 3300044671 | Bacteria | 3737 |
| 584 | Ga0466965_0006416 | 3300044683 | Bacteria | 5340 |
| 585 | Ga0466961_0004849 | 3300044693 | Bacteria | 8463 |
| 586 | Ga0466961_0036663 | 3300044693 | Bacteria | 3147 |
| 587 | Ga0466964_0006122 | 3300044706 | Bacteria | 4485 |
| 588 | Ga0466964_0040101 | 3300044706 | Bacteria | 1890 |
| 589 | Ga0453684_0000606 | 3300044712 | Bacteria | 132056 |
| 590 | Ga0453684_0029039 | 3300044712 | Bacteria | 7868 |
| 591 | Ga0466971_0077704 | 3300044719 | Bacteria | 1511 |
| 592 | Ga0466968_0005280 | 3300044735 | Bacteria | 4838 |
| 593 | Ga0466970_0006124 | 3300044765 | Bacteria | 5991 |
| 594 | Ga0466970_0059958 | 3300044765 | Bacteria | 2038 |
| 595 | Ga0466957_0580074 | 3300044842 | Bacteria | 784 |
| 596 | Ga0466960_0054582 | 3300044901 | Bacteria | 1940 |
| 597 | Ga0466959_0008819 | 3300045049 | Bacteria | 7145 |
| 598 | Ga0466959_0027997 | 3300045049 | Bacteria | 4179 |
| 599 | Ga0451576_0013321 | 3300045051 | Bacteria | 9202 |
| 600 | Ga0466967_0009266 | 3300045976 | Bacteria | 7293 |
| 601 | Ga0466967_0237002 | 3300045976 | Bacteria | 1739 |
| 602 | Ga0495617_000303 | 3300046452 | Bacteria | 27779 |
| 603 | Ga0495627_008497 | 3300046453 | Bacteria | 3845 |
| 604 | Ga0495627_088232 | 3300046453 | Bacteria | 893 |
| 605 | Ga0495590_0064769 | 3300046457 | Bacteria | 1279 |
| 606 | Ga0495638_0028214 | 3300046460 | Bacteria | 3626 |
| 607 | Ga0495651_0145428 | 3300046462 | Bacteria | 1715 |
| 608 | Ga0495605_0000168 | 3300046474 | Bacteria | 82889 |
| 609 | Ga0495639_0022262 | 3300046475 | Bacteria | 2779 |
| 610 | Ga0495584_0002376 | 3300046491 | Bacteria | 10696 |
| 611 | Ga0495584_0005922 | 3300046491 | Bacteria | 6440 |
| 612 | Ga0495584_0039758 | 3300046491 | Bacteria | 2376 |
| 613 | Ga0495585_0000193 | 3300046492 | Bacteria | 63937 |
| 614 | Ga0495585_0004816 | 3300046492 | Bacteria | 8669 |
| 615 | Ga0495596_0003328 | 3300046500 | Bacteria | 8183 |
| 616 | Ga0495607_0000941 | 3300046501 | Bacteria | 27027 |
| 617 | Ga0495583_0000525 | 3300046506 | Bacteria | 54370 |
| 618 | Ga0495583_0018518 | 3300046506 | Bacteria | 3663 |
| 619 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 620 | Ga0495606_0035562 | 3300046507 | Bacteria | 3403 |
| 621 | Ga0495606_0143507 | 3300046507 | Bacteria | 1408 |
| 622 | Ga0495610_0005043 | 3300046512 | Bacteria | 9536 |
| 623 | Ga0495610_0018746 | 3300046512 | Bacteria | 3894 |
| 624 | Ga0495616_0000526 | 3300046513 | Bacteria | 28964 |
| 625 | Ga0495616_0007518 | 3300046513 | Bacteria | 6521 |
| 626 | Ga0495616_0008947 | 3300046513 | Bacteria | 5884 |
| 627 | Ga0495616_0014603 | 3300046513 | Bacteria | 4391 |
| 628 | Ga0495631_0004184 | 3300046518 | Bacteria | 7719 |
| 629 | Ga0495637_0006045 | 3300046520 | Bacteria | 6111 |
| 630 | Ga0495648_0000109 | 3300046524 | Bacteria | 101519 |
| 631 | Ga0495663_0128016 | 3300046525 | Bacteria | 854 |
| 632 | Ga0495654_0003435 | 3300046530 | Bacteria | 9711 |
| 633 | Ga0495654_0046196 | 3300046530 | Bacteria | 2146 |
| 634 | Ga0495654_0062093 | 3300046530 | Bacteria | 1792 |
| 635 | Ga0495654_0182136 | 3300046530 | Bacteria | 909 |
| 636 | Ga0495609_0000346 | 3300046538 | Bacteria | 40425 |
| 637 | Ga0495609_0050548 | 3300046538 | Bacteria | 1853 |
| 638 | Ga0495621_0010000 | 3300046539 | Bacteria | 2894 |
| 639 | Ga0495621_0011585 | 3300046539 | Bacteria | 2733 |
| 640 | Ga0495597_0004057 | 3300046542 | Bacteria | 8196 |
| 641 | Ga0495597_0271549 | 3300046542 | Bacteria | 662 |
| 642 | Ga0495633_0006530 | 3300046558 | Bacteria | 6893 |
| 643 | Ga0495633_0012623 | 3300046558 | Bacteria | 4483 |
| 644 | Ga0495656_0003255 | 3300046615 | Bacteria | 5478 |
| 645 | Ga0495656_0666815 | 3300046615 | Bacteria | 559 |
| 646 | Ga0495668_0000095 | 3300046616 | Bacteria | 141321 |
| 647 | Ga0495668_0002235 | 3300046616 | Bacteria | 16399 |
| 648 | Ga0495668_0052017 | 3300046616 | Bacteria | 2267 |
| 649 | Ga0495668_0063099 | 3300046616 | Bacteria | 2041 |
| 650 | Ga0495668_0118188 | 3300046616 | Bacteria | 1450 |
| 651 | Ga0495625_0000896 | 3300046660 | Bacteria | 40225 |
| 652 | Ga0495625_0090482 | 3300046660 | Bacteria | 2116 |
| 653 | Ga0495625_0128104 | 3300046660 | Bacteria | 1721 |
| 654 | Ga0495625_0344619 | 3300046660 | Bacteria | 943 |
| 655 | Ga0495659_0013477 | 3300046664 | Bacteria | 2663 |
| 656 | Ga0495661_0069382 | 3300046665 | Bacteria | 2065 |
| 657 | Ga0495661_0140755 | 3300046665 | Bacteria | 1313 |
| 658 | Ga0495588_0019546 | 3300046674 | Bacteria | 3319 |
| 659 | Ga0495588_0033592 | 3300046674 | Bacteria | 2591 |
| 660 | Ga0495588_0252663 | 3300046674 | Bacteria | 929 |
| 661 | Ga0495657_0060967 | 3300046675 | Bacteria | 2497 |
| 662 | Ga0495599_0187568 | 3300046678 | Bacteria | 1273 |
| 663 | Ga0495669_0045637 | 3300046684 | Bacteria | 1954 |
| 664 | Ga0495670_0267388 | 3300046691 | Bacteria | 913 |
| 665 | Ga0495671_0009212 | 3300046692 | Bacteria | 5519 |
| 666 | Ga0495671_0030047 | 3300046692 | Bacteria | 2786 |
| 667 | Ga0495649_0007050 | 3300046694 | Bacteria | 6917 |
| 668 | Ga0495589_0311139 | 3300046794 | Bacteria | 729 |
| 669 | Ga0495600_0188319 | 3300046809 | Bacteria | 1328 |
| 670 | Ga0495636_0027504 | 3300047318 | Bacteria | 2316 |
| 671 | Ga0495683_0000144 | 3300047323 | Bacteria | 69959 |
| 672 | Ga0495683_0454240 | 3300047323 | Bacteria | 525 |
| 673 | Ga0495687_007289 | 3300047443 | Bacteria | 6552 |
| 674 | Ga0495677_0016382 | 3300047445 | Bacteria | 2689 |
| 675 | Ga0495685_006498 | 3300047447 | Bacteria | 3829 |
| 676 | Ga0495685_017529 | 3300047447 | Bacteria | 2453 |
| 677 | Ga0495681_0009923 | 3300047470 | Bacteria | 5815 |
| 678 | Ga0495614_0310627 | 3300048089 | Bacteria | 730 |
| 679 | Ga0495626_0041067 | 3300048091 | Bacteria | 2182 |
| 680 | Ga0496100_0007340 | 3300048903 | Bacteria | 6072 |
| 681 | Ga0496101_0018273 | 3300048904 | Bacteria | 4766 |
| 682 | Ga0496102_0000707 | 3300048905 | Bacteria | 33079 |
| 683 | Ga0496102_0042793 | 3300048905 | Bacteria | 4105 |
| 684 | Ga0496104_0020850 | 3300048907 | Bacteria | 6010 |
| 685 | Ga0496104_0635886 | 3300048907 | Bacteria | 976 |
| 686 | Ga0496106_0020141 | 3300048909 | Bacteria | 4948 |
| 687 | Ga0496106_0134694 | 3300048909 | Bacteria | 1939 |
| 688 | Ga0496107_0452486 | 3300048910 | Bacteria | 954 |
| 689 | Ga0496107_0873698 | 3300048910 | Bacteria | 656 |
| 690 | Ga0496109_0130274 | 3300048912 | Bacteria | 2347 |
| 691 | Ga0496110_0035381 | 3300048913 | Bacteria | 4332 |
| 692 | Ga0496110_0144587 | 3300048913 | Bacteria | 2150 |
| 693 | Ga0496111_0029616 | 3300048914 | Bacteria | 3889 |
| 694 | Ga0496111_0087357 | 3300048914 | Bacteria | 2282 |
| 695 | Ga0496113_0073271 | 3300048916 | Bacteria | 2609 |
| 696 | Ga0496114_0703367 | 3300048917 | Bacteria | 886 |
| 697 | Ga0496116_0035499 | 3300048919 | Bacteria | 3501 |
| 698 | Ga0496118_0010125 | 3300048921 | Bacteria | 9371 |
| 699 | Ga0496118_0030038 | 3300048921 | Bacteria | 4545 |
| 700 | Ga0496121_0042948 | 3300048924 | Bacteria | 3922 |
| 701 | Ga0496121_0190509 | 3300048924 | Bacteria | 1471 |
| 702 | Ga0496121_0197772 | 3300048924 | Bacteria | 1435 |
| 703 | Ga0496121_0506526 | 3300048924 | Bacteria | 765 |
| 704 | Ga0496122_0003984 | 3300048925 | Bacteria | 18836 |
| 705 | Ga0496122_0064753 | 3300048925 | Bacteria | 2657 |
| 706 | Ga0496123_0000235 | 3300048926 | Bacteria | 111823 |
| 707 | Ga0496123_0061997 | 3300048926 | Bacteria | 2399 |
| 708 | Ga0496123_0136762 | 3300048926 | Bacteria | 1347 |
| 709 | Ga0496124_0451518 | 3300048927 | Bacteria | 876 |
| 710 | Ga0496125_0020173 | 3300048928 | Bacteria | 6264 |
| 711 | Ga0496125_0026915 | 3300048928 | Bacteria | 5223 |
| 712 | Ga0496125_0091422 | 3300048928 | Bacteria | 2280 |
| 713 | Ga0496125_0158785 | 3300048928 | Bacteria | 1540 |
| 714 | Ga0496125_0325321 | 3300048928 | Bacteria | 930 |
| 715 | Ga0496126_0805841 | 3300048929 | Bacteria | 720 |
| 716 | Ga0495682_0073699 | 3300049460 | Bacteria | 1228 |
| 717 | Ga0501034_0548052 | 3300049571 | Bacteria | 1066 |
| 718 | Ga0501037_0010551 | 3300049573 | Bacteria | 6785 |
| 719 | Ga0501046_0085905 | 3300049580 | Bacteria | 2426 |
| 720 | Ga0501225_0013794 | 3300049705 | Bacteria | 2259 |
| 721 | Ga0501262_000153 | 3300049759 | Bacteria | 8442 |
| 722 | Ga0501266_001605 | 3300049763 | Bacteria | 2884 |
| 723 | Ga0501269_063195 | 3300049766 | Bacteria | 527 |
| 724 | Ga0501281_15192 | 3300049777 | Bacteria | 567 |
| 725 | nmdc:mga03683_10250_c1 | 3300050489 | Bacteria | 3358 |
| 726 | nmdc:mga03683_209216_c1 | 3300050489 | Bacteria | 897 |
| 727 | nmdc:mga03683_224231_c1 | 3300050489 | Bacteria | 868 |
| 728 | nmdc:mga03683_36119_c1 | 3300050489 | Bacteria | 2008 |
| 729 | nmdc:mga03683_406129_c1 | 3300050489 | Bacteria | 651 |
| 730 | nmdc:mga03683_439257_c1 | 3300050489 | Bacteria | 627 |
| 731 | nmdc:mga03n38_10203_c1 | 3300050490 | Bacteria | 3447 |
| 732 | nmdc:mga03n38_25159_c1 | 3300050490 | Bacteria | 2441 |
| 733 | nmdc:mga03n38_25218_c1 | 3300050490 | Bacteria | 2439 |
| 734 | nmdc:mga03n38_369277_c1 | 3300050490 | Bacteria | 784 |
| 735 | nmdc:mga00v17_21047_c2 | 3300050491 | Bacteria | 2596 |
| 736 | nmdc:mga00v17_359062_c1 | 3300050491 | Bacteria | 947 |
| 737 | nmdc:mga00v17_53639_c1 | 3300050491 | Bacteria | 2458 |
| 738 | nmdc:mga0yw44_28385_c1 | 3300050492 | Bacteria | 3218 |
| 739 | nmdc:mga0yw44_58591_c1 | 3300050492 | Bacteria | 2353 |
| 740 | nmdc:mga0k408_127897_c1 | 3300050493 | Bacteria | 1507 |
| 741 | nmdc:mga0k408_132105_c1 | 3300050493 | Bacteria | 1482 |
| 742 | nmdc:mga0k408_197323_c1 | 3300050493 | Bacteria | 1201 |
| 743 | nmdc:mga0k408_265279_c1 | 3300050493 | Bacteria | 1025 |
| 744 | nmdc:mga0k408_289323_c1 | 3300050493 | Bacteria | 978 |
| 745 | nmdc:mga0k408_36012_c1 | 3300050493 | Bacteria | 2839 |
| 746 | nmdc:mga0k408_403132_c1 | 3300050493 | Bacteria | 814 |
| 747 | nmdc:mga0k408_41811_c1 | 3300050493 | Bacteria | 2639 |
| 748 | nmdc:mga0k408_4603_c1 | 3300050493 | Bacteria | 7317 |
| 749 | nmdc:mga0k408_513833_c1 | 3300050493 | Bacteria | 709 |
| 750 | nmdc:mga0k408_52519_c1 | 3300050493 | Bacteria | 2362 |
| 751 | nmdc:mga06z11_277517_c1 | 3300050494 | Bacteria | 992 |
| 752 | nmdc:mga06z11_738697_c1 | 3300050494 | Bacteria | 600 |
| 753 | nmdc:mga04h51_139923_c1 | 3300050495 | Bacteria | 917 |
| 754 | nmdc:mga07m45_100184_c1 | 3300050496 | Bacteria | 1664 |
| 755 | nmdc:mga07m45_174148_c1 | 3300050496 | Bacteria | 1251 |
| 756 | nmdc:mga07m45_1973_c1 | 3300050496 | Bacteria | 9501 |
| 757 | nmdc:mga07m45_21686_c1 | 3300050496 | Bacteria | 3500 |
| 758 | nmdc:mga07m45_224527_c1 | 3300050496 | Bacteria | 1093 |
| 759 | nmdc:mga07m45_345113_c1 | 3300050496 | Bacteria | 865 |
| 760 | nmdc:mga07m45_8907_c1 | 3300050496 | Bacteria | 5182 |
| 761 | nmdc:mga09592_239398_c1 | 3300050508 | Bacteria | 1572 |
| 762 | nmdc:mga09592_5962_c1 | 3300050508 | Bacteria | 9932 |
| 763 | nmdc:mga0qj67_17296_c1 | 3300050509 | Bacteria | 5481 |
| 764 | Ga0500610_0006176 | 3300053079 | Bacteria | 5000 |
| 765 | Ga0500610_0013178 | 3300053079 | Bacteria | 3837 |
| 766 | Ga0500578_0039951 | 3300053086 | Bacteria | 3015 |
| 767 | Ga0500643_055693 | 3300053087 | Bacteria | 1119 |
| 768 | Ga0500644_0002098 | 3300053088 | Bacteria | 5060 |
| 769 | Ga0500651_0027085 | 3300053093 | Bacteria | 3604 |
| 770 | Ga0500651_0299293 | 3300053093 | Bacteria | 923 |
| 771 | Ga0500641_0061010 | 3300053096 | Bacteria | 1570 |
| 772 | Ga0500641_0120501 | 3300053096 | Bacteria | 1131 |
| 773 | Ga0500650_0093654 | 3300053098 | Bacteria | 1406 |
| 774 | Ga0500572_020849 | 3300053111 | Bacteria | 1730 |
| 775 | Ga0500592_012805 | 3300053116 | Bacteria | 1342 |
| 776 | Ga0500593_003907 | 3300053117 | Bacteria | 5717 |
| 777 | Ga0500593_008376 | 3300053117 | Bacteria | 4245 |
| 778 | Ga0500594_0003689 | 3300053118 | Bacteria | 3376 |
| 779 | Ga0500607_004990 | 3300053121 | Bacteria | 8825 |
| 780 | Ga0500607_216595 | 3300053121 | Bacteria | 803 |
| 781 | Ga0500608_004926 | 3300053122 | Bacteria | 5233 |
| 782 | Ga0500608_043313 | 3300053122 | Bacteria | 2161 |
| 783 | Ga0500618_020979 | 3300053125 | Bacteria | 1598 |
| 784 | Ga0500655_000523 | 3300053133 | Bacteria | 7736 |
| 785 | Ga0500658_0001924 | 3300053134 | Bacteria | 8127 |
| 786 | Ga0500559_0000011 | 3300053136 | Bacteria | 164751 |
| 787 | Ga0500559_0005307 | 3300053136 | Bacteria | 5936 |
| 788 | Ga0500568_0006491 | 3300053139 | Bacteria | 5865 |
| 789 | Ga0500568_0306157 | 3300053139 | Bacteria | 577 |
| 790 | Ga0500616_0143992 | 3300053153 | Bacteria | 1110 |
| 791 | Ga0500616_0164096 | 3300053153 | Bacteria | 1016 |
| 792 | Ga0500616_0309782 | 3300053153 | Bacteria | 653 |
| 793 | Ga0500622_0055210 | 3300053156 | Bacteria | 2035 |
| 794 | Ga0500622_0155426 | 3300053156 | Bacteria | 1077 |
| 795 | Ga0500624_026386 | 3300053157 | Bacteria | 972 |
| 796 | Ga0500627_0006722 | 3300053158 | Bacteria | 3944 |
| 797 | Ga0500627_0225857 | 3300053158 | Bacteria | 834 |
| 798 | Ga0500634_0006145 | 3300053161 | Bacteria | 5783 |
| 799 | Ga0500638_003903 | 3300053162 | Bacteria | 5628 |
| 800 | Ga0500625_070542 | 3300053729 | Bacteria | 1556 |
| 801 | Ga0500645_002856 | 3300053730 | Bacteria | 7416 |
| 802 | Ga0500645_015872 | 3300053730 | Bacteria | 2380 |
| 803 | Ga0500645_017528 | 3300053730 | Bacteria | 2243 |
| 804 | Ga0500645_163810 | 3300053730 | Bacteria | 609 |
| 805 | Ga0466962_0006446 | 3300061719 | Bacteria | 5634 |
| 806 | Ga0466962_0010759 | 3300061719 | Bacteria | 4397 |
| 807 | 2511244316 | 2511231002 | Bacteria | 5042903 |
| 808 | 2513227977 | 2513020051 | Bacteria | 6053213 |
| 809 | 2548500009 | 2547132374 | Bacteria | 5530232 |
| 810 | 2597028588 | 2596583598 | Bacteria | 5251611 |
| 811 | 2599445274 | 2599185178 | Bacteria | 5365746 |
| 812 | 2599624056 | 2599185214 | Bacteria | 8209958 |
| 813 | 2599672067 | 2599185226 | Bacteria | 8233575 |
| 814 | 2599681851 | 2599185227 | Bacteria | 8246414 |
| 815 | 2599693864 | 2599185229 | Bacteria | 8216126 |
| 816 | 2643868245 | 2643221570 | Bacteria | 5103772 |
| 817 | 2643993761 | 2643221596 | Bacteria | 5006805 |
| 818 | 2644293849 | 2643221652 | Bacteria | 5140275 |
| 819 | 2644304803 | 2643221654 | Bacteria | 5273570 |
| 820 | 2644339985 | 2643221660 | Bacteria | 4208257 |
| 821 | 2644397969 | 2643221672 | Bacteria | 6322190 |
| 822 | 2644644672 | 2643221717 | Bacteria | 5676132 |
| 823 | 2738719919 | 2738541277 | Bacteria | 7458140 |
| 824 | 2738879669 | 2738541307 | Bacteria | 8606193 |
| 825 | 2739279118 | 2738543019 | Bacteria | 7459457 |
| 826 | 2831269543 | 2831265667 | Bacteria | 7184833 |
| 827 | 2838060034 | 2838054893 | Bacteria | 7451788 |
| 828 | 2842681905 | 2842677519 | Bacteria | 5615038 |
| 829 | 2842734700 | 2842733646 | Bacteria | 5716726 |
| 830 | 2842748535 | 2842747753 | Bacteria | 5578255 |
| 831 | 2858693128 | 2858688981 | Bacteria | 8184122 |
| 832 | 2885195586 | 2885192300 | Bacteria | 5882526 |
| 833 | 2885199215 | 2885198086 | Bacteria | 7212419 |
| 834 | 2885212866 | 2885211737 | Bacteria | 7212420 |
| 835 | 2900580230 | 2900577576 | Bacteria | 5438534 |
| 836 | 2904450086 | 2904449895 | Bacteria | 6927402 |
| 837 | 2904457091 | 2904456579 | Bacteria | 6819253 |
| 838 | 2904543933 | 2904541872 | Bacteria | 8915136 |
| 839 | 2919464981 | 2919462493 | Bacteria | 5817112 |
| 840 | 2919704621 | 2919704043 | Bacteria | 5560311 |
| 841 | 2928076738 | 2928070936 | Bacteria | 8062541 |
| 842 | 2928090512 | 2928084124 | Bacteria | 7159212 |
| 843 | 2928117338 | 2928115317 | Bacteria | 6477646 |
| 844 | 2929162508 | 2929160207 | Bacteria | 9075316 |
| 845 | 2929525376 | 2929520902 | Bacteria | 6765052 |
| 846 | 2945913120 | 2945909444 | Bacteria | 7065066 |
| 847 | 2945948746 | 2945945610 | Bacteria | 5951079 |
| 848 | 2945972866 | 2945972063 | Bacteria | 6086495 |
| 849 | 2945984610 | 2945984333 | Bacteria | 7358892 |
| 850 | 2954772886 | 2954767861 | Bacteria | 5535784 |
| 851 | 2990713395 | 2990710928 | Bacteria | 5002431 |
| 852 | Ga0068855_100815857 | |||
| 853 | JGI24741J21665_1001445 | |||
| 854 | JGI24740J21852_10000319 | |||
| 855 | JGI24740J21852_10007091 | |||
| 856 | JGI24739J22299_10005364 | |||
| 857 | JGI25155J39150_1000074 | |||
| 858 | JGI25156J39149_1000002 | |||
| 859 | JGI25154J39366_1000010 | |||
| 860 | JGI25158J39367_1003721 | |||
| 861 | JGI25157J39369_1000001 | |||
| 862 | JGI25150J39212_1001101 | |||
| 863 | JGI25150J39212_1001868 | |||
| 864 | JGI25150J39212_1009272 | |||
| 865 | JGI25159J45721_1000465 | |||
| 866 | JGI25159J45721_1002893 | |||
| 867 | JGI25159J45721_1017298 | |||
| 868 | JGI25151J46595_10015217 | |||
| 869 | rootH2_10194452 | |||
| 870 | JGI25160J50197_1000192 | |||
| 871 | JGI25160J50197_1018502 | |||
| 872 | JGI25160J50197_1059988 | |||
| 873 | JGI25161J50226_1000043 | |||
| 874 | Ga0055538_1001079 | |||
| 875 | Ga0055538_1011084 | |||
| 876 | Ga0055539_1000123 | |||
| 877 | Ga0055533_1002174 | |||
| 878 | Ga0055533_1002613 | |||
| 879 | Ga0055533_1003314 | |||
| 880 | Ga0055532_1000002 | |||
| 881 | Ga0055532_1000029 | |||
| 882 | Ga0055525_1000345 | |||
| 883 | Ga0055542_1001189 | |||
| 884 | Ga0055529_1000062 | |||
| 885 | Ga0055526_1000441 | |||
| 886 | Ga0055526_1003998 | |||
| 887 | Ga0055526_1004562 | |||
| 888 | Ga0055537_1000259 | |||
| 889 | Ga0055537_1001161 | |||
| 890 | Ga0055537_1004429 | |||
| 891 | Ga0055537_1009409 | |||
| 892 | Ga0055524_1000156 | |||
| 893 | Ga0055524_1009658 | |||
| 894 | Ga0055536_1000270 | |||
| 895 | Ga0055536_1003726 | |||
| 896 | Ga0055536_1009172 | |||
| 897 | Ga0055534_1001138 | |||
| 898 | Ga0055534_1003028 | |||
| 899 | Ga0055534_1006217 | |||
| 900 | Ga0055534_1006824 | |||
| 901 | Ga0055534_1029829 | |||
| 902 | Ga0055528_1008541 | |||
| 903 | Ga0055528_1020328 | |||
| 904 | Ga0055530_10000408 | |||
| 905 | Ga0055530_10003951 | |||
| 906 | Ga0055530_10009348 | |||
| 907 | Ga0055530_10033474 | |||
| 908 | Ga0055540_1000033 | |||
| 909 | Ga0055540_1003778 | |||
| 910 | Ga0055540_1004106 | |||
| 911 | Ga0055540_1004580 | |||
| 912 | Ga0055540_1073622 | |||
| 913 | Ga0055531_10000273 | |||
| 914 | Ga0055531_10004865 | |||
| 915 | Ga0055531_10009016 | |||
| 916 | Ga0055531_10046577 | |||
| 917 | Ga0055541_1000208 | |||
| 918 | Ga0055541_1001170 | |||
| 919 | Ga0055541_1018967 | |||
| 920 | Ga0055541_1018975 | |||
| 921 | Ga0055543_1000127 | |||
| 922 | Ga0055543_1003299 | |||
| 923 | Ga0065165_1028859 | |||
| 924 | Ga0065165_1067279 | |||
| 925 | Ga0065704_10140698 | |||
| 926 | Ga0065704_10292894 | |||
| 927 | Ga0070676_10691508 | |||
| 928 | Ga0070670_100587130 | |||
| 929 | Ga0070677_10004622 | |||
| 930 | Ga0068869_100042886 | |||
| 931 | Ga0068869_100144770 | |||
| 932 | Ga0070680_100154059 | |||
| 933 | Ga0070680_100327448 | |||
| 934 | Ga0068868_100092735 | |||
| 935 | Ga0068868_100301613 | |||
| 936 | Ga0070660_100063427 | |||
| 937 | Ga0070661_100001595 | |||
| 938 | Ga0070661_100551136 | |||
| 939 | Ga0070661_101649227 | |||
| 940 | Ga0070668_100436175 | |||
| 941 | Ga0070669_100049588 | |||
| 942 | Ga0070675_100000158 | |||
| 943 | Ga0070675_100048670 | |||
| 944 | Ga0070671_100004317 | |||
| 945 | Ga0070671_100213572 | |||
| 946 | Ga0070674_100011597 | |||
| 947 | Ga0070674_100157791 | |||
| 948 | Ga0070673_100041500 | |||
| 949 | Ga0070673_100046916 | |||
| 950 | Ga0070659_100018367 | |||
| 951 | Ga0070667_100015538 | |||
| 952 | Ga0070667_100068522 | |||
| 953 | Ga0070667_100174663 | |||
| 954 | Ga0070714_100375116 | |||
| 955 | Ga0070663_100000011 | |||
| 956 | Ga0070663_100007541 | |||
| 957 | Ga0070678_100031759 | |||
| 958 | Ga0070678_100064383 | |||
| 959 | Ga0070662_100131317 | |||
| 960 | Ga0068867_100000092 | |||
| 961 | Ga0068867_100002736 | |||
| 962 | Ga0068867_100003562 | |||
| 963 | Ga0068867_100018629 | |||
| 964 | Ga0068867_100631262 | |||
| 965 | Ga0068853_100099468 | |||
| 966 | Ga0068853_100232269 | |||
| 967 | Ga0068853_101853500 | |||
| 968 | Ga0070672_100047628 | |||
| 969 | Ga0070672_100116863 | |||
| 970 | Ga0070672_100187081 | |||
| 971 | Ga0070665_100161485 | |||
| 972 | Ga0070665_100796843 | |||
| 973 | Ga0070665_101285026 | |||
| 974 | Ga0070665_101285386 | |||
| 975 | Ga0068855_100076757 | |||
| 976 | Ga0068855_100089079 | |||
| 977 | Ga0068855_100146314 | |||
| 978 | Ga0070664_100000008 | |||
| 979 | Ga0070664_100013869 | |||
| 980 | Ga0068857_100002038 | |||
| 981 | Ga0068857_100223425 | |||
| 982 | Ga0068857_100318117 | |||
| 983 | Ga0068854_100000052 | |||
| 984 | Ga0068856_100000009 | |||
| 985 | Ga0068856_100439570 | |||
| 986 | Ga0068852_100148447 | |||
| 987 | Ga0068852_100168505 | |||
| 988 | Ga0068851_10092729 | |||
| 989 | Ga0068862_100068756 | |||
| 990 | Ga0068862_101290497 | |||
| 991 | Ga0075365_10245891 | |||
| 992 | Ga0075363_100083557 | |||
| 993 | Ga0075363_100187166 | |||
| 994 | Ga0075364_10025580 | |||
| 995 | Ga0075364_10459791 | |||
| 996 | Ga0075432_10007261 | |||
| 997 | Ga0075432_10007774 | |||
| 998 | Ga0075362_10003943 | |||
| 999 | Ga0075362_10014025 | |||
| 1000 | Ga0075362_10026155 | |||
| 1001 | Ga0075362_10060691 | |||
| 1002 | Ga0075362_10324345 | |||
| 1003 | Ga0075362_10611600 | |||
| 1004 | Ga0075367_10183859 | |||
| 1005 | Ga0075366_10011492 | |||
| 1006 | Ga0075366_10051211 | |||
| 1007 | Ga0075366_10069431 | |||
| 1008 | Ga0075366_10089703 | |||
| 1009 | Ga0075366_10156187 | |||
| 1010 | Ga0075366_10287610 | |||
| 1011 | Ga0075366_10336508 | |||
| 1012 | Ga0075366_10386789 | |||
| 1013 | Ga0075366_10590118 | |||
| 1014 | Ga0097621_101230416 | |||
| 1015 | Ga0097621_101454490 | |||
| 1016 | Ga0075370_10000322 | |||
| 1017 | Ga0075370_10000738 | |||
| 1018 | Ga0075370_10046321 | |||
| 1019 | Ga0075370_10107198 | |||
| 1020 | Ga0075370_10173015 | |||
| 1021 | Ga0075370_10197097 | |||
| 1022 | Ga0075370_10501225 | |||
| 1023 | Ga0068871_100173810 | |||
| 1024 | Ga0075430_100021936 | |||
| 1025 | Ga0075429_100010391 | |||
| 1026 | Ga0075429_100760561 | |||
| 1027 | Ga0079104_1016127 | |||
| 1028 | Ga0079104_1020241 | |||
| 1029 | Ga0079104_1036670 | |||
| 1030 | Ga0099826_10008499 | |||
| 1031 | Ga0099826_10444032 | |||
| 1032 | Ga0105244_10003000 | |||
| 1033 | Ga0105244_10326503 | |||
| 1034 | Ga0105240_10004043 | |||
| 1035 | Ga0105240_10010244 | |||
| 1036 | Ga0105240_10027063 | |||
| 1037 | Ga0105245_10273025 | |||
| 1038 | Ga0105245_10323309 | |||
| 1039 | Ga0105243_10003757 | |||
| 1040 | Ga0105243_10009638 | |||
| 1041 | Ga0105243_10009706 | |||
| 1042 | Ga0105243_10022421 | |||
| 1043 | Ga0105242_10003000 | |||
| 1044 | Ga0105242_10495201 | |||
| 1045 | Ga0105242_10698787 | |||
| 1046 | Ga0105248_11123506 | |||
| 1047 | Ga0105237_10000945 | |||
| 1048 | Ga0105237_10124271 | |||
| 1049 | Ga0105237_11003981 | |||
| 1050 | Ga0105238_10081095 | |||
| 1051 | Ga0105249_11186873 | |||
| 1052 | Ga0105239_10005802 | |||
| 1053 | Ga0105239_10266673 | |||
| 1054 | Ga0105239_11418942 | |||
| 1055 | Ga0105246_10035641 | |||
| 1056 | Ga0105246_10913458 | |||
| 1057 | Ga0105246_11602204 | |||
| 1058 | Ga0157347_1002569 | |||
| 1059 | Ga0157347_1003557 | |||
| 1060 | Ga0157326_1000968 | |||
| 1061 | Ga0157373_10010823 | |||
| 1062 | Ga0157373_10023683 | |||
| 1063 | Ga0157373_10345524 | |||
| 1064 | Ga0157371_10000068 | |||
| 1065 | Ga0157371_10310855 | |||
| 1066 | Ga0157370_10010316 | |||
| 1067 | Ga0157370_10072460 | |||
| 1068 | Ga0157370_10367712 | |||
| 1069 | Ga0157370_11167749 | |||
| 1070 | Ga0157369_10012328 | |||
| 1071 | Ga0157374_11738372 | |||
| 1072 | Ga0157378_10076690 | |||
| 1073 | Ga0157378_10298572 | |||
| 1074 | Ga0163162_10165510 | |||
| 1075 | Ga0163162_10707785 | |||
| 1076 | Ga0157372_10000271 | |||
| 1077 | Ga0157375_10298060 | |||
| 1078 | Ga0157375_10598249 | |||
| 1079 | Ga0157375_11140407 | |||
| 1080 | Ga0157380_10002034 | |||
| 1081 | Ga0157380_10747942 | |||
| 1082 | Ga0182008_10001340 | |||
| 1083 | Ga0182008_10002648 | |||
| 1084 | Ga0182008_10016053 | |||
| 1085 | Ga0182008_10044379 | |||
| 1086 | Ga0182008_10053246 | |||
| 1087 | Ga0157377_10000163 | |||
| 1088 | Ga0157377_10234269 | |||
| 1089 | Ga0157379_10423334 | |||
| 1090 | Ga0157376_10148287 | |||
| 1091 | Ga0157376_10335114 | |||
| 1092 | Ga0157376_11077177 | |||
| 1093 | Ga0182006_1001145 | |||
| 1094 | Ga0182006_1012267 | |||
| 1095 | Ga0182006_1029708 | |||
| 1096 | Ga0182006_1147247 | |||
| 1097 | Ga0182007_10008474 | |||
| 1098 | Ga0182005_1012041 | |||
| 1099 | Ga0182005_1140321 | |||
| 1100 | Ga0183362_10001 | |||
| 1101 | Ga0163161_10000166 | |||
| 1102 | Ga0163161_10017700 | |||
| 1103 | Ga0163161_10017854 | |||
| 1104 | Ga0206351_10253009 | |||
| 1105 | Ga0206350_10481412 | |||
| 1106 | Ga0154015_1103548 | |||
| 1107 | Ga0213872_10034267 | |||
| 1108 | Ga0213876_10579543 | |||
| 1109 | Ga0209435_100001 | |||
| 1110 | Ga0209436_103077 | |||
| 1111 | Ga0209436_104293 | |||
| 1112 | Ga0209784_100003 | |||
| 1113 | Ga0209784_100482 | |||
| 1114 | Ga0209784_100539 | |||
| 1115 | Ga0209784_101093 | |||
| 1116 | Ga0209566_100002 | |||
| 1117 | Ga0209566_100970 | |||
| 1118 | Ga0209566_111096 | |||
| 1119 | Ga0209566_111097 | |||
| 1120 | Ga0209674_100008 | |||
| 1121 | Ga0209674_100229 | |||
| 1122 | Ga0209674_101558 | |||
| 1123 | Ga0209672_100052 | |||
| 1124 | Ga0209147_100002 | |||
| 1125 | Ga0209563_100004 | |||
| 1126 | Ga0209563_106635 | |||
| 1127 | Ga0209563_111006 | |||
| 1128 | Ga0209563_114368 | |||
| 1129 | Ga0209258_100002 | |||
| 1130 | Ga0207425_1000603 | |||
| 1131 | Ga0207425_1001556 | |||
| 1132 | Ga0207425_1002814 | |||
| 1133 | Ga0207425_1010123 | |||
| 1134 | Ga0209646_1000001 | |||
| 1135 | Ga0209646_1000059 | |||
| 1136 | Ga0209026_1000001 | |||
| 1137 | Ga0209026_1008832 | |||
| 1138 | Ga0209677_100009 | |||
| 1139 | Ga0209677_102838 | |||
| 1140 | Ga0209148_1000021 | |||
| 1141 | Ga0209759_1000001 | |||
| 1142 | Ga0209759_1002389 | |||
| 1143 | Ga0209759_1003853 | |||
| 1144 | Ga0209759_1005426 | |||
| 1145 | Ga0209129_1000071 | |||
| 1146 | Ga0209565_1000120 | |||
| 1147 | Ga0209565_1000326 | |||
| 1148 | Ga0209565_1000774 | |||
| 1149 | Ga0209565_1001593 | |||
| 1150 | Ga0209565_1056566 | |||
| 1151 | Ga0209455_1000021 | |||
| 1152 | Ga0209673_1000099 | |||
| 1153 | Ga0209673_1000839 | |||
| 1154 | Ga0209673_1001338 | |||
| 1155 | Ga0209130_1000041 | |||
| 1156 | Ga0209130_1000456 | |||
| 1157 | Ga0209130_1000952 | |||
| 1158 | Ga0209130_1001771 | |||
| 1159 | Ga0209130_1003498 | |||
| 1160 | Ga0209675_1000054 | |||
| 1161 | Ga0209675_1000290 | |||
| 1162 | Ga0209675_1001678 | |||
| 1163 | Ga0209675_1008675 | |||
| 1164 | Ga0209675_1014145 | |||
| 1165 | Ga0209676_1000005 | |||
| 1166 | Ga0209676_1000054 | |||
| 1167 | Ga0209676_1000260 | |||
| 1168 | Ga0209676_1002320 | |||
| 1169 | Ga0209676_1006861 | |||
| 1170 | Ga0209676_1012219 | |||
| 1171 | Ga0209676_1026508 | |||
| 1172 | Ga0209025_1001409 | |||
| 1173 | Ga0209025_1010783 | |||
| 1174 | Ga0209025_1013211 | |||
| 1175 | Ga0209025_1014966 | |||
| 1176 | Ga0209564_1000009 | |||
| 1177 | Ga0209564_1000239 | |||
| 1178 | Ga0209564_1000662 | |||
| 1179 | Ga0209564_1000784 | |||
| 1180 | Ga0209564_1000890 | |||
| 1181 | Ga0209758_1000027 | |||
| 1182 | Ga0209758_1010200 | |||
| 1183 | Ga0209758_1050345 | |||
| 1184 | Ga0209050_1000003 | |||
| 1185 | Ga0209050_1000007 | |||
| 1186 | Ga0209050_1000954 | |||
| 1187 | Ga0209050_1004569 | |||
| 1188 | Ga0209050_1016241 | |||
| 1189 | Ga0209256_1000001 | |||
| 1190 | Ga0209256_1000081 | |||
| 1191 | Ga0209256_1024131 | |||
| 1192 | Ga0209256_1059446 | |||
| 1193 | Ga0207426_1000027 | |||
| 1194 | Ga0207426_1000061 | |||
| 1195 | Ga0207426_1003593 | |||
| 1196 | Ga0207426_1004649 | |||
| 1197 | Ga0209051_1000003 | |||
| 1198 | Ga0209051_1000009 | |||
| 1199 | Ga0209051_1000319 | |||
| 1200 | Ga0209051_1000619 | |||
| 1201 | Ga0209051_1005714 | |||
| 1202 | Ga0209051_1019179 | |||
| 1203 | Ga0209051_1019880 | |||
| 1204 | Ga0209257_1000018 | |||
| 1205 | Ga0209257_1000873 | |||
| 1206 | Ga0209257_1007556 | |||
| 1207 | Ga0209257_1007934 | |||
| 1208 | Ga0209257_1008583 | |||
| 1209 | Ga0209257_1011066 | |||
| 1210 | Ga0207697_10108593 | |||
| 1211 | Ga0207656_10032769 | |||
| 1212 | Ga0207655_1001368 | |||
| 1213 | Ga0207682_10001652 | |||
| 1214 | Ga0207682_10099945 | |||
| 1215 | Ga0207688_10038678 | |||
| 1216 | Ga0207680_10417892 | |||
| 1217 | Ga0207647_10254573 | |||
| 1218 | Ga0207645_10055100 | |||
| 1219 | Ga0207645_10063693 | |||
| 1220 | Ga0207645_10446080 | |||
| 1221 | Ga0207705_10299096 | |||
| 1222 | Ga0207695_10001909 | |||
| 1223 | Ga0207695_10004148 | |||
| 1224 | Ga0207695_10125685 | |||
| 1225 | Ga0207695_10630993 | |||
| 1226 | Ga0207671_10123849 | |||
| 1227 | Ga0207660_10038245 | |||
| 1228 | Ga0207660_10311643 | |||
| 1229 | Ga0207649_10001269 | |||
| 1230 | Ga0207649_11270916 | |||
| 1231 | Ga0207681_10014932 | |||
| 1232 | Ga0207694_10061134 | |||
| 1233 | Ga0207694_10197807 | |||
| 1234 | Ga0207650_10001711 | |||
| 1235 | Ga0207659_10001143 | |||
| 1236 | Ga0207659_10168409 | |||
| 1237 | Ga0207687_10043205 | |||
| 1238 | Ga0207687_10087175 | |||
| 1239 | Ga0207664_11081393 | |||
| 1240 | Ga0207644_10003362 | |||
| 1241 | Ga0207690_10014545 | |||
| 1242 | Ga0207706_10017147 | |||
| 1243 | Ga0207706_10918481 | |||
| 1244 | Ga0207709_10000230 | |||
| 1245 | Ga0207709_10002452 | |||
| 1246 | Ga0207709_10022627 | |||
| 1247 | Ga0207669_10003638 | |||
| 1248 | Ga0207669_10617448 | |||
| 1249 | Ga0207704_10162483 | |||
| 1250 | Ga0207704_11228983 | |||
| 1251 | Ga0207691_10055060 | |||
| 1252 | Ga0207691_10056335 | |||
| 1253 | Ga0207691_10151133 | |||
| 1254 | Ga0207691_10826383 | |||
| 1255 | Ga0207711_10463975 | |||
| 1256 | Ga0207689_10025300 | |||
| 1257 | Ga0207689_10285070 | |||
| 1258 | Ga0207679_10000001 | |||
| 1259 | Ga0207679_10008899 | |||
| 1260 | Ga0207667_10088447 | |||
| 1261 | Ga0207667_10224669 | |||
| 1262 | Ga0207667_10479044 | |||
| 1263 | Ga0207667_10663985 | |||
| 1264 | Ga0207651_10008073 | |||
| 1265 | Ga0207651_10346029 | |||
| 1266 | Ga0207640_10000035 | |||
| 1267 | Ga0207640_10315862 | |||
| 1268 | Ga0207658_10000754 | |||
| 1269 | Ga0207658_10060529 | |||
| 1270 | Ga0207658_10178315 | |||
| 1271 | Ga0207677_10072405 | |||
| 1272 | Ga0207677_10196868 | |||
| 1273 | Ga0207639_10350464 | |||
| 1274 | Ga0207678_10000001 | |||
| 1275 | Ga0207678_10002368 | |||
| 1276 | Ga0207702_10008078 | |||
| 1277 | Ga0207702_10541109 | |||
| 1278 | Ga0207641_10151496 | |||
| 1279 | Ga0207648_10001232 | |||
| 1280 | Ga0207648_10005724 | |||
| 1281 | Ga0207648_10027075 | |||
| 1282 | Ga0207648_10038520 | |||
| 1283 | Ga0207648_10271507 | |||
| 1284 | Ga0207674_10012396 | |||
| 1285 | Ga0207674_10250557 | |||
| 1286 | Ga0207674_10353949 | |||
| 1287 | Ga0207683_10014615 | |||
| 1288 | Ga0207683_10070721 | |||
| 1289 | Ga0207683_10071124 | |||
| 1290 | Ga0207683_10221142 | |||
| 1291 | Ga0207698_10060310 | |||
| 1292 | Ga0207698_10099871 | |||
| 1293 | Ga0207698_10326422 | |||
| 1294 | Ga0209282_1000133 | |||
| 1295 | Ga0209813_10164718 | |||
| 1296 | Ga0209974_10014445 | |||
| 1297 | Ga0207428_10248181 | |||
| 1298 | Ga0268266_10014251 | |||
| 1299 | Ga0268266_10487016 | |||
| 1300 | Ga0268266_11102064 | |||
| 1301 | Ga0268265_10042673 | |||
| 1302 | Ga0307515_10001286 | |||
| 1303 | Ga0307515_10001485 | |||
| 1304 | Ga0307515_10026348 | |||
| 1305 | Ga0307515_10046408 | |||
| 1306 | Ga0307515_10172925 | |||
| 1307 | Ga0307512_10068145 | |||
| 1308 | Ga0314311_1134334 | |||
| 1309 | Ga0316182_1071470 | |||
| 1310 | Ga0265327_10002745 | |||
| 1311 | Ga0307513_10000012 | |||
| 1312 | Ga0307513_10000285 | |||
| 1313 | Ga0307513_10061834 | |||
| 1314 | Ga0307513_10131485 | |||
| 1315 | Ga0307509_10032544 | |||
| 1316 | Ga0307509_10034762 | |||
| 1317 | Ga0307509_10061068 | |||
| 1318 | Ga0307509_10361881 | |||
| 1319 | Ga0307408_100000079 | |||
| 1320 | Ga0307408_100022449 | |||
| 1321 | Ga0307408_100037053 | |||
| 1322 | Ga0307408_100060612 | |||
| 1323 | Ga0307408_100101444 | |||
| 1324 | Ga0307408_100344212 | |||
| 1325 | Ga0307408_100515197 | |||
| 1326 | Ga0307508_10000094 | |||
| 1327 | Ga0307508_10176342 | |||
| 1328 | Ga0307508_10440890 | |||
| 1329 | Ga0307514_10078672 | |||
| 1330 | Ga0265314_10147622 | |||
| 1331 | Ga0307516_10000525 | |||
| 1332 | Ga0307516_10004265 | |||
| 1333 | Ga0307516_10022750 | |||
| 1334 | Ga0307516_10458109 | |||
| 1335 | Ga0307405_10265904 | |||
| 1336 | Ga0307405_10328907 | |||
| 1337 | Ga0307405_10596852 | |||
| 1338 | Ga0307405_10893644 | |||
| 1339 | Ga0307406_10000927 | |||
| 1340 | Ga0307406_10009555 | |||
| 1341 | Ga0307406_10074343 | |||
| 1342 | Ga0307406_10534627 | |||
| 1343 | Ga0307412_10035354 | |||
| 1344 | Ga0307412_10045864 | |||
| 1345 | Ga0307412_10058510 | |||
| 1346 | Ga0307412_10096532 | |||
| 1347 | Ga0307412_10119539 | |||
| 1348 | Ga0307412_10143813 | |||
| 1349 | Ga0307412_10641112 | |||
| 1350 | Ga0307416_100044749 | |||
| 1351 | Ga0307416_100089287 | |||
| 1352 | Ga0307416_100200115 | |||
| 1353 | Ga0307416_101286618 | |||
| 1354 | Ga0307416_101651287 | |||
| 1355 | Ga0307414_10405799 | |||
| 1356 | Ga0307414_10411971 | |||
| 1357 | Ga0307414_11509865 | |||
| 1358 | Ga0307411_10414179 | |||
| 1359 | Ga0307411_11633047 | |||
| 1360 | Ga0307507_10096639 | |||
| 1361 | Ga0307510_10054117 | |||
| 1362 | Ga0307510_10108768 | |||
| 1363 | Ga0373959_0042364 | |||
| 1364 | Ga0373931_0315990 | |||
| 1365 | Ga0373925_0824834 | |||
| 1366 | Ga0395899_0000344 | |||
| 1367 | Ga0395899_0079887 | |||
| 1368 | Ga0395900_0019446 | |||
| 1369 | Ga0395900_0109112 | |||
| 1370 | Ga0395898_0174190 | |||
| 1371 | Ga0395905_0022085 | |||
| 1372 | Ga0395905_0037501 | |||
| 1373 | Ga0395905_0038248 | |||
| 1374 | Ga0395905_0083297 | |||
| 1375 | Ga0395905_0158898 | |||
| 1376 | Ga0395901_0127946 | |||
| 1377 | Ga0395901_0131188 | |||
| 1378 | Ga0395901_0373732 | |||
| 1379 | Ga0436365_1619585 | |||
| 1380 | Ga0436365_1868038 | |||
| 1381 | Ga0436361_0268202 | |||
| 1382 | Ga0439436_0001379 | |||
| 1383 | Ga0439436_0006229 | |||
| 1384 | Ga0439439_0005352 | |||
| 1385 | Ga0439439_0005369 | |||
| 1386 | Ga0439439_0009655 | |||
| 1387 | Ga0439461_0050938 | |||
| 1388 | Ga0439465_0000697 | |||
| 1389 | Ga0451789_0337724 | |||
| 1390 | Ga0451791_1603068 | |||
| 1391 | Ga0451793_0018749 | |||
| 1392 | Ga0451793_1463256 | |||
| 1393 | Ga0451800_0610257 | |||
| 1394 | Ga0451807_0067919 | |||
| 1395 | Ga0451837_1700856 | |||
| 1396 | Ga0451841_1340995 | |||
| 1397 | Ga0451853_0112802 | |||
| 1398 | Ga0451853_3547166 | |||
| 1399 | Ga0439431_0000916 | |||
| 1400 | Ga0439431_0007247 | |||
| 1401 | Ga0439433_0000360 | |||
| 1402 | Ga0439442_009609 | |||
| 1403 | Ga0439442_016402 | |||
| 1404 | Ga0439445_0000835 | |||
| 1405 | Ga0439432_003052 | |||
| 1406 | Ga0439432_012101 | |||
| 1407 | Ga0439432_095902 | |||
| 1408 | Ga0439449_0001800 | |||
| 1409 | Ga0439449_0002084 | |||
| 1410 | Ga0439449_0003898 | |||
| 1411 | Ga0439449_0017753 | |||
| 1412 | Ga0439452_006051 | |||
| 1413 | Ga0439452_022075 | |||
| 1414 | Ga0439457_008504 | |||
| 1415 | Ga0439462_0004954 | |||
| 1416 | Ga0439462_0008200 | |||
| 1417 | Ga0439462_0012214 | |||
| 1418 | Ga0450911_014976 | |||
| 1419 | Ga0450920_022302 | |||
| 1420 | Ga0450888_020205 | |||
| 1421 | Ga0450898_007204 | |||
| 1422 | Ga0450906_002698 | |||
| 1423 | Ga0450906_011020 | |||
| 1424 | Ga0450907_034411 | |||
| 1425 | Ga0450910_015188 | |||
| 1426 | Ga0450909_006505 | |||
| 1427 | Ga0439434_0000980 | |||
| 1428 | Ga0439434_0008390 | |||
| 1429 | Ga0439434_0010643 | |||
| 1430 | Ga0439434_0092514 | |||
| 1431 | Ga0450893_0008574 | |||
| 1432 | Ga0466986_0061755 | |||
| 1433 | Ga0466977_0153091 | |||
| 1434 | Ga0466978_0022614 | |||
| 1435 | Ga0466965_0006416 | |||
| 1436 | Ga0466961_0004849 | |||
| 1437 | Ga0466961_0036663 | |||
| 1438 | Ga0466964_0006122 | |||
| 1439 | Ga0466964_0040101 | |||
| 1440 | Ga0453684_0000606 | |||
| 1441 | Ga0453684_0029039 | |||
| 1442 | Ga0466971_0077704 | |||
| 1443 | Ga0466968_0005280 | |||
| 1444 | Ga0466970_0006124 | |||
| 1445 | Ga0466970_0059958 | |||
| 1446 | Ga0466957_0580074 | |||
| 1447 | Ga0466960_0054582 | |||
| 1448 | Ga0466959_0008819 | |||
| 1449 | Ga0466959_0027997 | |||
| 1450 | Ga0451576_0013321 | |||
| 1451 | Ga0466967_0009266 | |||
| 1452 | Ga0466967_0237002 | |||
| 1453 | Ga0495617_000303 | |||
| 1454 | Ga0495627_008497 | |||
| 1455 | Ga0495627_088232 | |||
| 1456 | Ga0495590_0064769 | |||
| 1457 | Ga0495638_0028214 | |||
| 1458 | Ga0495651_0145428 | |||
| 1459 | Ga0495605_0000168 | |||
| 1460 | Ga0495639_0022262 | |||
| 1461 | Ga0495584_0002376 | |||
| 1462 | Ga0495584_0005922 | |||
| 1463 | Ga0495584_0039758 | |||
| 1464 | Ga0495585_0000193 | |||
| 1465 | Ga0495585_0004816 | |||
| 1466 | Ga0495596_0003328 | |||
| 1467 | Ga0495607_0000941 | |||
| 1468 | Ga0495583_0000525 | |||
| 1469 | Ga0495583_0018518 | |||
| 1470 | Ga0495606_0000001 | |||
| 1471 | Ga0495606_0035562 | |||
| 1472 | Ga0495606_0143507 | |||
| 1473 | Ga0495610_0005043 | |||
| 1474 | Ga0495610_0018746 | |||
| 1475 | Ga0495616_0000526 | |||
| 1476 | Ga0495616_0007518 | |||
| 1477 | Ga0495616_0008947 | |||
| 1478 | Ga0495616_0014603 | |||
| 1479 | Ga0495631_0004184 | |||
| 1480 | Ga0495637_0006045 | |||
| 1481 | Ga0495648_0000109 | |||
| 1482 | Ga0495663_0128016 | |||
| 1483 | Ga0495654_0003435 | |||
| 1484 | Ga0495654_0046196 | |||
| 1485 | Ga0495654_0062093 | |||
| 1486 | Ga0495654_0182136 | |||
| 1487 | Ga0495609_0000346 | |||
| 1488 | Ga0495609_0050548 | |||
| 1489 | Ga0495621_0010000 | |||
| 1490 | Ga0495621_0011585 | |||
| 1491 | Ga0495597_0004057 | |||
| 1492 | Ga0495597_0271549 | |||
| 1493 | Ga0495633_0006530 | |||
| 1494 | Ga0495633_0012623 | |||
| 1495 | Ga0495656_0003255 | |||
| 1496 | Ga0495656_0666815 | |||
| 1497 | Ga0495668_0000095 | |||
| 1498 | Ga0495668_0002235 | |||
| 1499 | Ga0495668_0052017 | |||
| 1500 | Ga0495668_0063099 | |||
| 1501 | Ga0495668_0118188 | |||
| 1502 | Ga0495625_0000896 | |||
| 1503 | Ga0495625_0090482 | |||
| 1504 | Ga0495625_0128104 | |||
| 1505 | Ga0495625_0344619 | |||
| 1506 | Ga0495659_0013477 | |||
| 1507 | Ga0495661_0069382 | |||
| 1508 | Ga0495661_0140755 | |||
| 1509 | Ga0495588_0019546 | |||
| 1510 | Ga0495588_0033592 | |||
| 1511 | Ga0495588_0252663 | |||
| 1512 | Ga0495657_0060967 | |||
| 1513 | Ga0495599_0187568 | |||
| 1514 | Ga0495669_0045637 | |||
| 1515 | Ga0495670_0267388 | |||
| 1516 | Ga0495671_0009212 | |||
| 1517 | Ga0495671_0030047 | |||
| 1518 | Ga0495649_0007050 | |||
| 1519 | Ga0495589_0311139 | |||
| 1520 | Ga0495600_0188319 | |||
| 1521 | Ga0495636_0027504 | |||
| 1522 | Ga0495683_0000144 | |||
| 1523 | Ga0495683_0454240 | |||
| 1524 | Ga0495687_007289 | |||
| 1525 | Ga0495677_0016382 | |||
| 1526 | Ga0495685_006498 | |||
| 1527 | Ga0495685_017529 | |||
| 1528 | Ga0495681_0009923 | |||
| 1529 | Ga0495614_0310627 | |||
| 1530 | Ga0495626_0041067 | |||
| 1531 | Ga0496100_0007340 | |||
| 1532 | Ga0496101_0018273 | |||
| 1533 | Ga0496102_0000707 | |||
| 1534 | Ga0496102_0042793 | |||
| 1535 | Ga0496104_0020850 | |||
| 1536 | Ga0496104_0635886 | |||
| 1537 | Ga0496106_0020141 | |||
| 1538 | Ga0496106_0134694 | |||
| 1539 | Ga0496107_0452486 | |||
| 1540 | Ga0496107_0873698 | |||
| 1541 | Ga0496109_0130274 | |||
| 1542 | Ga0496110_0035381 | |||
| 1543 | Ga0496110_0144587 | |||
| 1544 | Ga0496111_0029616 | |||
| 1545 | Ga0496111_0087357 | |||
| 1546 | Ga0496113_0073271 | |||
| 1547 | Ga0496114_0703367 | |||
| 1548 | Ga0496116_0035499 | |||
| 1549 | Ga0496118_0010125 | |||
| 1550 | Ga0496118_0030038 | |||
| 1551 | Ga0496121_0042948 | |||
| 1552 | Ga0496121_0190509 | |||
| 1553 | Ga0496121_0197772 | |||
| 1554 | Ga0496121_0506526 | |||
| 1555 | Ga0496122_0003984 | |||
| 1556 | Ga0496122_0064753 | |||
| 1557 | Ga0496123_0000235 | |||
| 1558 | Ga0496123_0061997 | |||
| 1559 | Ga0496123_0136762 | |||
| 1560 | Ga0496124_0451518 | |||
| 1561 | Ga0496125_0020173 | |||
| 1562 | Ga0496125_0026915 | |||
| 1563 | Ga0496125_0091422 | |||
| 1564 | Ga0496125_0158785 | |||
| 1565 | Ga0496125_0325321 | |||
| 1566 | Ga0496126_0805841 | |||
| 1567 | Ga0495682_0073699 | |||
| 1568 | Ga0501034_0548052 | |||
| 1569 | Ga0501037_0010551 | |||
| 1570 | Ga0501046_0085905 | |||
| 1571 | Ga0501225_0013794 | |||
| 1572 | Ga0501262_000153 | |||
| 1573 | Ga0501266_001605 | |||
| 1574 | Ga0501269_063195 | |||
| 1575 | Ga0501281_15192 | |||
| 1576 | nmdc:mga03683_10250_c1 | |||
| 1577 | nmdc:mga03683_209216_c1 | |||
| 1578 | nmdc:mga03683_224231_c1 | |||
| 1579 | nmdc:mga03683_36119_c1 | |||
| 1580 | nmdc:mga03683_406129_c1 | |||
| 1581 | nmdc:mga03683_439257_c1 | |||
| 1582 | nmdc:mga03n38_10203_c1 | |||
| 1583 | nmdc:mga03n38_25159_c1 | |||
| 1584 | nmdc:mga03n38_25218_c1 | |||
| 1585 | nmdc:mga03n38_369277_c1 | |||
| 1586 | nmdc:mga00v17_21047_c2 | |||
| 1587 | nmdc:mga00v17_359062_c1 | |||
| 1588 | nmdc:mga00v17_53639_c1 | |||
| 1589 | nmdc:mga0yw44_28385_c1 | |||
| 1590 | nmdc:mga0yw44_58591_c1 | |||
| 1591 | nmdc:mga0k408_127897_c1 | |||
| 1592 | nmdc:mga0k408_132105_c1 | |||
| 1593 | nmdc:mga0k408_197323_c1 | |||
| 1594 | nmdc:mga0k408_265279_c1 | |||
| 1595 | nmdc:mga0k408_289323_c1 | |||
| 1596 | nmdc:mga0k408_36012_c1 | |||
| 1597 | nmdc:mga0k408_403132_c1 | |||
| 1598 | nmdc:mga0k408_41811_c1 | |||
| 1599 | nmdc:mga0k408_4603_c1 | |||
| 1600 | nmdc:mga0k408_513833_c1 | |||
| 1601 | nmdc:mga0k408_52519_c1 | |||
| 1602 | nmdc:mga06z11_277517_c1 | |||
| 1603 | nmdc:mga06z11_738697_c1 | |||
| 1604 | nmdc:mga04h51_139923_c1 | |||
| 1605 | nmdc:mga07m45_100184_c1 | |||
| 1606 | nmdc:mga07m45_174148_c1 | |||
| 1607 | nmdc:mga07m45_1973_c1 | |||
| 1608 | nmdc:mga07m45_21686_c1 | |||
| 1609 | nmdc:mga07m45_224527_c1 | |||
| 1610 | nmdc:mga07m45_345113_c1 | |||
| 1611 | nmdc:mga07m45_8907_c1 | |||
| 1612 | nmdc:mga09592_239398_c1 | |||
| 1613 | nmdc:mga09592_5962_c1 | |||
| 1614 | nmdc:mga0qj67_17296_c1 | |||
| 1615 | Ga0500610_0006176 | |||
| 1616 | Ga0500610_0013178 | |||
| 1617 | Ga0500578_0039951 | |||
| 1618 | Ga0500643_055693 | |||
| 1619 | Ga0500644_0002098 | |||
| 1620 | Ga0500651_0027085 | |||
| 1621 | Ga0500651_0299293 | |||
| 1622 | Ga0500641_0061010 | |||
| 1623 | Ga0500641_0120501 | |||
| 1624 | Ga0500650_0093654 | |||
| 1625 | Ga0500572_020849 | |||
| 1626 | Ga0500592_012805 | |||
| 1627 | Ga0500593_003907 | |||
| 1628 | Ga0500593_008376 | |||
| 1629 | Ga0500594_0003689 | |||
| 1630 | Ga0500607_004990 | |||
| 1631 | Ga0500607_216595 | |||
| 1632 | Ga0500608_004926 | |||
| 1633 | Ga0500608_043313 | |||
| 1634 | Ga0500618_020979 | |||
| 1635 | Ga0500655_000523 | |||
| 1636 | Ga0500658_0001924 | |||
| 1637 | Ga0500559_0000011 | |||
| 1638 | Ga0500559_0005307 | |||
| 1639 | Ga0500568_0006491 | |||
| 1640 | Ga0500568_0306157 | |||
| 1641 | Ga0500616_0143992 | |||
| 1642 | Ga0500616_0164096 | |||
| 1643 | Ga0500616_0309782 | |||
| 1644 | Ga0500622_0055210 | |||
| 1645 | Ga0500622_0155426 | |||
| 1646 | Ga0500624_026386 | |||
| 1647 | Ga0500627_0006722 | |||
| 1648 | Ga0500627_0225857 | |||
| 1649 | Ga0500634_0006145 | |||
| 1650 | Ga0500638_003903 | |||
| 1651 | Ga0500625_070542 | |||
| 1652 | Ga0500645_002856 | |||
| 1653 | Ga0500645_015872 | |||
| 1654 | Ga0500645_017528 | |||
| 1655 | Ga0500645_163810 | |||
| 1656 | Ga0466962_0006446 | |||
| 1657 | Ga0466962_0010759 | |||
| 1658 | 2511244316 | |||
| 1659 | 2513227977 | |||
| 1660 | 2548500009 | |||
| 1661 | 2597028588 | |||
| 1662 | 2599445274 | |||
| 1663 | 2599624056 | |||
| 1664 | 2599672067 | |||
| 1665 | 2599681851 | |||
| 1666 | 2599693864 | |||
| 1667 | 2643868245 | |||
| 1668 | 2643993761 | |||
| 1669 | 2644293849 | |||
| 1670 | 2644304803 | |||
| 1671 | 2644339985 | |||
| 1672 | 2644397969 | |||
| 1673 | 2644644672 | |||
| 1674 | 2738719919 | |||
| 1675 | 2738879669 | |||
| 1676 | 2739279118 | |||
| 1677 | 2831269543 | |||
| 1678 | 2838060034 | |||
| 1679 | 2842681905 | |||
| 1680 | 2842734700 | |||
| 1681 | 2842748535 | |||
| 1682 | 2858693128 | |||
| 1683 | 2885195586 | |||
| 1684 | 2885199215 | |||
| 1685 | 2885212866 | |||
| 1686 | 2900580230 | |||
| 1687 | 2904450086 | |||
| 1688 | 2904457091 | |||
| 1689 | 2904543933 | |||
| 1690 | 2919464981 | |||
| 1691 | 2919704621 | |||
| 1692 | 2928076738 | |||
| 1693 | 2928090512 | |||
| 1694 | 2928117338 | |||
| 1695 | 2929162508 | |||
| 1696 | 2929525376 | |||
| 1697 | 2945913120 | |||
| 1698 | 2945948746 | |||
| 1699 | 2945972866 | |||
| 1700 | 2945984610 | |||
| 1701 | 2954772886 | |||
| 1702 | 2990713395 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nvj-assembly1.cif.gz_A | deletion mutant (delta 141) of molybdopterin synthase | 0.9668 | 2 | 124 |
| 1nvj-assembly3.cif.gz_E | deletion mutant (delta 141) of molybdopterin synthase | 0.9588 | 2 | 123 |
| 1nvj-assembly1.cif.gz_B | deletion mutant (delta 141) of molybdopterin synthase | 0.9549 | 2 | 124 |
| 1nvj-assembly2.cif.gz_C | deletion mutant (delta 141) of molybdopterin synthase | 0.9506 | 2 | 124 |
| 4ap8-assembly1.cif.gz_A | crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) | 0.9437 | 3 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nvjC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9506 | 2 | 124 | 3.90.1170.40 |
| 5mpoC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9385 | 3 | 126 | 3.90.1170.40 |
| 1fmaE00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9364 | 2 | 148 | 3.90.1170.40 |
| af_Q6AY59_40_191_3.90.1170.40 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9248 | 3 | 136 | 3.90.1170.40 |
| 1fmaE00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9112 | 2 | 148 | 3.90.1170.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832E1U9-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9799 | 22 | 135 |
GO:0006777
|
| AF-A0A7J4PD46-F1-model_v4 | Molybdenum cofactor biosynthesis protein MoaE | 0.9795 | 25 | 117 |
GO:0006777
|
| AF-A0A2D5PE05-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9758 | 3 | 148 |
GO:0006777
GO:0030366 |
| AF-A0A2S6SUQ3-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9702 | 2 | 139 |
GO:0006777
GO:0030366 |
| AF-A0A1C6QU64-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9694 | 3 | 155 |
GO:0006777
GO:0030366 |