F483479
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 851 | 384 | 834 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0196001|Ga0501032_0196001_298_906 |
| Length | 195 |
| Sequence | MMGQKLSGNRTIKTMIIFTTQTTRPLKRKNMQMKKLFLLAGFAAMALLSQAQKYAIIDTKYILDKLPEYKMAQKQLDDIAAGWQKDLDRMYKDYDAEQVMLSEDLRKKREDQLFQKEKNLRDLQRQRFGFEGDLFKTRQNLIKPIQDKVYNAVQKIAVQRGYDFILDKSEGITIIFADPKLDKSEDILRELGVKN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 4 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 5 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 6 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 7 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 8 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 9 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 10 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 11 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 12 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 13 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 14 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 15 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 16 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 17 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 18 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 22 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 23 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 26 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 27 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 28 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 29 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 30 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 39 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 212 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 225 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 226 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 242 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 243 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 244 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 246 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 247 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 248 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 249 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 250 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 251 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 252 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 253 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 254 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 255 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 256 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 257 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 260 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 261 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 262 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 269 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 270 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 309 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 310 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 311 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 312 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 328 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 329 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 330 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 332 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 335 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 337 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 338 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 342 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 343 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 347 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 348 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 354 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 356 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 357 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 358 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 359 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 360 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 361 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 364 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 365 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 366 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 367 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 368 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 370 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 371 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 372 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 373 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 374 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 375 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 376 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 377 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 379 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 380 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 381 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 382 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 384 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.65 |
| Metatranscriptomes | 0.24 |
| Isolates | 2.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.4 |
| Nodule | 0 |
| Rhizoplane | 1.18 |
| Rhizosphere | 84.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1104021 | 2162886007 | Bacteria | 1312 |
| 2 | JGI24740J21852_10001262 | 3300001979 | Bacteria | 11463 |
| 3 | JGI24739J22299_10024864 | 3300001989 | Bacteria | 2109 |
| 4 | JGI24744J21845_10006042 | 3300002077 | Bacteria | 2510 |
| 5 | JGI25154J39366_1000003 | 3300002738 | Bacteria | 397627 |
| 6 | JGI25157J39369_1008050 | 3300002741 | Bacteria | 1487 |
| 7 | JGI25153J46596_10003159 | 3300003215 | Bacteria | 9290 |
| 8 | JGI25153J46596_10007886 | 3300003215 | Bacteria | 5168 |
| 9 | rootH1_10044617 | 3300003316 | Bacteria | 6195 |
| 10 | rootH2_10076327 | 3300003320 | Bacteria | 11967 |
| 11 | rootH2_10149464 | 3300003320 | Bacteria | 1461 |
| 12 | rootH2_10206676 | 3300003320 | Bacteria | 1541 |
| 13 | rootL2_10170793 | 3300003322 | Bacteria | 1028 |
| 14 | rootH1_10014610 | 3300003316 | Bacteria | 16128 |
| 15 | rootH1_10014610 | 3300003323 | Bacteria | 26841 |
| 16 | rootH1_10014611 | 3300003323 | Bacteria | 2441 |
| 17 | rootH1_10016772 | 3300003323 | Bacteria | 12240 |
| 18 | JGI25160J50197_1001477 | 3300003354 | Bacteria | 11699 |
| 19 | JGI25160J50197_1022441 | 3300003354 | Bacteria | 1850 |
| 20 | Ga0055542_1001719 | 3300003762 | Bacteria | 9455 |
| 21 | Ga0055526_1039510 | 3300003771 | Bacteria | 1201 |
| 22 | Ga0055528_1000060 | 3300003790 | Bacteria | 87471 |
| 23 | Ga0055530_10000378 | 3300003791 | Bacteria | 40399 |
| 24 | Ga0055531_10030616 | 3300003794 | Bacteria | 1802 |
| 25 | Ga0065165_1001923 | 3300005262 | Bacteria | 19827 |
| 26 | Ga0065165_1016362 | 3300005262 | Bacteria | 2781 |
| 27 | Ga0065165_1020820 | 3300005262 | Bacteria | 2296 |
| 28 | Ga0065714_10137470 | 3300005288 | Bacteria | 1197 |
| 29 | Ga0065704_10167542 | 3300005289 | Bacteria | 1312 |
| 30 | Ga0065712_10030184 | 3300005290 | Bacteria | 1316 |
| 31 | Ga0065712_10100308 | 3300005290 | Bacteria | 2066 |
| 32 | Ga0065715_10282515 | 3300005293 | Bacteria | 1083 |
| 33 | Ga0070658_10132184 | 3300005327 | Bacteria | 2080 |
| 34 | Ga0070676_10009154 | 3300005328 | Bacteria | 5358 |
| 35 | Ga0070676_10613325 | 3300005328 | Bacteria | 786 |
| 36 | Ga0070676_11034973 | 3300005328 | Bacteria | 618 |
| 37 | Ga0070683_100002314 | 3300005329 | Bacteria | 15105 |
| 38 | Ga0070683_100085157 | 3300005329 | Bacteria | 2962 |
| 39 | Ga0070683_100454177 | 3300005329 | Bacteria | 1223 |
| 40 | Ga0070683_100861154 | 3300005329 | Bacteria | 869 |
| 41 | Ga0070683_100981511 | 3300005329 | Unclassified | 811 |
| 42 | Ga0070683_101251328 | 3300005329 | Bacteria | 713 |
| 43 | Ga0070690_100024106 | 3300005330 | Bacteria | 3741 |
| 44 | Ga0070690_100435643 | 3300005330 | Bacteria | 969 |
| 45 | Ga0070670_100261512 | 3300005331 | Bacteria | 1508 |
| 46 | Ga0070670_100308676 | 3300005331 | Bacteria | 1384 |
| 47 | Ga0070670_100586191 | 3300005331 | Bacteria | 997 |
| 48 | Ga0068869_100005175 | 3300005334 | Bacteria | 8185 |
| 49 | Ga0068869_100008029 | 3300005334 | Bacteria | 6778 |
| 50 | Ga0068869_100085491 | 3300005334 | Bacteria | 2362 |
| 51 | Ga0068869_101105172 | 3300005334 | Bacteria | 694 |
| 52 | Ga0070666_10026971 | 3300005335 | Bacteria | 3758 |
| 53 | Ga0070666_10173715 | 3300005335 | Bacteria | 1510 |
| 54 | Ga0070666_10187414 | 3300005335 | Bacteria | 1453 |
| 55 | Ga0070666_10318735 | 3300005335 | Bacteria | 1109 |
| 56 | Ga0070680_100010528 | 3300005336 | Bacteria | 7134 |
| 57 | Ga0070682_100000019 | 3300005337 | Bacteria | 220844 |
| 58 | Ga0070682_100049312 | 3300005337 | Bacteria | 2625 |
| 59 | Ga0070682_100137593 | 3300005337 | Bacteria | 1661 |
| 60 | Ga0070682_100174827 | 3300005337 | Bacteria | 1495 |
| 61 | Ga0068868_100004324 | 3300005338 | Bacteria | 9953 |
| 62 | Ga0068868_100083535 | 3300005338 | Bacteria | 2564 |
| 63 | Ga0068868_100196500 | 3300005338 | Bacteria | 1680 |
| 64 | Ga0068868_100361741 | 3300005338 | Bacteria | 1245 |
| 65 | Ga0070660_100095233 | 3300005339 | Bacteria | 2353 |
| 66 | Ga0070660_100100442 | 3300005339 | Bacteria | 2292 |
| 67 | Ga0070660_100390403 | 3300005339 | Bacteria | 1150 |
| 68 | Ga0070660_100584631 | 3300005339 | Bacteria | 933 |
| 69 | Ga0070660_100942206 | 3300005339 | Bacteria | 729 |
| 70 | Ga0070689_100021006 | 3300005340 | Bacteria | 4853 |
| 71 | Ga0070689_100033467 | 3300005340 | Bacteria | 3917 |
| 72 | Ga0070689_100306998 | 3300005340 | Bacteria | 1322 |
| 73 | Ga0070691_10011739 | 3300005341 | Bacteria | 4007 |
| 74 | Ga0070687_100129328 | 3300005343 | Bacteria | 1456 |
| 75 | Ga0070687_100894375 | 3300005343 | Bacteria | 636 |
| 76 | Ga0070661_100013425 | 3300005344 | Bacteria | 5749 |
| 77 | Ga0070668_100039320 | 3300005347 | Bacteria | 3618 |
| 78 | Ga0070668_100400452 | 3300005347 | Bacteria | 1172 |
| 79 | Ga0070668_100480567 | 3300005347 | Bacteria | 1073 |
| 80 | Ga0070669_100056017 | 3300005353 | Bacteria | 2890 |
| 81 | Ga0070669_100280414 | 3300005353 | Bacteria | 1335 |
| 82 | Ga0070669_100399589 | 3300005353 | Bacteria | 1124 |
| 83 | Ga0070669_100597678 | 3300005353 | Bacteria | 924 |
| 84 | Ga0070669_100781067 | 3300005353 | Bacteria | 811 |
| 85 | Ga0070675_100041303 | 3300005354 | Bacteria | 3767 |
| 86 | Ga0070675_100131302 | 3300005354 | Bacteria | 2135 |
| 87 | Ga0070675_100138245 | 3300005354 | Bacteria | 2080 |
| 88 | Ga0070675_100511190 | 3300005354 | Bacteria | 1083 |
| 89 | Ga0070671_100044015 | 3300005355 | Bacteria | 3709 |
| 90 | Ga0070671_100086837 | 3300005355 | Bacteria | 2618 |
| 91 | Ga0070671_100623499 | 3300005355 | Bacteria | 933 |
| 92 | Ga0070671_100722618 | 3300005355 | Bacteria | 865 |
| 93 | Ga0070673_100033496 | 3300005364 | Bacteria | 3881 |
| 94 | Ga0070673_100049643 | 3300005364 | Bacteria | 3277 |
| 95 | Ga0070673_100170375 | 3300005364 | Unclassified | 1858 |
| 96 | Ga0070673_100176585 | 3300005364 | Bacteria | 1826 |
| 97 | Ga0070673_100758375 | 3300005364 | Bacteria | 894 |
| 98 | Ga0070688_100039108 | 3300005365 | Bacteria | 2901 |
| 99 | Ga0070688_100081027 | 3300005365 | Bacteria | 2101 |
| 100 | Ga0070659_100186571 | 3300005366 | Bacteria | 1703 |
| 101 | Ga0070667_100204460 | 3300005367 | Bacteria | 1753 |
| 102 | Ga0070667_100833897 | 3300005367 | Bacteria | 857 |
| 103 | Ga0070713_100315837 | 3300005436 | Bacteria | 1442 |
| 104 | Ga0070701_11062070 | 3300005438 | Bacteria | 568 |
| 105 | Ga0070705_100922302 | 3300005440 | Bacteria | 704 |
| 106 | Ga0070663_100376714 | 3300005455 | Bacteria | 1155 |
| 107 | Ga0070678_100007858 | 3300005456 | Bacteria | 6346 |
| 108 | Ga0070678_100045789 | 3300005456 | Bacteria | 3132 |
| 109 | Ga0070662_100020419 | 3300005457 | Bacteria | 4510 |
| 110 | Ga0070662_100039935 | 3300005457 | Bacteria | 3340 |
| 111 | Ga0070662_100061481 | 3300005457 | Bacteria | 2742 |
| 112 | Ga0070662_100195335 | 3300005457 | Bacteria | 1602 |
| 113 | Ga0070681_10058113 | 3300005458 | Bacteria | 3848 |
| 114 | Ga0070681_10221963 | 3300005458 | Bacteria | 1805 |
| 115 | Ga0068867_100027314 | 3300005459 | Bacteria | 4100 |
| 116 | Ga0068867_100028644 | 3300005459 | Bacteria | 4011 |
| 117 | Ga0068867_100040234 | 3300005459 | Bacteria | 3410 |
| 118 | Ga0068867_100040241 | 3300005459 | Bacteria | 3410 |
| 119 | Ga0068867_100240266 | 3300005459 | Bacteria | 1469 |
| 120 | Ga0068867_100637137 | 3300005459 | Bacteria | 934 |
| 121 | Ga0068867_100740619 | 3300005459 | Unclassified | 871 |
| 122 | Ga0070685_10050637 | 3300005466 | Bacteria | 2400 |
| 123 | Ga0070679_100000836 | 3300005530 | Bacteria | 26787 |
| 124 | Ga0070679_100216934 | 3300005530 | Bacteria | 1875 |
| 125 | Ga0070684_100000823 | 3300005535 | Bacteria | 21717 |
| 126 | Ga0070684_100002886 | 3300005535 | Bacteria | 12774 |
| 127 | Ga0070684_100738471 | 3300005535 | Bacteria | 919 |
| 128 | Ga0070684_100754353 | 3300005535 | Bacteria | 909 |
| 129 | Ga0070684_101133974 | 3300005535 | Bacteria | 735 |
| 130 | Ga0068853_100007046 | 3300005539 | Bacteria | 8988 |
| 131 | Ga0068853_100009327 | 3300005539 | Bacteria | 7911 |
| 132 | Ga0068853_100176747 | 3300005539 | Bacteria | 1934 |
| 133 | Ga0068853_100208699 | 3300005539 | Bacteria | 1780 |
| 134 | Ga0068853_100519382 | 3300005539 | Bacteria | 1126 |
| 135 | Ga0068853_100528449 | 3300005539 | Bacteria | 1116 |
| 136 | Ga0068853_100692170 | 3300005539 | Bacteria | 972 |
| 137 | Ga0068853_100917069 | 3300005539 | Bacteria | 842 |
| 138 | Ga0070672_100003727 | 3300005543 | Bacteria | 9916 |
| 139 | Ga0070672_100304310 | 3300005543 | Bacteria | 1352 |
| 140 | Ga0070672_100335842 | 3300005543 | Bacteria | 1286 |
| 141 | Ga0070686_100169323 | 3300005544 | Bacteria | 1544 |
| 142 | Ga0070686_100192730 | 3300005544 | Bacteria | 1456 |
| 143 | Ga0070686_100242940 | 3300005544 | Bacteria | 1312 |
| 144 | Ga0070693_100224773 | 3300005547 | Bacteria | 1232 |
| 145 | Ga0070693_100434145 | 3300005547 | Bacteria | 918 |
| 146 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 147 | Ga0070665_100062566 | 3300005548 | Bacteria | 3732 |
| 148 | Ga0070665_100076597 | 3300005548 | Bacteria | 3351 |
| 149 | Ga0070665_100448306 | 3300005548 | Bacteria | 1300 |
| 150 | Ga0070665_100536497 | 3300005548 | Bacteria | 1182 |
| 151 | Ga0068855_100006600 | 3300005563 | Bacteria | 14106 |
| 152 | Ga0068855_100014225 | 3300005563 | Bacteria | 9586 |
| 153 | Ga0068855_100024083 | 3300005563 | Bacteria | 7287 |
| 154 | Ga0068855_100274060 | 3300005563 | Bacteria | 1875 |
| 155 | Ga0070664_100009426 | 3300005564 | Bacteria | 7914 |
| 156 | Ga0070664_100019327 | 3300005564 | Bacteria | 5605 |
| 157 | Ga0070664_100026791 | 3300005564 | Bacteria | 4786 |
| 158 | Ga0070664_100094916 | 3300005564 | Bacteria | 2587 |
| 159 | Ga0070664_100368151 | 3300005564 | Bacteria | 1310 |
| 160 | Ga0070664_100520085 | 3300005564 | Bacteria | 1098 |
| 161 | Ga0070664_100839215 | 3300005564 | Bacteria | 860 |
| 162 | Ga0070664_101318769 | 3300005564 | Bacteria | 682 |
| 163 | Ga0068857_100004302 | 3300005577 | Bacteria | 12015 |
| 164 | Ga0068857_100005247 | 3300005577 | Bacteria | 11033 |
| 165 | Ga0068857_100024711 | 3300005577 | Bacteria | 5292 |
| 166 | Ga0068857_100129622 | 3300005577 | Bacteria | 2274 |
| 167 | Ga0068857_100193365 | 3300005577 | Bacteria | 1853 |
| 168 | Ga0068857_100268357 | 3300005577 | Bacteria | 1568 |
| 169 | Ga0068857_100372094 | 3300005577 | Bacteria | 1325 |
| 170 | Ga0068857_100418476 | 3300005577 | Bacteria | 1249 |
| 171 | Ga0068854_100124556 | 3300005578 | Bacteria | 1961 |
| 172 | Ga0068854_100150217 | 3300005578 | Bacteria | 1795 |
| 173 | Ga0068854_100179882 | 3300005578 | Bacteria | 1651 |
| 174 | Ga0068854_100390486 | 3300005578 | Bacteria | 1149 |
| 175 | Ga0068854_100444154 | 3300005578 | Bacteria | 1082 |
| 176 | Ga0068854_100449009 | 3300005578 | Bacteria | 1076 |
| 177 | Ga0068856_100055686 | 3300005614 | Bacteria | 3903 |
| 178 | Ga0068856_100204401 | 3300005614 | Bacteria | 1990 |
| 179 | Ga0068856_101136185 | 3300005614 | Bacteria | 798 |
| 180 | Ga0070702_100466194 | 3300005615 | Bacteria | 920 |
| 181 | Ga0068852_100000744 | 3300005616 | Bacteria | 21378 |
| 182 | Ga0068852_100000989 | 3300005616 | Bacteria | 18732 |
| 183 | Ga0068852_100045245 | 3300005616 | Bacteria | 3743 |
| 184 | Ga0068852_100062865 | 3300005616 | Bacteria | 3230 |
| 185 | Ga0068852_100228781 | 3300005616 | Bacteria | 1772 |
| 186 | Ga0068852_100407428 | 3300005616 | Bacteria | 1339 |
| 187 | Ga0068852_100854470 | 3300005616 | Bacteria | 926 |
| 188 | Ga0068852_100916598 | 3300005616 | Bacteria | 894 |
| 189 | Ga0068852_101566852 | 3300005616 | Bacteria | 681 |
| 190 | Ga0068852_102019073 | 3300005616 | Bacteria | 599 |
| 191 | Ga0068859_100001537 | 3300005617 | Bacteria | 23548 |
| 192 | Ga0068859_100032421 | 3300005617 | Bacteria | 5249 |
| 193 | Ga0068859_100071945 | 3300005617 | Bacteria | 3493 |
| 194 | Ga0068859_100072317 | 3300005617 | Bacteria | 3485 |
| 195 | Ga0068859_100094528 | 3300005617 | Bacteria | 3041 |
| 196 | Ga0068864_100046635 | 3300005618 | Bacteria | 3719 |
| 197 | Ga0068864_100062524 | 3300005618 | Bacteria | 3225 |
| 198 | Ga0068864_100073120 | 3300005618 | Bacteria | 2989 |
| 199 | Ga0068864_100102035 | 3300005618 | Bacteria | 2545 |
| 200 | Ga0068864_100166759 | 3300005618 | Bacteria | 2006 |
| 201 | Ga0068864_100206523 | 3300005618 | Bacteria | 1807 |
| 202 | Ga0068864_100701604 | 3300005618 | Bacteria | 989 |
| 203 | Ga0068864_101256703 | 3300005618 | Bacteria | 740 |
| 204 | Ga0068866_10027049 | 3300005718 | Bacteria | 2716 |
| 205 | Ga0068861_100300047 | 3300005719 | Bacteria | 1391 |
| 206 | Ga0068861_100579650 | 3300005719 | Bacteria | 1027 |
| 207 | Ga0068851_10091568 | 3300005834 | Bacteria | 1601 |
| 208 | Ga0068851_10566615 | 3300005834 | Bacteria | 688 |
| 209 | Ga0068863_100089444 | 3300005841 | Bacteria | 2919 |
| 210 | Ga0068863_100111170 | 3300005841 | Bacteria | 2610 |
| 211 | Ga0068863_100327519 | 3300005841 | Bacteria | 1489 |
| 212 | Ga0068863_100469196 | 3300005841 | Bacteria | 1237 |
| 213 | Ga0068858_100033772 | 3300005842 | Bacteria | 4744 |
| 214 | Ga0068858_100100576 | 3300005842 | Bacteria | 2696 |
| 215 | Ga0068858_100235320 | 3300005842 | Bacteria | 1737 |
| 216 | Ga0068858_101123700 | 3300005842 | Bacteria | 772 |
| 217 | Ga0068860_100000061 | 3300005843 | Bacteria | 192548 |
| 218 | Ga0068860_100001341 | 3300005843 | Bacteria | 26789 |
| 219 | Ga0068860_100076623 | 3300005843 | Bacteria | 3180 |
| 220 | Ga0068860_100661574 | 3300005843 | Bacteria | 1053 |
| 221 | Ga0068860_101823472 | 3300005843 | Bacteria | 630 |
| 222 | Ga0068862_100005164 | 3300005844 | Bacteria | 10980 |
| 223 | Ga0068862_100180767 | 3300005844 | Bacteria | 1893 |
| 224 | Ga0081540_1002949 | 3300005983 | Bacteria | 13669 |
| 225 | Ga0070715_10206605 | 3300006163 | Bacteria | 1001 |
| 226 | Ga0075366_10018940 | 3300006195 | Bacteria | 3978 |
| 227 | Ga0075366_10064494 | 3300006195 | Bacteria | 2178 |
| 228 | Ga0075366_10239789 | 3300006195 | Bacteria | 1105 |
| 229 | Ga0097621_100030125 | 3300006237 | Bacteria | 4293 |
| 230 | Ga0097621_100049304 | 3300006237 | Bacteria | 3420 |
| 231 | Ga0097621_100114616 | 3300006237 | Bacteria | 2281 |
| 232 | Ga0097621_100257538 | 3300006237 | Bacteria | 1530 |
| 233 | Ga0097621_100760265 | 3300006237 | Bacteria | 896 |
| 234 | Ga0097621_100855367 | 3300006237 | Bacteria | 845 |
| 235 | Ga0075370_10175079 | 3300006353 | Bacteria | 1262 |
| 236 | Ga0068871_100004499 | 3300006358 | Bacteria | 9709 |
| 237 | Ga0068871_100045959 | 3300006358 | Bacteria | 3516 |
| 238 | Ga0068871_100114713 | 3300006358 | Bacteria | 2270 |
| 239 | Ga0068871_100290087 | 3300006358 | Bacteria | 1433 |
| 240 | Ga0068871_100428207 | 3300006358 | Bacteria | 1183 |
| 241 | Ga0068871_100500703 | 3300006358 | Bacteria | 1095 |
| 242 | Ga0068871_100563289 | 3300006358 | Bacteria | 1033 |
| 243 | Ga0075434_100046233 | 3300006871 | Bacteria | 4320 |
| 244 | Ga0075434_101518647 | 3300006871 | Bacteria | 679 |
| 245 | Ga0068865_100160502 | 3300006881 | Bacteria | 1714 |
| 246 | Ga0068865_100575481 | 3300006881 | Bacteria | 949 |
| 247 | Ga0097620_100001537 | 3300006931 | Bacteria | 23548 |
| 248 | Ga0097620_100032421 | 3300006931 | Bacteria | 5249 |
| 249 | Ga0097620_100071946 | 3300006931 | Bacteria | 3493 |
| 250 | Ga0097620_100072323 | 3300006931 | Bacteria | 3485 |
| 251 | Ga0097620_100094524 | 3300006931 | Bacteria | 3041 |
| 252 | Ga0097620_100303654 | 3300006931 | Bacteria | 1689 |
| 253 | Ga0105251_10401389 | 3300009011 | Bacteria | 630 |
| 254 | Ga0105240_10000800 | 3300009093 | Bacteria | 56989 |
| 255 | Ga0105240_10012537 | 3300009093 | Bacteria | 11694 |
| 256 | Ga0105240_10026787 | 3300009093 | Bacteria | 7561 |
| 257 | Ga0105240_10073546 | 3300009093 | Bacteria | 4220 |
| 258 | Ga0105240_10075380 | 3300009093 | Bacteria | 4161 |
| 259 | Ga0105240_10194738 | 3300009093 | Bacteria | 2381 |
| 260 | Ga0105240_10218061 | 3300009093 | Bacteria | 2224 |
| 261 | Ga0111539_10011561 | 3300009094 | Bacteria | 11079 |
| 262 | Ga0111539_10485090 | 3300009094 | Bacteria | 1440 |
| 263 | Ga0105247_10848743 | 3300009101 | Bacteria | 701 |
| 264 | Ga0114129_10353492 | 3300009147 | Bacteria | 1946 |
| 265 | Ga0105241_10001809 | 3300009174 | Bacteria | 16223 |
| 266 | Ga0105241_10042701 | 3300009174 | Bacteria | 3432 |
| 267 | Ga0105241_10127807 | 3300009174 | Bacteria | 2054 |
| 268 | Ga0105241_10131163 | 3300009174 | Bacteria | 2029 |
| 269 | Ga0105241_10195624 | 3300009174 | Bacteria | 1686 |
| 270 | Ga0105241_10267849 | 3300009174 | Bacteria | 1454 |
| 271 | Ga0105241_10470012 | 3300009174 | Bacteria | 1116 |
| 272 | Ga0105241_10490942 | 3300009174 | Bacteria | 1093 |
| 273 | Ga0105241_10735234 | 3300009174 | Bacteria | 903 |
| 274 | Ga0105242_10430846 | 3300009176 | Bacteria | 1238 |
| 275 | Ga0105242_10700684 | 3300009176 | Bacteria | 991 |
| 276 | Ga0105242_10939238 | 3300009176 | Bacteria | 868 |
| 277 | Ga0105242_11147415 | 3300009176 | Bacteria | 794 |
| 278 | Ga0105248_10173092 | 3300009177 | Bacteria | 2433 |
| 279 | Ga0105248_10978259 | 3300009177 | Bacteria | 956 |
| 280 | Ga0105237_10000453 | 3300009545 | Bacteria | 58200 |
| 281 | Ga0105237_10003705 | 3300009545 | Bacteria | 18019 |
| 282 | Ga0105237_10013196 | 3300009545 | Bacteria | 8669 |
| 283 | Ga0105237_10023637 | 3300009545 | Bacteria | 6295 |
| 284 | Ga0105237_10027884 | 3300009545 | Bacteria | 5755 |
| 285 | Ga0105237_10336811 | 3300009545 | Bacteria | 1513 |
| 286 | Ga0105237_11214807 | 3300009545 | Bacteria | 760 |
| 287 | Ga0105238_10000592 | 3300009551 | Bacteria | 38095 |
| 288 | Ga0105238_10041982 | 3300009551 | Bacteria | 4632 |
| 289 | Ga0105238_10194684 | 3300009551 | Bacteria | 2003 |
| 290 | Ga0105249_10010748 | 3300009553 | Bacteria | 8043 |
| 291 | Ga0105249_10065163 | 3300009553 | Bacteria | 3351 |
| 292 | Ga0105249_10139717 | 3300009553 | Unclassified | 2321 |
| 293 | Ga0105249_10223534 | 3300009553 | Bacteria | 1854 |
| 294 | Ga0105249_10361403 | 3300009553 | Bacteria | 1473 |
| 295 | Ga0105249_10470530 | 3300009553 | Bacteria | 1298 |
| 296 | Ga0105239_10000019 | 3300010375 | Bacteria | 273836 |
| 297 | Ga0105239_10009226 | 3300010375 | Bacteria | 11159 |
| 298 | Ga0105239_10012695 | 3300010375 | Bacteria | 9373 |
| 299 | Ga0105239_10046242 | 3300010375 | Bacteria | 4769 |
| 300 | Ga0105239_10061440 | 3300010375 | Bacteria | 4123 |
| 301 | Ga0105239_10135680 | 3300010375 | Bacteria | 2739 |
| 302 | Ga0105239_10323457 | 3300010375 | Bacteria | 1739 |
| 303 | Ga0105239_11084666 | 3300010375 | Bacteria | 921 |
| 304 | Ga0105246_10158024 | 3300011119 | Bacteria | 1724 |
| 305 | Ga0105246_10234822 | 3300011119 | Bacteria | 1446 |
| 306 | Ga0105246_10391604 | 3300011119 | Bacteria | 1151 |
| 307 | Ga0105246_10781393 | 3300011119 | Bacteria | 845 |
| 308 | Ga0157373_10040922 | 3300013100 | Bacteria | 3315 |
| 309 | Ga0157373_10072818 | 3300013100 | Bacteria | 2425 |
| 310 | Ga0157373_10347797 | 3300013100 | Bacteria | 1057 |
| 311 | Ga0157371_10006990 | 3300013102 | Bacteria | 9185 |
| 312 | Ga0157371_10083130 | 3300013102 | Bacteria | 2267 |
| 313 | Ga0157371_10491596 | 3300013102 | Bacteria | 905 |
| 314 | Ga0157371_10806392 | 3300013102 | Bacteria | 708 |
| 315 | Ga0157370_10005329 | 3300013104 | Bacteria | 14440 |
| 316 | Ga0157370_10068911 | 3300013104 | Bacteria | 3342 |
| 317 | Ga0157370_10115104 | 3300013104 | Bacteria | 2512 |
| 318 | Ga0157370_10374315 | 3300013104 | Bacteria | 1312 |
| 319 | Ga0157370_10413071 | 3300013104 | Bacteria | 1242 |
| 320 | Ga0157369_10027331 | 3300013105 | Bacteria | 6326 |
| 321 | Ga0157369_10095175 | 3300013105 | Bacteria | 3178 |
| 322 | Ga0157369_10172833 | 3300013105 | Bacteria | 2276 |
| 323 | Ga0157369_10861572 | 3300013105 | Bacteria | 930 |
| 324 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 325 | Ga0157374_10003407 | 3300013296 | Bacteria | 13350 |
| 326 | Ga0157374_10041765 | 3300013296 | Bacteria | 4228 |
| 327 | Ga0157374_10094013 | 3300013296 | Bacteria | 2864 |
| 328 | Ga0157374_10596660 | 3300013296 | Bacteria | 1114 |
| 329 | Ga0157374_10893854 | 3300013296 | Bacteria | 906 |
| 330 | Ga0157378_10003727 | 3300013297 | Bacteria | 13508 |
| 331 | Ga0157378_10006316 | 3300013297 | Bacteria | 10381 |
| 332 | Ga0157378_10067129 | 3300013297 | Bacteria | 3214 |
| 333 | Ga0157378_10309789 | 3300013297 | Bacteria | 1531 |
| 334 | Ga0157378_10746527 | 3300013297 | Bacteria | 1001 |
| 335 | Ga0157378_11098334 | 3300013297 | Bacteria | 832 |
| 336 | Ga0163162_10010130 | 3300013306 | Bacteria | 9161 |
| 337 | Ga0163162_10161533 | 3300013306 | Bacteria | 2362 |
| 338 | Ga0163162_10544113 | 3300013306 | Bacteria | 1290 |
| 339 | Ga0163162_10863198 | 3300013306 | Bacteria | 1020 |
| 340 | Ga0163162_10931612 | 3300013306 | Unclassified | 980 |
| 341 | Ga0163162_11698972 | 3300013306 | Bacteria | 721 |
| 342 | Ga0157372_10002332 | 3300013307 | Bacteria | 20561 |
| 343 | Ga0157372_10007698 | 3300013307 | Bacteria | 11455 |
| 344 | Ga0157372_10023290 | 3300013307 | Bacteria | 6712 |
| 345 | Ga0157372_10032041 | 3300013307 | Bacteria | 5760 |
| 346 | Ga0157372_10058652 | 3300013307 | Bacteria | 4304 |
| 347 | Ga0157372_10149086 | 3300013307 | Bacteria | 2698 |
| 348 | Ga0157372_10154609 | 3300013307 | Bacteria | 2649 |
| 349 | Ga0157372_10157431 | 3300013307 | Bacteria | 2624 |
| 350 | Ga0157372_10188258 | 3300013307 | Bacteria | 2390 |
| 351 | Ga0157372_10190800 | 3300013307 | Bacteria | 2374 |
| 352 | Ga0157372_10226830 | 3300013307 | Bacteria | 2166 |
| 353 | Ga0157372_10378590 | 3300013307 | Bacteria | 1649 |
| 354 | Ga0157372_10729009 | 3300013307 | Bacteria | 1153 |
| 355 | Ga0157372_10936892 | 3300013307 | Bacteria | 1004 |
| 356 | Ga0157372_11135030 | 3300013307 | Bacteria | 904 |
| 357 | Ga0157372_11243537 | 3300013307 | Bacteria | 860 |
| 358 | Ga0157375_10034814 | 3300013308 | Bacteria | 4800 |
| 359 | Ga0157375_10160091 | 3300013308 | Bacteria | 2392 |
| 360 | Ga0157375_10378034 | 3300013308 | Bacteria | 1583 |
| 361 | Ga0157375_10387368 | 3300013308 | Bacteria | 1564 |
| 362 | Ga0157375_11084865 | 3300013308 | Bacteria | 937 |
| 363 | Ga0157375_11127115 | 3300013308 | Bacteria | 919 |
| 364 | Ga0163163_10001351 | 3300014325 | Bacteria | 20695 |
| 365 | Ga0163163_10047872 | 3300014325 | Bacteria | 4203 |
| 366 | Ga0163163_10102798 | 3300014325 | Bacteria | 2882 |
| 367 | Ga0163163_10242874 | 3300014325 | Bacteria | 1851 |
| 368 | Ga0163163_10258236 | 3300014325 | Bacteria | 1793 |
| 369 | Ga0163163_10303744 | 3300014325 | Bacteria | 1648 |
| 370 | Ga0163163_10850863 | 3300014325 | Bacteria | 975 |
| 371 | Ga0157380_10012066 | 3300014326 | Bacteria | 6255 |
| 372 | Ga0157380_10027166 | 3300014326 | Bacteria | 4351 |
| 373 | Ga0157380_10095826 | 3300014326 | Bacteria | 2459 |
| 374 | Ga0157380_10160068 | 3300014326 | Bacteria | 1956 |
| 375 | Ga0157380_10407296 | 3300014326 | Bacteria | 1292 |
| 376 | Ga0157380_10526802 | 3300014326 | Unclassified | 1154 |
| 377 | Ga0157380_10865854 | 3300014326 | Bacteria | 927 |
| 378 | Ga0157377_10012474 | 3300014745 | Bacteria | 4275 |
| 379 | Ga0157377_10215119 | 3300014745 | Bacteria | 1227 |
| 380 | Ga0157377_10633331 | 3300014745 | Bacteria | 767 |
| 381 | Ga0157379_10081736 | 3300014968 | Bacteria | 2894 |
| 382 | Ga0157379_10107120 | 3300014968 | Bacteria | 2509 |
| 383 | Ga0157379_10117040 | 3300014968 | Bacteria | 2397 |
| 384 | Ga0157379_10268713 | 3300014968 | Bacteria | 1550 |
| 385 | Ga0157379_10451648 | 3300014968 | Bacteria | 1187 |
| 386 | Ga0157376_10011577 | 3300014969 | Bacteria | 6510 |
| 387 | Ga0157376_10013360 | 3300014969 | Bacteria | 6124 |
| 388 | Ga0157376_10038551 | 3300014969 | Bacteria | 3889 |
| 389 | Ga0157376_10208176 | 3300014969 | Bacteria | 1804 |
| 390 | Ga0157376_10306843 | 3300014969 | Bacteria | 1504 |
| 391 | Ga0182005_1000069 | 3300015265 | Bacteria | 85864 |
| 392 | Ga0182005_1093902 | 3300015265 | Unclassified | 836 |
| 393 | Ga0163161_10060640 | 3300017792 | Bacteria | 2753 |
| 394 | Ga0163161_10071098 | 3300017792 | Bacteria | 2545 |
| 395 | Ga0213876_10006978 | 3300021384 | Bacteria | 6156 |
| 396 | Ga0209436_100329 | 3300025208 | Bacteria | 21518 |
| 397 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 398 | Ga0209258_112036 | 3300025242 | Bacteria | 1073 |
| 399 | Ga0207425_1024802 | 3300025245 | Bacteria | 1242 |
| 400 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 401 | Ga0209646_1000921 | 3300025246 | Bacteria | 9416 |
| 402 | Ga0209026_1000192 | 3300025250 | Bacteria | 88221 |
| 403 | Ga0209148_1000186 | 3300025254 | Bacteria | 117677 |
| 404 | Ga0209129_1020980 | 3300025258 | Bacteria | 1205 |
| 405 | Ga0209673_1000258 | 3300025273 | Bacteria | 100207 |
| 406 | Ga0209675_1029097 | 3300025291 | Bacteria | 1334 |
| 407 | Ga0209564_1006138 | 3300025295 | Bacteria | 6588 |
| 408 | Ga0209758_1009737 | 3300025297 | Bacteria | 5903 |
| 409 | Ga0209758_1019239 | 3300025297 | Bacteria | 3302 |
| 410 | Ga0209050_1001018 | 3300025298 | Bacteria | 34976 |
| 411 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 412 | Ga0207426_1000594 | 3300025302 | Bacteria | 47795 |
| 413 | Ga0207426_1000780 | 3300025302 | Bacteria | 34922 |
| 414 | Ga0209051_1012467 | 3300025303 | Bacteria | 4110 |
| 415 | Ga0209257_1002472 | 3300025304 | Bacteria | 18282 |
| 416 | Ga0207697_10062396 | 3300025315 | Bacteria | 1552 |
| 417 | Ga0207697_10144527 | 3300025315 | Bacteria | 1033 |
| 418 | Ga0207656_10065045 | 3300025321 | Bacteria | 1609 |
| 419 | Ga0207656_10231017 | 3300025321 | Bacteria | 902 |
| 420 | Ga0207642_10144822 | 3300025899 | Bacteria | 1257 |
| 421 | Ga0207688_10320785 | 3300025901 | Bacteria | 950 |
| 422 | Ga0207680_10154004 | 3300025903 | Bacteria | 1535 |
| 423 | Ga0207680_10566749 | 3300025903 | Bacteria | 811 |
| 424 | Ga0207647_10006690 | 3300025904 | Bacteria | 8375 |
| 425 | Ga0207647_10058415 | 3300025904 | Bacteria | 2362 |
| 426 | Ga0207645_10008702 | 3300025907 | Bacteria | 7066 |
| 427 | Ga0207645_10088406 | 3300025907 | Bacteria | 1992 |
| 428 | Ga0207645_10442261 | 3300025907 | Bacteria | 877 |
| 429 | Ga0207705_10028584 | 3300025909 | Bacteria | 3975 |
| 430 | Ga0207705_10937142 | 3300025909 | Unclassified | 670 |
| 431 | Ga0207654_10006717 | 3300025911 | Bacteria | 5784 |
| 432 | Ga0207654_10185651 | 3300025911 | Bacteria | 1359 |
| 433 | Ga0207654_10203308 | 3300025911 | Bacteria | 1305 |
| 434 | Ga0207654_10313121 | 3300025911 | Bacteria | 1071 |
| 435 | Ga0207707_10722912 | 3300025912 | Bacteria | 835 |
| 436 | Ga0207695_10001230 | 3300025913 | Bacteria | 43841 |
| 437 | Ga0207695_10009898 | 3300025913 | Bacteria | 11715 |
| 438 | Ga0207695_10010595 | 3300025913 | Bacteria | 11268 |
| 439 | Ga0207695_10014509 | 3300025913 | Bacteria | 9326 |
| 440 | Ga0207695_10038750 | 3300025913 | Bacteria | 5126 |
| 441 | Ga0207695_10560677 | 3300025913 | Bacteria | 1024 |
| 442 | Ga0207671_10000311 | 3300025914 | Bacteria | 71753 |
| 443 | Ga0207671_10002781 | 3300025914 | Bacteria | 18252 |
| 444 | Ga0207671_10007499 | 3300025914 | Bacteria | 9463 |
| 445 | Ga0207671_10012770 | 3300025914 | Bacteria | 6733 |
| 446 | Ga0207671_10016200 | 3300025914 | Bacteria | 5803 |
| 447 | Ga0207671_10063777 | 3300025914 | Bacteria | 2738 |
| 448 | Ga0207660_10085252 | 3300025917 | Bacteria | 2330 |
| 449 | Ga0207660_10099412 | 3300025917 | Bacteria | 2171 |
| 450 | Ga0207660_10124974 | 3300025917 | Bacteria | 1953 |
| 451 | Ga0207662_10049076 | 3300025918 | Bacteria | 2503 |
| 452 | Ga0207662_10566324 | 3300025918 | Bacteria | 788 |
| 453 | Ga0207657_10013163 | 3300025919 | Bacteria | 8122 |
| 454 | Ga0207657_10043217 | 3300025919 | Bacteria | 3971 |
| 455 | Ga0207657_10102440 | 3300025919 | Bacteria | 2374 |
| 456 | Ga0207657_10142429 | 3300025919 | Bacteria | 1958 |
| 457 | Ga0207657_10526935 | 3300025919 | Bacteria | 924 |
| 458 | Ga0207649_10110237 | 3300025920 | Bacteria | 1837 |
| 459 | Ga0207652_10002760 | 3300025921 | Bacteria | 14747 |
| 460 | Ga0207652_10208279 | 3300025921 | Bacteria | 1760 |
| 461 | Ga0207681_10112954 | 3300025923 | Bacteria | 1980 |
| 462 | Ga0207681_10178699 | 3300025923 | Bacteria | 1615 |
| 463 | Ga0207681_10243250 | 3300025923 | Bacteria | 1401 |
| 464 | Ga0207694_10017189 | 3300025924 | Bacteria | 5466 |
| 465 | Ga0207694_10060474 | 3300025924 | Bacteria | 2948 |
| 466 | Ga0207694_10345824 | 3300025924 | Bacteria | 1230 |
| 467 | Ga0207650_10132445 | 3300025925 | Bacteria | 1952 |
| 468 | Ga0207650_10184171 | 3300025925 | Bacteria | 1666 |
| 469 | Ga0207650_11375286 | 3300025925 | Bacteria | 601 |
| 470 | Ga0207659_10008828 | 3300025926 | Bacteria | 6280 |
| 471 | Ga0207659_10087627 | 3300025926 | Bacteria | 2318 |
| 472 | Ga0207659_10147520 | 3300025926 | Bacteria | 1833 |
| 473 | Ga0207659_10620642 | 3300025926 | Bacteria | 923 |
| 474 | Ga0207659_11329245 | 3300025926 | Unclassified | 617 |
| 475 | Ga0207700_10307286 | 3300025928 | Bacteria | 1371 |
| 476 | Ga0207644_10670155 | 3300025931 | Bacteria | 864 |
| 477 | Ga0207706_10009283 | 3300025933 | Bacteria | 9031 |
| 478 | Ga0207706_10034680 | 3300025933 | Bacteria | 4489 |
| 479 | Ga0207706_10131220 | 3300025933 | Bacteria | 2204 |
| 480 | Ga0207686_10032197 | 3300025934 | Bacteria | 3119 |
| 481 | Ga0207670_10093564 | 3300025936 | Bacteria | 2130 |
| 482 | Ga0207670_10274523 | 3300025936 | Bacteria | 1312 |
| 483 | Ga0207670_11029954 | 3300025936 | Bacteria | 693 |
| 484 | Ga0207669_10272702 | 3300025937 | Bacteria | 1272 |
| 485 | Ga0207669_10413314 | 3300025937 | Bacteria | 1060 |
| 486 | Ga0207704_10680428 | 3300025938 | Bacteria | 850 |
| 487 | Ga0207665_10964611 | 3300025939 | Bacteria | 678 |
| 488 | Ga0207691_10006189 | 3300025940 | Bacteria | 11561 |
| 489 | Ga0207691_10147063 | 3300025940 | Bacteria | 2073 |
| 490 | Ga0207691_10321301 | 3300025940 | Bacteria | 1327 |
| 491 | Ga0207691_10332236 | 3300025940 | Bacteria | 1302 |
| 492 | Ga0207711_10156808 | 3300025941 | Bacteria | 2058 |
| 493 | Ga0207689_10005993 | 3300025942 | Bacteria | 10751 |
| 494 | Ga0207689_10019558 | 3300025942 | Bacteria | 5706 |
| 495 | Ga0207689_10084542 | 3300025942 | Bacteria | 2608 |
| 496 | Ga0207689_10155883 | 3300025942 | Bacteria | 1883 |
| 497 | Ga0207661_10019604 | 3300025944 | Bacteria | 5046 |
| 498 | Ga0207661_10133031 | 3300025944 | Bacteria | 2133 |
| 499 | Ga0207661_10151192 | 3300025944 | Bacteria | 2007 |
| 500 | Ga0207661_10908778 | 3300025944 | Bacteria | 811 |
| 501 | Ga0207661_11403932 | 3300025944 | Bacteria | 641 |
| 502 | Ga0207679_10001675 | 3300025945 | Bacteria | 13804 |
| 503 | Ga0207679_10032297 | 3300025945 | Bacteria | 3673 |
| 504 | Ga0207667_10000098 | 3300025949 | Bacteria | 140051 |
| 505 | Ga0207667_10017026 | 3300025949 | Bacteria | 8198 |
| 506 | Ga0207667_10062322 | 3300025949 | Bacteria | 3900 |
| 507 | Ga0207667_10096038 | 3300025949 | Bacteria | 3059 |
| 508 | Ga0207667_10270369 | 3300025949 | Bacteria | 1738 |
| 509 | Ga0207667_10475313 | 3300025949 | Bacteria | 1269 |
| 510 | Ga0207651_10280758 | 3300025960 | Bacteria | 1376 |
| 511 | Ga0207651_10366333 | 3300025960 | Bacteria | 1218 |
| 512 | Ga0207712_10078276 | 3300025961 | Bacteria | 2399 |
| 513 | Ga0207668_10210037 | 3300025972 | Bacteria | 1556 |
| 514 | Ga0207668_10252966 | 3300025972 | Bacteria | 1432 |
| 515 | Ga0207640_10131713 | 3300025981 | Bacteria | 1809 |
| 516 | Ga0207640_10172343 | 3300025981 | Bacteria | 1614 |
| 517 | Ga0207640_10337458 | 3300025981 | Bacteria | 1206 |
| 518 | Ga0207640_10412645 | 3300025981 | Bacteria | 1103 |
| 519 | Ga0207640_10709979 | 3300025981 | Bacteria | 863 |
| 520 | Ga0207658_10031002 | 3300025986 | Bacteria | 3793 |
| 521 | Ga0207658_10196180 | 3300025986 | Bacteria | 1682 |
| 522 | Ga0207658_10391583 | 3300025986 | Bacteria | 1219 |
| 523 | Ga0207658_10490319 | 3300025986 | Bacteria | 1093 |
| 524 | Ga0207658_10559709 | 3300025986 | Bacteria | 1024 |
| 525 | Ga0207677_11665365 | 3300026023 | Bacteria | 591 |
| 526 | Ga0207703_11110466 | 3300026035 | Bacteria | 760 |
| 527 | Ga0207639_10015901 | 3300026041 | Bacteria | 5314 |
| 528 | Ga0207639_10083313 | 3300026041 | Bacteria | 2538 |
| 529 | Ga0207639_10150844 | 3300026041 | Bacteria | 1946 |
| 530 | Ga0207639_10181205 | 3300026041 | Bacteria | 1792 |
| 531 | Ga0207639_10194763 | 3300026041 | Bacteria | 1734 |
| 532 | Ga0207639_10196563 | 3300026041 | Bacteria | 1727 |
| 533 | Ga0207639_10215795 | 3300026041 | Bacteria | 1654 |
| 534 | Ga0207639_10336027 | 3300026041 | Bacteria | 1345 |
| 535 | Ga0207639_10355955 | 3300026041 | Bacteria | 1309 |
| 536 | Ga0207639_10712315 | 3300026041 | Bacteria | 932 |
| 537 | Ga0207678_10081466 | 3300026067 | Bacteria | 2770 |
| 538 | Ga0207678_10260923 | 3300026067 | Bacteria | 1485 |
| 539 | Ga0207702_10026609 | 3300026078 | Bacteria | 4803 |
| 540 | Ga0207702_10335412 | 3300026078 | Bacteria | 1443 |
| 541 | Ga0207702_10522585 | 3300026078 | Bacteria | 1159 |
| 542 | Ga0207641_10149855 | 3300026088 | Bacteria | 2112 |
| 543 | Ga0207641_10170700 | 3300026088 | Bacteria | 1985 |
| 544 | Ga0207641_10374416 | 3300026088 | Bacteria | 1362 |
| 545 | Ga0207641_10552503 | 3300026088 | Unclassified | 1123 |
| 546 | Ga0207648_10012780 | 3300026089 | Bacteria | 7844 |
| 547 | Ga0207648_10023408 | 3300026089 | Bacteria | 5533 |
| 548 | Ga0207648_10044966 | 3300026089 | Bacteria | 3873 |
| 549 | Ga0207648_10248184 | 3300026089 | Bacteria | 1586 |
| 550 | Ga0207648_10439860 | 3300026089 | Bacteria | 1186 |
| 551 | Ga0207648_10781897 | 3300026089 | Bacteria | 888 |
| 552 | Ga0207676_10087749 | 3300026095 | Bacteria | 2545 |
| 553 | Ga0207676_10101172 | 3300026095 | Bacteria | 2389 |
| 554 | Ga0207676_10172812 | 3300026095 | Bacteria | 1884 |
| 555 | Ga0207676_10206081 | 3300026095 | Bacteria | 1741 |
| 556 | Ga0207674_10000969 | 3300026116 | Bacteria | 37567 |
| 557 | Ga0207674_10014175 | 3300026116 | Bacteria | 8811 |
| 558 | Ga0207674_10014702 | 3300026116 | Bacteria | 8631 |
| 559 | Ga0207674_10025103 | 3300026116 | Bacteria | 6360 |
| 560 | Ga0207674_10034066 | 3300026116 | Bacteria | 5326 |
| 561 | Ga0207674_10185220 | 3300026116 | Bacteria | 2033 |
| 562 | Ga0207674_10660554 | 3300026116 | Unclassified | 1009 |
| 563 | Ga0207674_11172619 | 3300026116 | Bacteria | 738 |
| 564 | Ga0207674_11684163 | 3300026116 | Bacteria | 602 |
| 565 | Ga0207675_100266147 | 3300026118 | Bacteria | 1662 |
| 566 | Ga0207675_100329200 | 3300026118 | Bacteria | 1493 |
| 567 | Ga0207675_100830925 | 3300026118 | Bacteria | 938 |
| 568 | Ga0207675_101435595 | 3300026118 | Bacteria | 711 |
| 569 | Ga0207675_101651844 | 3300026118 | Bacteria | 661 |
| 570 | Ga0207683_10004664 | 3300026121 | Bacteria | 11817 |
| 571 | Ga0207683_10045803 | 3300026121 | Bacteria | 3825 |
| 572 | Ga0207683_10100616 | 3300026121 | Bacteria | 2581 |
| 573 | Ga0207698_10021209 | 3300026142 | Bacteria | 4488 |
| 574 | Ga0207698_10051034 | 3300026142 | Bacteria | 3160 |
| 575 | Ga0207698_10052541 | 3300026142 | Bacteria | 3123 |
| 576 | Ga0207698_10174898 | 3300026142 | Bacteria | 1895 |
| 577 | Ga0207698_10345297 | 3300026142 | Bacteria | 1403 |
| 578 | Ga0207698_10809631 | 3300026142 | Bacteria | 939 |
| 579 | Ga0207698_10859943 | 3300026142 | Bacteria | 912 |
| 580 | Ga0209969_1023408 | 3300027360 | Bacteria | 926 |
| 581 | Ga0209995_1004101 | 3300027471 | Bacteria | 2325 |
| 582 | Ga0209971_1041396 | 3300027682 | Unclassified | 1109 |
| 583 | Ga0209974_10068612 | 3300027876 | Bacteria | 1207 |
| 584 | Ga0207428_10130466 | 3300027907 | Bacteria | 1923 |
| 585 | Ga0268266_10008277 | 3300028379 | Bacteria | 9267 |
| 586 | Ga0268266_10062165 | 3300028379 | Bacteria | 3222 |
| 587 | Ga0268266_10094525 | 3300028379 | Bacteria | 2624 |
| 588 | Ga0268266_10472899 | 3300028379 | Bacteria | 1194 |
| 589 | Ga0268265_10015032 | 3300028380 | Bacteria | 5286 |
| 590 | Ga0268265_10595482 | 3300028380 | Bacteria | 1056 |
| 591 | Ga0268264_10000079 | 3300028381 | Bacteria | 249516 |
| 592 | Ga0268264_10007764 | 3300028381 | Bacteria | 8933 |
| 593 | Ga0268264_10015227 | 3300028381 | Bacteria | 6309 |
| 594 | Ga0268264_10258960 | 3300028381 | Bacteria | 1620 |
| 595 | Ga0268264_11495320 | 3300028381 | Bacteria | 686 |
| 596 | Ga0307517_10327950 | 3300028786 | Bacteria | 843 |
| 597 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 598 | Ga0307515_10000059 | 3300028794 | Bacteria | 257520 |
| 599 | Ga0307511_10022566 | 3300030521 | Bacteria | 5895 |
| 600 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 601 | Ga0265327_10000030 | 3300031251 | Bacteria | 333531 |
| 602 | Ga0265327_10057725 | 3300031251 | Bacteria | 1996 |
| 603 | Ga0307513_10178127 | 3300031456 | Bacteria | 1993 |
| 604 | Ga0307514_10338550 | 3300031649 | Bacteria | 812 |
| 605 | Ga0265314_10132806 | 3300031711 | Bacteria | 1550 |
| 606 | Ga0307516_10003458 | 3300031730 | Bacteria | 20249 |
| 607 | Ga0307516_10241696 | 3300031730 | Bacteria | 1503 |
| 608 | Ga0307413_10406011 | 3300031824 | Bacteria | 1069 |
| 609 | Ga0307410_10358699 | 3300031852 | Unclassified | 1167 |
| 610 | Ga0307410_10404322 | 3300031852 | Bacteria | 1104 |
| 611 | Ga0307409_100654231 | 3300031995 | Bacteria | 1045 |
| 612 | Ga0307416_100747113 | 3300032002 | Bacteria | 1071 |
| 613 | Ga0307416_101483349 | 3300032002 | Bacteria | 784 |
| 614 | Ga0307414_10074124 | 3300032004 | Bacteria | 2465 |
| 615 | Ga0307414_11313697 | 3300032004 | Bacteria | 671 |
| 616 | Ga0307411_10860403 | 3300032005 | Bacteria | 803 |
| 617 | Ga0307415_100755866 | 3300032126 | Bacteria | 883 |
| 618 | Ga0307415_101102587 | 3300032126 | Bacteria | 743 |
| 619 | Ga0307510_10009446 | 3300033180 | Bacteria | 11614 |
| 620 | Ga0316214_1038468 | 3300033545 | Bacteria | 685 |
| 621 | Ga0373934_0198739 | 3300035086 | Bacteria | 825 |
| 622 | Ga0373953_0080711 | 3300035117 | Bacteria | 1352 |
| 623 | Ga0373954_0166526 | 3300035118 | Bacteria | 1079 |
| 624 | Ga0373955_0070860 | 3300035172 | Bacteria | 1948 |
| 625 | Ga0373924_0133640 | 3300035410 | Bacteria | 1080 |
| 626 | Ga0373935_0138643 | 3300035692 | Bacteria | 1641 |
| 627 | Ga0373935_0194986 | 3300035692 | Bacteria | 1397 |
| 628 | Ga0373937_0040867 | 3300036401 | Bacteria | 4228 |
| 629 | Ga0373925_0119354 | 3300037068 | Bacteria | 2046 |
| 630 | Ga0395899_0012303 | 3300037312 | Bacteria | 6555 |
| 631 | Ga0395899_0078033 | 3300037312 | Bacteria | 2415 |
| 632 | Ga0395900_0015690 | 3300037418 | Bacteria | 7722 |
| 633 | Ga0395900_0187516 | 3300037418 | Bacteria | 2099 |
| 634 | Ga0395898_0024421 | 3300037466 | Bacteria | 6096 |
| 635 | Ga0395905_0002365 | 3300037471 | Bacteria | 21010 |
| 636 | Ga0395905_0065491 | 3300037471 | Bacteria | 3402 |
| 637 | Ga0395901_0004445 | 3300038443 | Bacteria | 14139 |
| 638 | Ga0395901_0431605 | 3300038443 | Bacteria | 1350 |
| 639 | Ga0436365_0311643 | 3300039437 | Bacteria | 16902 |
| 640 | Ga0436365_0918024 | 3300039437 | Bacteria | 720 |
| 641 | Ga0436362_0886610 | 3300039453 | Bacteria | 775 |
| 642 | Ga0439436_0000160 | 3300041404 | Bacteria | 15790 |
| 643 | Ga0439436_0038169 | 3300041404 | Bacteria | 1382 |
| 644 | Ga0439439_0002072 | 3300041406 | Bacteria | 4180 |
| 645 | Ga0439465_0040095 | 3300041413 | Bacteria | 1513 |
| 646 | Ga0451802_1207351 | 3300041460 | Bacteria | 983 |
| 647 | Ga0451851_0296872 | 3300041507 | Bacteria | 591 |
| 648 | Ga0451843_0090240 | 3300041509 | Bacteria | 633 |
| 649 | Ga0451843_1769404 | 3300041509 | Bacteria | 977 |
| 650 | Ga0439431_0000806 | 3300041997 | Bacteria | 6768 |
| 651 | Ga0439433_0021554 | 3300041999 | Bacteria | 1442 |
| 652 | Ga0439445_0057213 | 3300042004 | Bacteria | 1061 |
| 653 | Ga0439449_0008071 | 3300042007 | Bacteria | 4000 |
| 654 | Ga0439449_0013227 | 3300042007 | Bacteria | 3104 |
| 655 | Ga0439449_0017949 | 3300042007 | Bacteria | 2656 |
| 656 | Ga0439449_0187938 | 3300042007 | Bacteria | 773 |
| 657 | Ga0439457_003842 | 3300042014 | Bacteria | 4024 |
| 658 | Ga0439462_0014378 | 3300042015 | Bacteria | 2033 |
| 659 | Ga0439462_0117773 | 3300042015 | Bacteria | 738 |
| 660 | Ga0450898_009254 | 3300042134 | Bacteria | 1572 |
| 661 | Ga0450899_043287 | 3300042135 | Bacteria | 566 |
| 662 | Ga0450908_056495 | 3300042184 | Bacteria | 686 |
| 663 | Ga0439434_0037134 | 3300042435 | Bacteria | 1491 |
| 664 | Ga0450893_0039269 | 3300042532 | Bacteria | 864 |
| 665 | Ga0451577_0493722 | 3300042876 | Bacteria | 1111 |
| 666 | Ga0466969_0048045 | 3300044656 | Bacteria | 2111 |
| 667 | Ga0466972_0000082 | 3300044658 | Bacteria | 88592 |
| 668 | Ga0466972_0000146 | 3300044658 | Bacteria | 57580 |
| 669 | Ga0466972_0015319 | 3300044658 | Bacteria | 3833 |
| 670 | Ga0466972_0024449 | 3300044658 | Bacteria | 2997 |
| 671 | Ga0466972_0031023 | 3300044658 | Bacteria | 2631 |
| 672 | Ga0453683_0111624 | 3300044673 | Bacteria | 1719 |
| 673 | Ga0466965_0075261 | 3300044683 | Bacteria | 1702 |
| 674 | Ga0466965_0126383 | 3300044683 | Bacteria | 1323 |
| 675 | Ga0466965_0270324 | 3300044683 | Bacteria | 916 |
| 676 | Ga0466966_0165376 | 3300044684 | Bacteria | 1346 |
| 677 | Ga0453684_0157320 | 3300044712 | Bacteria | 2692 |
| 678 | Ga0453684_0183866 | 3300044712 | Bacteria | 2451 |
| 679 | Ga0453684_0890069 | 3300044712 | Bacteria | 954 |
| 680 | Ga0466968_0046866 | 3300044735 | Bacteria | 1837 |
| 681 | Ga0466970_0170791 | 3300044765 | Bacteria | 1205 |
| 682 | Ga0466957_0000381 | 3300044842 | Bacteria | 21723 |
| 683 | Ga0466957_0006481 | 3300044842 | Bacteria | 6610 |
| 684 | Ga0466957_0426924 | 3300044842 | Bacteria | 910 |
| 685 | Ga0466959_0032925 | 3300045049 | Bacteria | 3836 |
| 686 | Ga0466959_0112955 | 3300045049 | Bacteria | 1937 |
| 687 | Ga0451576_0381844 | 3300045051 | Bacteria | 1477 |
| 688 | Ga0466958_0032173 | 3300045836 | Bacteria | 3120 |
| 689 | Ga0495592_0374909 | 3300046454 | Bacteria | 907 |
| 690 | Ga0495629_0099643 | 3300046459 | Bacteria | 2028 |
| 691 | Ga0495638_0009863 | 3300046460 | Bacteria | 6665 |
| 692 | Ga0495653_0292053 | 3300046463 | Bacteria | 1066 |
| 693 | Ga0495650_0044451 | 3300046471 | Bacteria | 1878 |
| 694 | Ga0495664_0284396 | 3300046477 | Bacteria | 999 |
| 695 | Ga0495606_0034998 | 3300046507 | Bacteria | 3439 |
| 696 | Ga0495608_0026304 | 3300046511 | Bacteria | 3968 |
| 697 | Ga0495630_0146876 | 3300046517 | Bacteria | 1793 |
| 698 | Ga0495632_0321043 | 3300046519 | Bacteria | 684 |
| 699 | Ga0495648_0001246 | 3300046524 | Bacteria | 25445 |
| 700 | Ga0495652_0042704 | 3300046529 | Bacteria | 3909 |
| 701 | Ga0495652_0521171 | 3300046529 | Bacteria | 821 |
| 702 | Ga0495586_0214507 | 3300046535 | Bacteria | 1093 |
| 703 | Ga0495587_0047268 | 3300046536 | Bacteria | 2552 |
| 704 | Ga0495598_0090883 | 3300046537 | Bacteria | 995 |
| 705 | Ga0495645_0075044 | 3300046543 | Bacteria | 2434 |
| 706 | Ga0495667_0213350 | 3300046559 | Bacteria | 1233 |
| 707 | Ga0495668_0000202 | 3300046616 | Bacteria | 87083 |
| 708 | Ga0495634_0375114 | 3300046642 | Bacteria | 848 |
| 709 | Ga0495634_0511427 | 3300046642 | Bacteria | 703 |
| 710 | Ga0495611_0001026 | 3300046648 | Bacteria | 14788 |
| 711 | Ga0495625_0092176 | 3300046660 | Bacteria | 2094 |
| 712 | Ga0495635_0031039 | 3300046663 | Bacteria | 3712 |
| 713 | Ga0495669_0291642 | 3300046684 | Bacteria | 786 |
| 714 | Ga0495649_0431637 | 3300046694 | Bacteria | 659 |
| 715 | Ga0495649_0451804 | 3300046694 | Bacteria | 642 |
| 716 | Ga0495600_0018974 | 3300046809 | Bacteria | 4389 |
| 717 | Ga0495604_0071896 | 3300047317 | Bacteria | 2616 |
| 718 | Ga0495674_0218995 | 3300047319 | Bacteria | 1574 |
| 719 | Ga0495676_0848344 | 3300047321 | Bacteria | 587 |
| 720 | Ga0495687_000886 | 3300047443 | Bacteria | 31629 |
| 721 | Ga0495684_0141387 | 3300047471 | Bacteria | 1804 |
| 722 | Ga0495686_0225644 | 3300047472 | Bacteria | 1063 |
| 723 | Ga0495686_0265761 | 3300047472 | Bacteria | 959 |
| 724 | Ga0496100_0550662 | 3300048903 | Bacteria | 892 |
| 725 | Ga0496101_0042227 | 3300048904 | Bacteria | 3255 |
| 726 | Ga0496105_0366662 | 3300048908 | Bacteria | 1148 |
| 727 | Ga0496106_0181322 | 3300048909 | Bacteria | 1672 |
| 728 | Ga0496109_0355081 | 3300048912 | Bacteria | 1385 |
| 729 | Ga0496110_0459186 | 3300048913 | Bacteria | 1161 |
| 730 | Ga0496114_0000538 | 3300048917 | Bacteria | 27938 |
| 731 | Ga0496114_0050742 | 3300048917 | Bacteria | 3454 |
| 732 | Ga0496115_0744153 | 3300048918 | Bacteria | 767 |
| 733 | Ga0496124_0049547 | 3300048927 | Bacteria | 3583 |
| 734 | Ga0501298_108037 | 3300049521 | Bacteria | 642 |
| 735 | Ga0501335_007011 | 3300049551 | Bacteria | 1035 |
| 736 | Ga0501031_0024784 | 3300049568 | Bacteria | 3911 |
| 737 | Ga0501032_0009186 | 3300049569 | Bacteria | 7166 |
| 738 | Ga0501032_0196001 | 3300049569 | Bacteria | 1319 |
| 739 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 740 | Ga0501034_0030378 | 3300049571 | Bacteria | 5493 |
| 741 | Ga0501034_0152617 | 3300049571 | Bacteria | 2285 |
| 742 | Ga0501036_0210844 | 3300049572 | Bacteria | 1632 |
| 743 | Ga0501037_0019254 | 3300049573 | Bacteria | 5032 |
| 744 | Ga0501037_0044258 | 3300049573 | Bacteria | 3269 |
| 745 | Ga0501038_0048321 | 3300049574 | Unclassified | 3682 |
| 746 | Ga0501038_0058848 | 3300049574 | Bacteria | 3293 |
| 747 | Ga0501038_0751902 | 3300049574 | Bacteria | 727 |
| 748 | Ga0501039_0156785 | 3300049575 | Bacteria | 1789 |
| 749 | Ga0501040_0168557 | 3300049576 | Unclassified | 1550 |
| 750 | Ga0501043_0019687 | 3300049579 | Bacteria | 5300 |
| 751 | Ga0501046_0077826 | 3300049580 | Bacteria | 2567 |
| 752 | Ga0501047_0107962 | 3300049581 | Bacteria | 2665 |
| 753 | Ga0501047_0258382 | 3300049581 | Bacteria | 1590 |
| 754 | Ga0501047_0259607 | 3300049581 | Bacteria | 1585 |
| 755 | Ga0501068_0213485 | 3300049584 | Unclassified | 1226 |
| 756 | Ga0501070_0228816 | 3300049586 | Bacteria | 1524 |
| 757 | Ga0501072_0129038 | 3300049588 | Bacteria | 2015 |
| 758 | Ga0501202_001707 | 3300049652 | Bacteria | 3561 |
| 759 | Ga0501217_026917 | 3300049661 | Bacteria | 1392 |
| 760 | Ga0501222_013011 | 3300049662 | Bacteria | 1096 |
| 761 | Ga0501223_009110 | 3300049663 | Bacteria | 2015 |
| 762 | Ga0501228_022452 | 3300049666 | Bacteria | 723 |
| 763 | Ga0501235_059660 | 3300049669 | Bacteria | 892 |
| 764 | Ga0501236_045667 | 3300049670 | Bacteria | 738 |
| 765 | Ga0501240_072150 | 3300049673 | Bacteria | 627 |
| 766 | Ga0501252_021502 | 3300049682 | Bacteria | 846 |
| 767 | Ga0501259_090520 | 3300049688 | Bacteria | 687 |
| 768 | Ga0501221_116871 | 3300049704 | Bacteria | 678 |
| 769 | Ga0501225_0001644 | 3300049705 | Bacteria | 6977 |
| 770 | Ga0501245_027499 | 3300049708 | Bacteria | 923 |
| 771 | Ga0501080_0266670 | 3300049742 | Bacteria | 1559 |
| 772 | Ga0501241_003800 | 3300049758 | Bacteria | 2845 |
| 773 | Ga0501266_002964 | 3300049763 | Bacteria | 2115 |
| 774 | Ga0501273_064702 | 3300049770 | Bacteria | 583 |
| 775 | Ga0501035_0058002 | 3300049822 | Bacteria | 3451 |
| 776 | Ga0501044_0057853 | 3300049823 | Bacteria | 3977 |
| 777 | Ga0501044_0249915 | 3300049823 | Bacteria | 1715 |
| 778 | Ga0501204_042040 | 3300049850 | Bacteria | 673 |
| 779 | nmdc:mga0k408_152717_c1 | 3300050493 | Bacteria | 1375 |
| 780 | nmdc:mga0k408_347611_c1 | 3300050493 | Bacteria | 884 |
| 781 | nmdc:mga0k408_365215_c1 | 3300050493 | Bacteria | 860 |
| 782 | nmdc:mga0k408_83869_c1 | 3300050493 | Bacteria | 1869 |
| 783 | nmdc:mga07m45_100577_c1 | 3300050496 | Bacteria | 1660 |
| 784 | nmdc:mga07m45_177196_c1 | 3300050496 | Bacteria | 1239 |
| 785 | nmdc:mga05p37_278481_c1 | 3300050507 | Bacteria | 1996 |
| 786 | nmdc:mga08y16_7939_c1 | 3300050511 | Bacteria | 11107 |
| 787 | nmdc:mga0n895_40693_c1 | 3300050512 | Bacteria | 4515 |
| 788 | Ga0495619_0293753 | 3300053085 | Bacteria | 1126 |
| 789 | Ga0500578_0000063 | 3300053086 | Bacteria | 117869 |
| 790 | Ga0500578_0234069 | 3300053086 | Bacteria | 1112 |
| 791 | Ga0500644_0000042 | 3300053088 | Bacteria | 76909 |
| 792 | Ga0500644_0029590 | 3300053088 | Bacteria | 1724 |
| 793 | Ga0500646_0002688 | 3300053090 | Bacteria | 4591 |
| 794 | Ga0500646_0058349 | 3300053090 | Bacteria | 1130 |
| 795 | Ga0500583_0000076 | 3300053092 | Bacteria | 59162 |
| 796 | Ga0500583_0011401 | 3300053092 | Bacteria | 3348 |
| 797 | Ga0500583_0026172 | 3300053092 | Bacteria | 2501 |
| 798 | Ga0500651_0453384 | 3300053093 | Bacteria | 713 |
| 799 | Ga0500650_0106245 | 3300053098 | Bacteria | 1312 |
| 800 | Ga0500562_000013 | 3300053108 | Bacteria | 150003 |
| 801 | Ga0500569_000551 | 3300053109 | Bacteria | 6285 |
| 802 | Ga0500572_003120 | 3300053111 | Bacteria | 3843 |
| 803 | Ga0500594_0019590 | 3300053118 | Bacteria | 1679 |
| 804 | Ga0500607_024676 | 3300053121 | Bacteria | 3354 |
| 805 | Ga0500628_023766 | 3300053129 | Bacteria | 1266 |
| 806 | Ga0500642_0057945 | 3300053130 | Bacteria | 1730 |
| 807 | Ga0500652_007276 | 3300053131 | Bacteria | 3614 |
| 808 | Ga0500655_080816 | 3300053133 | Bacteria | 669 |
| 809 | Ga0500658_0013681 | 3300053134 | Bacteria | 3000 |
| 810 | Ga0500559_0007408 | 3300053136 | Bacteria | 4866 |
| 811 | Ga0500568_0000080 | 3300053139 | Bacteria | 92694 |
| 812 | Ga0500568_0065045 | 3300053139 | Bacteria | 1404 |
| 813 | Ga0500577_0000839 | 3300053142 | Bacteria | 7946 |
| 814 | Ga0500588_0054050 | 3300053146 | Bacteria | 1263 |
| 815 | Ga0500590_066310 | 3300053148 | Bacteria | 1802 |
| 816 | Ga0500590_214684 | 3300053148 | Bacteria | 800 |
| 817 | Ga0500616_0074910 | 3300053153 | Bacteria | 1715 |
| 818 | Ga0500616_0080468 | 3300053153 | Bacteria | 1638 |
| 819 | Ga0500616_0226325 | 3300053153 | Bacteria | 812 |
| 820 | Ga0500622_0000242 | 3300053156 | Bacteria | 56575 |
| 821 | Ga0500622_0000939 | 3300053156 | Bacteria | 24779 |
| 822 | Ga0500622_0006674 | 3300053156 | Bacteria | 6650 |
| 823 | Ga0500633_0002773 | 3300053160 | Bacteria | 3682 |
| 824 | Ga0500636_0278058 | 3300053177 | Bacteria | 837 |
| 825 | Ga0500637_0215991 | 3300053178 | Bacteria | 1086 |
| 826 | Ga0500584_075481 | 3300053726 | Bacteria | 1459 |
| 827 | Ga0500611_000060 | 3300053727 | Bacteria | 47744 |
| 828 | Ga0500661_005067 | 3300055283 | Bacteria | 2468 |
| 829 | Ga0500661_014284 | 3300055283 | Bacteria | 1429 |
| 830 | Ga0587077_012566 | 3300059493 | Bacteria | 1356 |
| 831 | Ga0466962_0005005 | 3300061719 | Bacteria | 6372 |
| 832 | Ga0466962_0088987 | 3300061719 | Bacteria | 1479 |
| 833 | Ga0466962_0092693 | 3300061719 | Bacteria | 1448 |
| 834 | Ga0466962_0180847 | 3300061719 | Bacteria | 1028 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300011119 | Ga0105246_10234822 | Ga0105246_102348222 | 144 |
| 2 | 3300013296 | Ga0157374_10041765 | Ga0157374_100417655 | 144 |
| 3 | 3300013297 | Ga0157378_10003727 | Ga0157378_1000372712 | 144 |
| 4 | 3300049850 | Ga0501204_042040 | Ga0501204_042040_19_507 | 153 |
| 5 | 3300013307 | Ga0157372_10188258 | Ga0157372_101882583 | 154 |
| 6 | 3300014326 | Ga0157380_10526802 | Ga0157380_105268021 | 154 |
| 7 | 3300037312 | Ga0395899_0078033 | Ga0395899_0078033_959_1471 | 155 |
| 8 | 3300037418 | Ga0395900_0187516 | Ga0395900_0187516_494_1006 | 155 |
| 9 | 3300037471 | Ga0395905_0002365 | Ga0395905_0002365_9646_10158 | 155 |
| 10 | 3300037471 | Ga0395905_0065491 | Ga0395905_0065491_1815_2327 | 155 |
| 11 | 3300038443 | Ga0395901_0431605 | Ga0395901_0431605_28_540 | 155 |
| 12 | 3300005353 | Ga0070669_100597678 | Ga0070669_1005976782 | 156 |
| 13 | 3300005843 | Ga0068860_101823472 | Ga0068860_1018234721 | 156 |
| 14 | 3300013307 | Ga0157372_10032041 | Ga0157372_100320413 | 156 |
| 15 | 3300028381 | Ga0268264_11495320 | Ga0268264_114953201 | 156 |
| 16 | 3300045049 | Ga0466959_0032925 | Ga0466959_0032925_514_1026 | 156 |
| 17 | 3300045836 | Ga0466958_0032173 | Ga0466958_0032173_368_880 | 156 |
| 18 | 3300061719 | Ga0466962_0005005 | Ga0466962_0005005_3947_4459 | 156 |
| 19 | 3300006871 | Ga0075434_100046233 | Ga0075434_1000462332 | 157 |
| 20 | 3300013297 | Ga0157378_11098334 | Ga0157378_110983341 | 157 |
| 21 | 3300014968 | Ga0157379_10268713 | Ga0157379_102687132 | 157 |
| 22 | 3300032002 | Ga0307416_100747113 | Ga0307416_1007471132 | 157 |
| 23 | 3300050512 | nmdc:mga0n895_40693_c1 | nmdc:mga0n895_40693_c1_3251_3760 | 157 |
| 24 | 3300041404 | Ga0439436_0000160 | Ga0439436_0000160_1568_2047 | 159 |
| 25 | 3300041406 | Ga0439439_0002072 | Ga0439439_0002072_1646_2125 | 159 |
| 26 | 3300041999 | Ga0439433_0021554 | Ga0439433_0021554_371_850 | 159 |
| 27 | 3300042007 | Ga0439449_0013227 | Ga0439449_0013227_898_1377 | 159 |
| 28 | 3300042014 | Ga0439457_003842 | Ga0439457_003842_1190_1669 | 159 |
| 29 | 3300042015 | Ga0439462_0014378 | Ga0439462_0014378_938_1417 | 159 |
| 30 | 3300042135 | Ga0450899_043287 | Ga0450899_043287_17_496 | 159 |
| 31 | 3300005329 | Ga0070683_100981511 | Ga0070683_1009815112 | 160 |
| 32 | 3300005458 | Ga0070681_10221963 | Ga0070681_102219633 | 160 |
| 33 | 3300013100 | Ga0157373_10040922 | Ga0157373_100409222 | 160 |
| 34 | 3300025912 | Ga0207707_10722912 | Ga0207707_107229122 | 160 |
| 35 | 3300027360 | Ga0209969_1023408 | Ga0209969_10234082 | 160 |
| 36 | 3300027471 | Ga0209995_1004101 | Ga0209995_10041012 | 160 |
| 37 | 3300027682 | Ga0209971_1041396 | Ga0209971_10413962 | 160 |
| 38 | 3300027876 | Ga0209974_10068612 | Ga0209974_100686121 | 160 |
| 39 | 3300028794 | Ga0307515_10000059 | Ga0307515_10000059144 | 160 |
| 40 | 3300005354 | Ga0070675_100511190 | Ga0070675_1005111901 | 161 |
| 41 | 3300014968 | Ga0157379_10451648 | Ga0157379_104516482 | 161 |
| 42 | 3300025926 | Ga0207659_11329245 | Ga0207659_113292451 | 161 |
| 43 | 3300026118 | Ga0207675_101651844 | Ga0207675_1016518441 | 162 |
| 44 | 3300049568 | Ga0501031_0024784 | Ga0501031_0024784_2930_3448 | 162 |
| 45 | 3300049569 | Ga0501032_0196001 | Ga0501032_0196001_298_906 | 162 |
| 46 | 3300049572 | Ga0501036_0210844 | Ga0501036_0210844_10_528 | 162 |
| 47 | 3300049573 | Ga0501037_0044258 | Ga0501037_0044258_1188_1706 | 162 |
| 48 | 3300049574 | Ga0501038_0048321 | Ga0501038_0048321_1668_2249 | 162 |
| 49 | 3300049576 | Ga0501040_0168557 | Ga0501040_0168557_946_1464 | 162 |
| 50 | 3300049580 | Ga0501046_0077826 | Ga0501046_0077826_985_1503 | 162 |
| 51 | 3300049584 | Ga0501068_0213485 | Ga0501068_0213485_277_885 | 162 |
| 52 | 3300049588 | Ga0501072_0129038 | Ga0501072_0129038_82_600 | 162 |
| 53 | 3300049822 | Ga0501035_0058002 | Ga0501035_0058002_1590_2108 | 162 |
| 54 | 3300013307 | Ga0157372_10058652 | Ga0157372_100586522 | 163 |
| 55 | 3300013307 | Ga0157372_11243537 | Ga0157372_112435371 | 163 |
| 56 | 3300025321 | Ga0207656_10231017 | Ga0207656_102310171 | 163 |
| 57 | 3300026089 | Ga0207648_10439860 | Ga0207648_104398601 | 163 |
| 58 | 3300005335 | Ga0070666_10173715 | Ga0070666_101737152 | 164 |
| 59 | 3300006237 | Ga0097621_100114616 | Ga0097621_1001146162 | 164 |
| 60 | 3300013307 | Ga0157372_10226830 | Ga0157372_102268303 | 164 |
| 61 | 3300014326 | Ga0157380_10865854 | Ga0157380_108658542 | 164 |
| 62 | 3300031852 | Ga0307410_10404322 | Ga0307410_104043222 | 164 |
| 63 | 3300031995 | Ga0307409_100654231 | Ga0307409_1006542311 | 165 |
| 64 | 3300039437 | Ga0436365_0918024 | Ga0436365_0918024_99_614 | 165 |
| 65 | 3300049662 | Ga0501222_013011 | Ga0501222_013011_51_575 | 165 |
| 66 | 3300049666 | Ga0501228_022452 | Ga0501228_022452_171_695 | 165 |
| 67 | 3300049669 | Ga0501235_059660 | Ga0501235_059660_22_546 | 165 |
| 68 | 3300049673 | Ga0501240_072150 | Ga0501240_072150_44_568 | 165 |
| 69 | 3300049682 | Ga0501252_021502 | Ga0501252_021502_29_553 | 165 |
| 70 | 3300049708 | Ga0501245_027499 | Ga0501245_027499_380_904 | 165 |
| 71 | 3300049763 | Ga0501266_002964 | Ga0501266_002964_633_1157 | 165 |
| 72 | iso_pu_bacteria | 2738541278 | 2738725600 | 165 |
| 73 | 3300005618 | Ga0068864_101256703 | Ga0068864_1012567031 | 166 |
| 74 | 3300048917 | Ga0496114_0000538 | Ga0496114_0000538_3857_4369 | 166 |
| 75 | 3300053090 | Ga0500646_0058349 | Ga0500646_0058349_193_693 | 166 |
| 76 | 3300053108 | Ga0500562_000013 | Ga0500562_000013_57498_57998 | 166 |
| 77 | 3300053118 | Ga0500594_0019590 | Ga0500594_0019590_309_809 | 166 |
| 78 | iso_pu_bacteria | 2929154850 | 2929159597 | 166 |
| 79 | 3300005335 | Ga0070666_10187414 | Ga0070666_101874142 | 167 |
| 80 | 3300005367 | Ga0070667_100833897 | Ga0070667_1008338971 | 167 |
| 81 | 3300005539 | Ga0068853_100528449 | Ga0068853_1005284492 | 167 |
| 82 | 3300005614 | Ga0068856_100055686 | Ga0068856_1000556862 | 167 |
| 83 | 3300005616 | Ga0068852_100045245 | Ga0068852_1000452454 | 167 |
| 84 | 3300005616 | Ga0068852_100916598 | Ga0068852_1009165982 | 167 |
| 85 | 3300005618 | Ga0068864_100046635 | Ga0068864_1000466354 | 167 |
| 86 | 3300009545 | Ga0105237_10003705 | Ga0105237_1000370513 | 167 |
| 87 | 3300009545 | Ga0105237_10013196 | Ga0105237_100131967 | 167 |
| 88 | 3300010375 | Ga0105239_10009226 | Ga0105239_100092262 | 167 |
| 89 | 3300013306 | Ga0163162_10863198 | Ga0163162_108631982 | 167 |
| 90 | 3300025911 | Ga0207654_10006717 | Ga0207654_100067173 | 167 |
| 91 | 3300025913 | Ga0207695_10014509 | Ga0207695_100145095 | 167 |
| 92 | 3300025914 | Ga0207671_10002781 | Ga0207671_100027817 | 167 |
| 93 | 3300025914 | Ga0207671_10007499 | Ga0207671_100074995 | 167 |
| 94 | 3300025914 | Ga0207671_10012770 | Ga0207671_100127702 | 167 |
| 95 | 3300025924 | Ga0207694_10017189 | Ga0207694_100171894 | 167 |
| 96 | 3300025949 | Ga0207667_10475313 | Ga0207667_104753132 | 167 |
| 97 | 3300025986 | Ga0207658_10490319 | Ga0207658_104903191 | 167 |
| 98 | 3300026041 | Ga0207639_10196563 | Ga0207639_101965632 | 167 |
| 99 | 3300026078 | Ga0207702_10335412 | Ga0207702_103354122 | 167 |
| 100 | 3300026095 | Ga0207676_10206081 | Ga0207676_102060811 | 167 |
| 101 | 3300026142 | Ga0207698_10021209 | Ga0207698_100212092 | 167 |
| 102 | 3300042876 | Ga0451577_0493722 | Ga0451577_0493722_110_628 | 167 |
| 103 | 3300044683 | Ga0466965_0270324 | Ga0466965_0270324_202_711 | 167 |
| 104 | 3300044712 | Ga0453684_0157320 | Ga0453684_0157320_523_1041 | 167 |
| 105 | 3300049742 | Ga0501080_0266670 | Ga0501080_0266670_873_1382 | 167 |
| 106 | 3300055283 | Ga0500661_014284 | Ga0500661_014284_679_1182 | 167 |
| 107 | 3300061719 | Ga0466962_0180847 | Ga0466962_0180847_502_1011 | 167 |
| 108 | iso_pu_bacteria | 2818991442 | 2819574675 | 167 |
| 109 | iso_pu_bacteria | 2818991460 | 2819676574 | 167 |
| 110 | iso_pu_bacteria | 2821136567 | 2821140766 | 167 |
| 111 | iso_pu_bacteria | 2840677318 | 2840678472 | 167 |
| 112 | iso_pu_bacteria | 2883068021 | 2883071389 | 167 |
| 113 | iso_pu_bacteria | 2884791551 | 2884796437 | 167 |
| 114 | iso_pu_bacteria | 2896085136 | 2896086290 | 167 |
| 115 | iso_pu_bacteria | 2896109856 | 2896113417 | 167 |
| 116 | iso_pu_bacteria | 2904467357 | 2904471268 | 167 |
| 117 | iso_pu_bacteria | 2929177148 | 2929178050 | 167 |
| 118 | iso_pu_bacteria | 2929239360 | 2929240378 | 167 |
| 119 | iso_pu_bacteria | 2929921140 | 2929922125 | 167 |
| 120 | iso_pu_bacteria | 2945977869 | 2945980410 | 167 |
| 121 | iso_pu_bacteria | 2946013367 | 2946013727 | 167 |
| 122 | iso_pu_bacteria | 8003151029 | 8003155660 | 167 |
| 123 | 3300003320 | rootH2_10149464 | rootH2_101494642 | 168 |
| 124 | 3300005290 | Ga0065712_10030184 | Ga0065712_100301842 | 168 |
| 125 | 3300005331 | Ga0070670_100261512 | Ga0070670_1002615122 | 168 |
| 126 | 3300005338 | Ga0068868_100083535 | Ga0068868_1000835352 | 168 |
| 127 | 3300005339 | Ga0070660_100584631 | Ga0070660_1005846311 | 168 |
| 128 | 3300005343 | Ga0070687_100894375 | Ga0070687_1008943751 | 168 |
| 129 | 3300005347 | Ga0070668_100400452 | Ga0070668_1004004522 | 168 |
| 130 | 3300005353 | Ga0070669_100399589 | Ga0070669_1003995892 | 168 |
| 131 | 3300005354 | Ga0070675_100131302 | Ga0070675_1001313022 | 168 |
| 132 | 3300005355 | Ga0070671_100722618 | Ga0070671_1007226181 | 168 |
| 133 | 3300005364 | Ga0070673_100176585 | Ga0070673_1001765852 | 168 |
| 134 | 3300005459 | Ga0068867_100740619 | Ga0068867_1007406192 | 168 |
| 135 | 3300005539 | Ga0068853_100917069 | Ga0068853_1009170691 | 168 |
| 136 | 3300005543 | Ga0070672_100335842 | Ga0070672_1003358422 | 168 |
| 137 | 3300005577 | Ga0068857_100004302 | Ga0068857_1000043021 | 168 |
| 138 | 3300005577 | Ga0068857_100372094 | Ga0068857_1003720942 | 168 |
| 139 | 3300005578 | Ga0068854_100124556 | Ga0068854_1001245563 | 168 |
| 140 | 3300005616 | Ga0068852_100000989 | Ga0068852_10000098917 | 168 |
| 141 | 3300005843 | Ga0068860_100661574 | Ga0068860_1006615742 | 168 |
| 142 | 3300006163 | Ga0070715_10206605 | Ga0070715_102066052 | 168 |
| 143 | 3300006237 | Ga0097621_100030125 | Ga0097621_1000301252 | 168 |
| 144 | 3300006358 | Ga0068871_100004499 | Ga0068871_1000044992 | 168 |
| 145 | 3300009093 | Ga0105240_10000800 | Ga0105240_1000080024 | 168 |
| 146 | 3300009093 | Ga0105240_10073546 | Ga0105240_100735465 | 168 |
| 147 | 3300009093 | Ga0105240_10194738 | Ga0105240_101947382 | 168 |
| 148 | 3300009174 | Ga0105241_10001809 | Ga0105241_100018098 | 168 |
| 149 | 3300009174 | Ga0105241_10042701 | Ga0105241_100427011 | 168 |
| 150 | 3300009176 | Ga0105242_10700684 | Ga0105242_107006842 | 168 |
| 151 | 3300009545 | Ga0105237_10027884 | Ga0105237_100278847 | 168 |
| 152 | 3300009545 | Ga0105237_10336811 | Ga0105237_103368112 | 168 |
| 153 | 3300009545 | Ga0105237_11214807 | Ga0105237_112148072 | 168 |
| 154 | 3300009551 | Ga0105238_10000592 | Ga0105238_1000059221 | 168 |
| 155 | 3300009551 | Ga0105238_10041982 | Ga0105238_100419825 | 168 |
| 156 | 3300009553 | Ga0105249_10361403 | Ga0105249_103614032 | 168 |
| 157 | 3300010375 | Ga0105239_10061440 | Ga0105239_100614402 | 168 |
| 158 | 3300013104 | Ga0157370_10005329 | Ga0157370_1000532914 | 168 |
| 159 | 3300013105 | Ga0157369_10027331 | Ga0157369_100273312 | 168 |
| 160 | 3300013296 | Ga0157374_10893854 | Ga0157374_108938541 | 168 |
| 161 | 3300013297 | Ga0157378_10006316 | Ga0157378_100063162 | 168 |
| 162 | 3300013307 | Ga0157372_10002332 | Ga0157372_100023325 | 168 |
| 163 | 3300013307 | Ga0157372_10023290 | Ga0157372_100232906 | 168 |
| 164 | 3300014325 | Ga0163163_10303744 | Ga0163163_103037442 | 168 |
| 165 | 3300014326 | Ga0157380_10095826 | Ga0157380_100958263 | 168 |
| 166 | 3300017792 | Ga0163161_10071098 | Ga0163161_100710983 | 168 |
| 167 | 3300025904 | Ga0207647_10006690 | Ga0207647_100066905 | 168 |
| 168 | 3300025907 | Ga0207645_10442261 | Ga0207645_104422612 | 168 |
| 169 | 3300025913 | Ga0207695_10001230 | Ga0207695_1000123043 | 168 |
| 170 | 3300025913 | Ga0207695_10010595 | Ga0207695_100105957 | 168 |
| 171 | 3300025914 | Ga0207671_10063777 | Ga0207671_100637773 | 168 |
| 172 | 3300025918 | Ga0207662_10566324 | Ga0207662_105663241 | 168 |
| 173 | 3300025919 | Ga0207657_10526935 | Ga0207657_105269351 | 168 |
| 174 | 3300025923 | Ga0207681_10112954 | Ga0207681_101129542 | 168 |
| 175 | 3300025924 | Ga0207694_10345824 | Ga0207694_103458242 | 168 |
| 176 | 3300025925 | Ga0207650_10184171 | Ga0207650_101841713 | 168 |
| 177 | 3300025926 | Ga0207659_10147520 | Ga0207659_101475203 | 168 |
| 178 | 3300025937 | Ga0207669_10413314 | Ga0207669_104133142 | 168 |
| 179 | 3300025940 | Ga0207691_10321301 | Ga0207691_103213012 | 168 |
| 180 | 3300025949 | Ga0207667_10000098 | Ga0207667_10000098108 | 168 |
| 181 | 3300025960 | Ga0207651_10366333 | Ga0207651_103663332 | 168 |
| 182 | 3300025981 | Ga0207640_10131713 | Ga0207640_101317132 | 168 |
| 183 | 3300026041 | Ga0207639_10083313 | Ga0207639_100833132 | 168 |
| 184 | 3300026041 | Ga0207639_10150844 | Ga0207639_101508441 | 168 |
| 185 | 3300026041 | Ga0207639_10215795 | Ga0207639_102157952 | 168 |
| 186 | 3300026116 | Ga0207674_10000969 | Ga0207674_1000096939 | 168 |
| 187 | 3300026116 | Ga0207674_10660554 | Ga0207674_106605542 | 168 |
| 188 | 3300031711 | Ga0265314_10132806 | Ga0265314_101328062 | 168 |
| 189 | 3300031730 | Ga0307516_10003458 | Ga0307516_100034582 | 168 |
| 190 | 3300031730 | Ga0307516_10241696 | Ga0307516_102416962 | 168 |
| 191 | 3300031824 | Ga0307413_10406011 | Ga0307413_104060112 | 168 |
| 192 | 3300031852 | Ga0307410_10358699 | Ga0307410_103586992 | 168 |
| 193 | 3300032002 | Ga0307416_101483349 | Ga0307416_1014833491 | 168 |
| 194 | 3300032004 | Ga0307414_11313697 | Ga0307414_113136971 | 168 |
| 195 | 3300032005 | Ga0307411_10860403 | Ga0307411_108604032 | 168 |
| 196 | 3300032126 | Ga0307415_101102587 | Ga0307415_1011025871 | 168 |
| 197 | 3300046460 | Ga0495638_0009863 | Ga0495638_0009863_1756_2277 | 168 |
| 198 | 3300048918 | Ga0496115_0744153 | Ga0496115_0744153_177_689 | 168 |
| 199 | 3300053093 | Ga0500651_0453384 | Ga0500651_0453384_135_656 | 168 |
| 200 | 3300053133 | Ga0500655_080816 | Ga0500655_080816_92_613 | 168 |
| 201 | 3300053139 | Ga0500568_0000080 | Ga0500568_0000080_64316_64825 | 168 |
| 202 | 3300053148 | Ga0500590_214684 | Ga0500590_214684_203_724 | 168 |
| 203 | 3300053178 | Ga0500637_0215991 | Ga0500637_0215991_431_952 | 168 |
| 204 | iso_pu_bacteria | 2818991444 | 2819585677 | 168 |
| 205 | 3300002077 | JGI24744J21845_10006042 | JGI24744J21845_100060424 | 169 |
| 206 | 3300003316 | rootH1_10044617 | rootH1_100446177 | 169 |
| 207 | 3300003320 | rootH2_10076327 | rootH2_100763277 | 169 |
| 208 | 3300003323 | rootH1_10016772 | rootH1_1001677214 | 169 |
| 209 | 3300005288 | Ga0065714_10137470 | Ga0065714_101374702 | 169 |
| 210 | 3300005328 | Ga0070676_10009154 | Ga0070676_100091542 | 169 |
| 211 | 3300005329 | Ga0070683_100002314 | Ga0070683_1000023149 | 169 |
| 212 | 3300005329 | Ga0070683_101251328 | Ga0070683_1012513281 | 169 |
| 213 | 3300005330 | Ga0070690_100024106 | Ga0070690_1000241062 | 169 |
| 214 | 3300005334 | Ga0068869_100005175 | Ga0068869_1000051756 | 169 |
| 215 | 3300005334 | Ga0068869_100008029 | Ga0068869_1000080292 | 169 |
| 216 | 3300005334 | Ga0068869_101105172 | Ga0068869_1011051721 | 169 |
| 217 | 3300005335 | Ga0070666_10026971 | Ga0070666_100269712 | 169 |
| 218 | 3300005335 | Ga0070666_10318735 | Ga0070666_103187352 | 169 |
| 219 | 3300005337 | Ga0070682_100049312 | Ga0070682_1000493121 | 169 |
| 220 | 3300005338 | Ga0068868_100004324 | Ga0068868_1000043244 | 169 |
| 221 | 3300005338 | Ga0068868_100196500 | Ga0068868_1001965002 | 169 |
| 222 | 3300005339 | Ga0070660_100390403 | Ga0070660_1003904032 | 169 |
| 223 | 3300005340 | Ga0070689_100021006 | Ga0070689_1000210066 | 169 |
| 224 | 3300005340 | Ga0070689_100033467 | Ga0070689_1000334674 | 169 |
| 225 | 3300005341 | Ga0070691_10011739 | Ga0070691_100117392 | 169 |
| 226 | 3300005344 | Ga0070661_100013425 | Ga0070661_1000134258 | 169 |
| 227 | 3300005353 | Ga0070669_100056017 | Ga0070669_1000560173 | 169 |
| 228 | 3300005353 | Ga0070669_100781067 | Ga0070669_1007810671 | 169 |
| 229 | 3300005355 | Ga0070671_100044015 | Ga0070671_1000440156 | 169 |
| 230 | 3300005355 | Ga0070671_100086837 | Ga0070671_1000868372 | 169 |
| 231 | 3300005364 | Ga0070673_100033496 | Ga0070673_1000334962 | 169 |
| 232 | 3300005364 | Ga0070673_100049643 | Ga0070673_1000496435 | 169 |
| 233 | 3300005365 | Ga0070688_100039108 | Ga0070688_1000391082 | 169 |
| 234 | 3300005365 | Ga0070688_100081027 | Ga0070688_1000810273 | 169 |
| 235 | 3300005366 | Ga0070659_100186571 | Ga0070659_1001865712 | 169 |
| 236 | 3300005440 | Ga0070705_100922302 | Ga0070705_1009223021 | 169 |
| 237 | 3300005456 | Ga0070678_100007858 | Ga0070678_1000078582 | 169 |
| 238 | 3300005457 | Ga0070662_100020419 | Ga0070662_1000204192 | 169 |
| 239 | 3300005457 | Ga0070662_100039935 | Ga0070662_1000399352 | 169 |
| 240 | 3300005457 | Ga0070662_100195335 | Ga0070662_1001953352 | 169 |
| 241 | 3300005459 | Ga0068867_100028644 | Ga0068867_1000286445 | 169 |
| 242 | 3300005459 | Ga0068867_100040234 | Ga0068867_1000402342 | 169 |
| 243 | 3300005459 | Ga0068867_100637137 | Ga0068867_1006371372 | 169 |
| 244 | 3300005466 | Ga0070685_10050637 | Ga0070685_100506373 | 169 |
| 245 | 3300005535 | Ga0070684_100000823 | Ga0070684_1000008238 | 169 |
| 246 | 3300005535 | Ga0070684_100002886 | Ga0070684_1000028866 | 169 |
| 247 | 3300005535 | Ga0070684_100738471 | Ga0070684_1007384711 | 169 |
| 248 | 3300005535 | Ga0070684_100754353 | Ga0070684_1007543532 | 169 |
| 249 | 3300005539 | Ga0068853_100007046 | Ga0068853_1000070467 | 169 |
| 250 | 3300005539 | Ga0068853_100208699 | Ga0068853_1002086992 | 169 |
| 251 | 3300005539 | Ga0068853_100692170 | Ga0068853_1006921701 | 169 |
| 252 | 3300005544 | Ga0070686_100192730 | Ga0070686_1001927302 | 169 |
| 253 | 3300005544 | Ga0070686_100242940 | Ga0070686_1002429402 | 169 |
| 254 | 3300005548 | Ga0070665_100000014 | Ga0070665_100000014200 | 169 |
| 255 | 3300005548 | Ga0070665_100062566 | Ga0070665_1000625663 | 169 |
| 256 | 3300005548 | Ga0070665_100076597 | Ga0070665_1000765972 | 169 |
| 257 | 3300005548 | Ga0070665_100448306 | Ga0070665_1004483061 | 169 |
| 258 | 3300005563 | Ga0068855_100014225 | Ga0068855_10001422513 | 169 |
| 259 | 3300005563 | Ga0068855_100024083 | Ga0068855_1000240831 | 169 |
| 260 | 3300005564 | Ga0070664_100009426 | Ga0070664_1000094265 | 169 |
| 261 | 3300005564 | Ga0070664_100019327 | Ga0070664_1000193274 | 169 |
| 262 | 3300005564 | Ga0070664_100026791 | Ga0070664_1000267917 | 169 |
| 263 | 3300005564 | Ga0070664_100094916 | Ga0070664_1000949161 | 169 |
| 264 | 3300005564 | Ga0070664_100368151 | Ga0070664_1003681512 | 169 |
| 265 | 3300005564 | Ga0070664_100520085 | Ga0070664_1005200852 | 169 |
| 266 | 3300005577 | Ga0068857_100005247 | Ga0068857_1000052472 | 169 |
| 267 | 3300005577 | Ga0068857_100129622 | Ga0068857_1001296222 | 169 |
| 268 | 3300005577 | Ga0068857_100268357 | Ga0068857_1002683572 | 169 |
| 269 | 3300005578 | Ga0068854_100179882 | Ga0068854_1001798822 | 169 |
| 270 | 3300005614 | Ga0068856_100204401 | Ga0068856_1002044012 | 169 |
| 271 | 3300005614 | Ga0068856_101136185 | Ga0068856_1011361852 | 169 |
| 272 | 3300005616 | Ga0068852_100407428 | Ga0068852_1004074282 | 169 |
| 273 | 3300005617 | Ga0068859_100072317 | Ga0068859_1000723172 | 169 |
| 274 | 3300005618 | Ga0068864_100062524 | Ga0068864_1000625242 | 169 |
| 275 | 3300005618 | Ga0068864_100102035 | Ga0068864_1001020352 | 169 |
| 276 | 3300005618 | Ga0068864_100701604 | Ga0068864_1007016042 | 169 |
| 277 | 3300005718 | Ga0068866_10027049 | Ga0068866_100270493 | 169 |
| 278 | 3300005841 | Ga0068863_100111170 | Ga0068863_1001111702 | 169 |
| 279 | 3300005841 | Ga0068863_100469196 | Ga0068863_1004691962 | 169 |
| 280 | 3300005842 | Ga0068858_100033772 | Ga0068858_1000337723 | 169 |
| 281 | 3300005842 | Ga0068858_100100576 | Ga0068858_1001005763 | 169 |
| 282 | 3300005842 | Ga0068858_100235320 | Ga0068858_1002353202 | 169 |
| 283 | 3300005842 | Ga0068858_101123700 | Ga0068858_1011237001 | 169 |
| 284 | 3300005843 | Ga0068860_100000061 | Ga0068860_1000000614 | 169 |
| 285 | 3300005844 | Ga0068862_100180767 | Ga0068862_1001807672 | 169 |
| 286 | 3300005983 | Ga0081540_1002949 | Ga0081540_100294914 | 169 |
| 287 | 3300006195 | Ga0075366_10018940 | Ga0075366_100189403 | 169 |
| 288 | 3300006195 | Ga0075366_10239789 | Ga0075366_102397892 | 169 |
| 289 | 3300006237 | Ga0097621_100049304 | Ga0097621_1000493045 | 169 |
| 290 | 3300006237 | Ga0097621_100257538 | Ga0097621_1002575382 | 169 |
| 291 | 3300006237 | Ga0097621_100855367 | Ga0097621_1008553671 | 169 |
| 292 | 3300006358 | Ga0068871_100045959 | Ga0068871_1000459592 | 169 |
| 293 | 3300006358 | Ga0068871_100114713 | Ga0068871_1001147133 | 169 |
| 294 | 3300006358 | Ga0068871_100290087 | Ga0068871_1002900872 | 169 |
| 295 | 3300006358 | Ga0068871_100500703 | Ga0068871_1005007032 | 169 |
| 296 | 3300006871 | Ga0075434_101518647 | Ga0075434_1015186471 | 169 |
| 297 | 3300006881 | Ga0068865_100160502 | Ga0068865_1001605022 | 169 |
| 298 | 3300006931 | Ga0097620_100072323 | Ga0097620_1000723232 | 169 |
| 299 | 3300006931 | Ga0097620_100303654 | Ga0097620_1003036542 | 169 |
| 300 | 3300009011 | Ga0105251_10401389 | Ga0105251_104013891 | 169 |
| 301 | 3300009093 | Ga0105240_10026787 | Ga0105240_100267876 | 169 |
| 302 | 3300009093 | Ga0105240_10075380 | Ga0105240_100753802 | 169 |
| 303 | 3300009093 | Ga0105240_10218061 | Ga0105240_102180612 | 169 |
| 304 | 3300009094 | Ga0111539_10485090 | Ga0111539_104850901 | 169 |
| 305 | 3300009147 | Ga0114129_10353492 | Ga0114129_103534922 | 169 |
| 306 | 3300009174 | Ga0105241_10127807 | Ga0105241_101278073 | 169 |
| 307 | 3300009174 | Ga0105241_10131163 | Ga0105241_101311632 | 169 |
| 308 | 3300009174 | Ga0105241_10195624 | Ga0105241_101956242 | 169 |
| 309 | 3300009174 | Ga0105241_10470012 | Ga0105241_104700122 | 169 |
| 310 | 3300009174 | Ga0105241_10735234 | Ga0105241_107352342 | 169 |
| 311 | 3300009176 | Ga0105242_11147415 | Ga0105242_111474152 | 169 |
| 312 | 3300009177 | Ga0105248_10173092 | Ga0105248_101730923 | 169 |
| 313 | 3300009177 | Ga0105248_10978259 | Ga0105248_109782592 | 169 |
| 314 | 3300009545 | Ga0105237_10000453 | Ga0105237_1000045353 | 169 |
| 315 | 3300009545 | Ga0105237_10023637 | Ga0105237_100236373 | 169 |
| 316 | 3300009551 | Ga0105238_10194684 | Ga0105238_101946842 | 169 |
| 317 | 3300009553 | Ga0105249_10010748 | Ga0105249_100107482 | 169 |
| 318 | 3300009553 | Ga0105249_10223534 | Ga0105249_102235342 | 169 |
| 319 | 3300010375 | Ga0105239_10000019 | Ga0105239_1000001961 | 169 |
| 320 | 3300010375 | Ga0105239_10012695 | Ga0105239_100126952 | 169 |
| 321 | 3300010375 | Ga0105239_10046242 | Ga0105239_100462422 | 169 |
| 322 | 3300010375 | Ga0105239_11084666 | Ga0105239_110846662 | 169 |
| 323 | 3300011119 | Ga0105246_10391604 | Ga0105246_103916042 | 169 |
| 324 | 3300013100 | Ga0157373_10072818 | Ga0157373_100728182 | 169 |
| 325 | 3300013100 | Ga0157373_10347797 | Ga0157373_103477972 | 169 |
| 326 | 3300013104 | Ga0157370_10413071 | Ga0157370_104130711 | 169 |
| 327 | 3300013296 | Ga0157374_10000011 | Ga0157374_10000011348 | 169 |
| 328 | 3300013296 | Ga0157374_10003407 | Ga0157374_1000340715 | 169 |
| 329 | 3300013296 | Ga0157374_10094013 | Ga0157374_100940133 | 169 |
| 330 | 3300013297 | Ga0157378_10309789 | Ga0157378_103097892 | 169 |
| 331 | 3300013306 | Ga0163162_10010130 | Ga0163162_1001013013 | 169 |
| 332 | 3300013306 | Ga0163162_10161533 | Ga0163162_101615332 | 169 |
| 333 | 3300013307 | Ga0157372_10007698 | Ga0157372_1000769811 | 169 |
| 334 | 3300013307 | Ga0157372_10190800 | Ga0157372_101908003 | 169 |
| 335 | 3300013307 | Ga0157372_10936892 | Ga0157372_109368921 | 169 |
| 336 | 3300013307 | Ga0157372_11135030 | Ga0157372_111350302 | 169 |
| 337 | 3300013308 | Ga0157375_10034814 | Ga0157375_100348145 | 169 |
| 338 | 3300013308 | Ga0157375_10160091 | Ga0157375_101600912 | 169 |
| 339 | 3300013308 | Ga0157375_10378034 | Ga0157375_103780342 | 169 |
| 340 | 3300013308 | Ga0157375_10387368 | Ga0157375_103873683 | 169 |
| 341 | 3300014325 | Ga0163163_10001351 | Ga0163163_1000135114 | 169 |
| 342 | 3300014325 | Ga0163163_10047872 | Ga0163163_100478722 | 169 |
| 343 | 3300014325 | Ga0163163_10850863 | Ga0163163_108508632 | 169 |
| 344 | 3300014326 | Ga0157380_10160068 | Ga0157380_101600683 | 169 |
| 345 | 3300014326 | Ga0157380_10407296 | Ga0157380_104072962 | 169 |
| 346 | 3300014745 | Ga0157377_10012474 | Ga0157377_100124743 | 169 |
| 347 | 3300014745 | Ga0157377_10215119 | Ga0157377_102151192 | 169 |
| 348 | 3300014745 | Ga0157377_10633331 | Ga0157377_106333312 | 169 |
| 349 | 3300014968 | Ga0157379_10107120 | Ga0157379_101071202 | 169 |
| 350 | 3300014968 | Ga0157379_10117040 | Ga0157379_101170403 | 169 |
| 351 | 3300014969 | Ga0157376_10011577 | Ga0157376_100115776 | 169 |
| 352 | 3300014969 | Ga0157376_10013360 | Ga0157376_100133604 | 169 |
| 353 | 3300014969 | Ga0157376_10038551 | Ga0157376_100385512 | 169 |
| 354 | 3300014969 | Ga0157376_10208176 | Ga0157376_102081762 | 169 |
| 355 | 3300017792 | Ga0163161_10060640 | Ga0163161_100606402 | 169 |
| 356 | 3300025242 | Ga0209258_112036 | Ga0209258_1120361 | 169 |
| 357 | 3300025246 | Ga0209646_1000921 | Ga0209646_10009219 | 169 |
| 358 | 3300025315 | Ga0207697_10144527 | Ga0207697_101445271 | 169 |
| 359 | 3300025899 | Ga0207642_10144822 | Ga0207642_101448222 | 169 |
| 360 | 3300025901 | Ga0207688_10320785 | Ga0207688_103207851 | 169 |
| 361 | 3300025903 | Ga0207680_10154004 | Ga0207680_101540043 | 169 |
| 362 | 3300025904 | Ga0207647_10058415 | Ga0207647_100584154 | 169 |
| 363 | 3300025907 | Ga0207645_10008702 | Ga0207645_100087022 | 169 |
| 364 | 3300025911 | Ga0207654_10185651 | Ga0207654_101856512 | 169 |
| 365 | 3300025911 | Ga0207654_10203308 | Ga0207654_102033082 | 169 |
| 366 | 3300025913 | Ga0207695_10038750 | Ga0207695_100387504 | 169 |
| 367 | 3300025913 | Ga0207695_10560677 | Ga0207695_105606772 | 169 |
| 368 | 3300025914 | Ga0207671_10000311 | Ga0207671_1000031124 | 169 |
| 369 | 3300025914 | Ga0207671_10016200 | Ga0207671_100162005 | 169 |
| 370 | 3300025919 | Ga0207657_10043217 | Ga0207657_100432172 | 169 |
| 371 | 3300025919 | Ga0207657_10142429 | Ga0207657_101424292 | 169 |
| 372 | 3300025920 | Ga0207649_10110237 | Ga0207649_101102372 | 169 |
| 373 | 3300025923 | Ga0207681_10178699 | Ga0207681_101786992 | 169 |
| 374 | 3300025924 | Ga0207694_10060474 | Ga0207694_100604742 | 169 |
| 375 | 3300025925 | Ga0207650_10132445 | Ga0207650_101324452 | 169 |
| 376 | 3300025925 | Ga0207650_11375286 | Ga0207650_113752861 | 169 |
| 377 | 3300025931 | Ga0207644_10670155 | Ga0207644_106701551 | 169 |
| 378 | 3300025933 | Ga0207706_10009283 | Ga0207706_100092832 | 169 |
| 379 | 3300025933 | Ga0207706_10034680 | Ga0207706_100346806 | 169 |
| 380 | 3300025934 | Ga0207686_10032197 | Ga0207686_100321972 | 169 |
| 381 | 3300025936 | Ga0207670_10093564 | Ga0207670_100935642 | 169 |
| 382 | 3300025939 | Ga0207665_10964611 | Ga0207665_109646111 | 169 |
| 383 | 3300025940 | Ga0207691_10147063 | Ga0207691_101470632 | 169 |
| 384 | 3300025941 | Ga0207711_10156808 | Ga0207711_101568082 | 169 |
| 385 | 3300025942 | Ga0207689_10019558 | Ga0207689_100195584 | 169 |
| 386 | 3300025942 | Ga0207689_10155883 | Ga0207689_101558832 | 169 |
| 387 | 3300025944 | Ga0207661_10019604 | Ga0207661_100196046 | 169 |
| 388 | 3300025944 | Ga0207661_10133031 | Ga0207661_101330312 | 169 |
| 389 | 3300025944 | Ga0207661_11403932 | Ga0207661_114039321 | 169 |
| 390 | 3300025945 | Ga0207679_10001675 | Ga0207679_100016758 | 169 |
| 391 | 3300025945 | Ga0207679_10032297 | Ga0207679_100322972 | 169 |
| 392 | 3300025949 | Ga0207667_10096038 | Ga0207667_100960383 | 169 |
| 393 | 3300025981 | Ga0207640_10337458 | Ga0207640_103374582 | 169 |
| 394 | 3300025986 | Ga0207658_10031002 | Ga0207658_100310022 | 169 |
| 395 | 3300025986 | Ga0207658_10196180 | Ga0207658_101961802 | 169 |
| 396 | 3300026035 | Ga0207703_11110466 | Ga0207703_111104662 | 169 |
| 397 | 3300026041 | Ga0207639_10194763 | Ga0207639_101947632 | 169 |
| 398 | 3300026041 | Ga0207639_10355955 | Ga0207639_103559552 | 169 |
| 399 | 3300026041 | Ga0207639_10712315 | Ga0207639_107123152 | 169 |
| 400 | 3300026067 | Ga0207678_10081466 | Ga0207678_100814662 | 169 |
| 401 | 3300026078 | Ga0207702_10522585 | Ga0207702_105225852 | 169 |
| 402 | 3300026088 | Ga0207641_10170700 | Ga0207641_101707001 | 169 |
| 403 | 3300026088 | Ga0207641_10374416 | Ga0207641_103744162 | 169 |
| 404 | 3300026089 | Ga0207648_10012780 | Ga0207648_100127804 | 169 |
| 405 | 3300026089 | Ga0207648_10023408 | Ga0207648_100234084 | 169 |
| 406 | 3300026089 | Ga0207648_10248184 | Ga0207648_102481842 | 169 |
| 407 | 3300026095 | Ga0207676_10101172 | Ga0207676_101011723 | 169 |
| 408 | 3300026095 | Ga0207676_10172812 | Ga0207676_101728122 | 169 |
| 409 | 3300026116 | Ga0207674_10014175 | Ga0207674_100141755 | 169 |
| 410 | 3300026116 | Ga0207674_10014702 | Ga0207674_100147024 | 169 |
| 411 | 3300026116 | Ga0207674_10025103 | Ga0207674_100251036 | 169 |
| 412 | 3300026116 | Ga0207674_10185220 | Ga0207674_101852202 | 169 |
| 413 | 3300026118 | Ga0207675_100266147 | Ga0207675_1002661472 | 169 |
| 414 | 3300026118 | Ga0207675_101435595 | Ga0207675_1014355951 | 169 |
| 415 | 3300026121 | Ga0207683_10004664 | Ga0207683_100046642 | 169 |
| 416 | 3300026142 | Ga0207698_10052541 | Ga0207698_100525412 | 169 |
| 417 | 3300026142 | Ga0207698_10174898 | Ga0207698_101748982 | 169 |
| 418 | 3300028379 | Ga0268266_10008277 | Ga0268266_100082772 | 169 |
| 419 | 3300028379 | Ga0268266_10062165 | Ga0268266_100621655 | 169 |
| 420 | 3300028379 | Ga0268266_10094525 | Ga0268266_100945253 | 169 |
| 421 | 3300028380 | Ga0268265_10595482 | Ga0268265_105954822 | 169 |
| 422 | 3300028381 | Ga0268264_10000079 | Ga0268264_10000079178 | 169 |
| 423 | 3300028786 | Ga0307517_10327950 | Ga0307517_103279502 | 169 |
| 424 | 3300030521 | Ga0307511_10022566 | Ga0307511_100225665 | 169 |
| 425 | 3300031456 | Ga0307513_10178127 | Ga0307513_101781273 | 169 |
| 426 | 3300032126 | Ga0307415_100755866 | Ga0307415_1007558662 | 169 |
| 427 | 3300035086 | Ga0373934_0198739 | Ga0373934_0198739_238_750 | 169 |
| 428 | 3300035117 | Ga0373953_0080711 | Ga0373953_0080711_94_606 | 169 |
| 429 | 3300035118 | Ga0373954_0166526 | Ga0373954_0166526_507_1019 | 169 |
| 430 | 3300035172 | Ga0373955_0070860 | Ga0373955_0070860_1337_1849 | 169 |
| 431 | 3300035410 | Ga0373924_0133640 | Ga0373924_0133640_302_814 | 169 |
| 432 | 3300035692 | Ga0373935_0138643 | Ga0373935_0138643_506_1018 | 169 |
| 433 | 3300036401 | Ga0373937_0040867 | Ga0373937_0040867_323_835 | 169 |
| 434 | 3300037068 | Ga0373925_0119354 | Ga0373925_0119354_784_1296 | 169 |
| 435 | 3300041507 | Ga0451851_0296872 | Ga0451851_0296872_44_553 | 169 |
| 436 | 3300041509 | Ga0451843_1769404 | Ga0451843_1769404_369_881 | 169 |
| 437 | 3300042007 | Ga0439449_0008071 | Ga0439449_0008071_640_1149 | 169 |
| 438 | 3300042015 | Ga0439462_0117773 | Ga0439462_0117773_24_533 | 169 |
| 439 | 3300042532 | Ga0450893_0039269 | Ga0450893_0039269_117_626 | 169 |
| 440 | 3300044656 | Ga0466969_0048045 | Ga0466969_0048045_1510_2019 | 169 |
| 441 | 3300044658 | Ga0466972_0000082 | Ga0466972_0000082_84315_84830 | 169 |
| 442 | 3300044658 | Ga0466972_0024449 | Ga0466972_0024449_1608_2168 | 169 |
| 443 | 3300044658 | Ga0466972_0031023 | Ga0466972_0031023_432_950 | 169 |
| 444 | 3300044683 | Ga0466965_0126383 | Ga0466965_0126383_244_753 | 169 |
| 445 | 3300044684 | Ga0466966_0165376 | Ga0466966_0165376_114_626 | 169 |
| 446 | 3300044712 | Ga0453684_0890069 | Ga0453684_0890069_427_939 | 169 |
| 447 | 3300044735 | Ga0466968_0046866 | Ga0466968_0046866_774_1292 | 169 |
| 448 | 3300044842 | Ga0466957_0000381 | Ga0466957_0000381_9887_10402 | 169 |
| 449 | 3300044842 | Ga0466957_0006481 | Ga0466957_0006481_4350_4865 | 169 |
| 450 | 3300046454 | Ga0495592_0374909 | Ga0495592_0374909_213_725 | 169 |
| 451 | 3300046459 | Ga0495629_0099643 | Ga0495629_0099643_224_736 | 169 |
| 452 | 3300046463 | Ga0495653_0292053 | Ga0495653_0292053_62_574 | 169 |
| 453 | 3300046477 | Ga0495664_0284396 | Ga0495664_0284396_272_784 | 169 |
| 454 | 3300046511 | Ga0495608_0026304 | Ga0495608_0026304_3362_3874 | 169 |
| 455 | 3300046517 | Ga0495630_0146876 | Ga0495630_0146876_1087_1599 | 169 |
| 456 | 3300046524 | Ga0495648_0001246 | Ga0495648_0001246_1942_2457 | 169 |
| 457 | 3300046529 | Ga0495652_0042704 | Ga0495652_0042704_188_700 | 169 |
| 458 | 3300046536 | Ga0495587_0047268 | Ga0495587_0047268_213_725 | 169 |
| 459 | 3300046559 | Ga0495667_0213350 | Ga0495667_0213350_418_930 | 169 |
| 460 | 3300046616 | Ga0495668_0000202 | Ga0495668_0000202_2542_3051 | 169 |
| 461 | 3300046642 | Ga0495634_0375114 | Ga0495634_0375114_152_664 | 169 |
| 462 | 3300046642 | Ga0495634_0511427 | Ga0495634_0511427_73_585 | 169 |
| 463 | 3300046648 | Ga0495611_0001026 | Ga0495611_0001026_9886_10398 | 169 |
| 464 | 3300046663 | Ga0495635_0031039 | Ga0495635_0031039_2957_3469 | 169 |
| 465 | 3300046684 | Ga0495669_0291642 | Ga0495669_0291642_216_728 | 169 |
| 466 | 3300046694 | Ga0495649_0451804 | Ga0495649_0451804_110_625 | 169 |
| 467 | 3300046809 | Ga0495600_0018974 | Ga0495600_0018974_674_1186 | 169 |
| 468 | 3300047317 | Ga0495604_0071896 | Ga0495604_0071896_975_1487 | 169 |
| 469 | 3300047319 | Ga0495674_0218995 | Ga0495674_0218995_984_1496 | 169 |
| 470 | 3300047321 | Ga0495676_0848344 | Ga0495676_0848344_45_557 | 169 |
| 471 | 3300047443 | Ga0495687_000886 | Ga0495687_000886_29737_30252 | 169 |
| 472 | 3300047471 | Ga0495684_0141387 | Ga0495684_0141387_586_1098 | 169 |
| 473 | 3300047472 | Ga0495686_0265761 | Ga0495686_0265761_30_542 | 169 |
| 474 | 3300048903 | Ga0496100_0550662 | Ga0496100_0550662_336_848 | 169 |
| 475 | 3300048904 | Ga0496101_0042227 | Ga0496101_0042227_2060_2572 | 169 |
| 476 | 3300048908 | Ga0496105_0366662 | Ga0496105_0366662_59_571 | 169 |
| 477 | 3300048909 | Ga0496106_0181322 | Ga0496106_0181322_772_1284 | 169 |
| 478 | 3300048912 | Ga0496109_0355081 | Ga0496109_0355081_849_1361 | 169 |
| 479 | 3300048913 | Ga0496110_0459186 | Ga0496110_0459186_620_1132 | 169 |
| 480 | 3300048917 | Ga0496114_0050742 | Ga0496114_0050742_194_706 | 169 |
| 481 | 3300049521 | Ga0501298_108037 | Ga0501298_108037_62_574 | 169 |
| 482 | 3300049574 | Ga0501038_0751902 | Ga0501038_0751902_23_532 | 169 |
| 483 | 3300049581 | Ga0501047_0258382 | Ga0501047_0258382_421_939 | 169 |
| 484 | 3300049581 | Ga0501047_0259607 | Ga0501047_0259607_935_1444 | 169 |
| 485 | 3300049652 | Ga0501202_001707 | Ga0501202_001707_2407_2919 | 169 |
| 486 | 3300049661 | Ga0501217_026917 | Ga0501217_026917_334_846 | 169 |
| 487 | 3300049663 | Ga0501223_009110 | Ga0501223_009110_913_1425 | 169 |
| 488 | 3300049670 | Ga0501236_045667 | Ga0501236_045667_32_544 | 169 |
| 489 | 3300049688 | Ga0501259_090520 | Ga0501259_090520_135_647 | 169 |
| 490 | 3300049705 | Ga0501225_0001644 | Ga0501225_0001644_2434_2943 | 169 |
| 491 | 3300049770 | Ga0501273_064702 | Ga0501273_064702_23_535 | 169 |
| 492 | 3300049823 | Ga0501044_0057853 | Ga0501044_0057853_1705_2214 | 169 |
| 493 | 3300049823 | Ga0501044_0249915 | Ga0501044_0249915_813_1322 | 169 |
| 494 | 3300050493 | nmdc:mga0k408_152717_c1 | nmdc:mga0k408_152717_c1_113_622 | 169 |
| 495 | 3300050493 | nmdc:mga0k408_347611_c1 | nmdc:mga0k408_347611_c1_266_781 | 169 |
| 496 | 3300050493 | nmdc:mga0k408_365215_c1 | nmdc:mga0k408_365215_c1_332_841 | 169 |
| 497 | 3300050493 | nmdc:mga0k408_83869_c1 | nmdc:mga0k408_83869_c1_683_1198 | 169 |
| 498 | 3300050507 | nmdc:mga05p37_278481_c1 | nmdc:mga05p37_278481_c1_443_952 | 169 |
| 499 | 3300053085 | Ga0495619_0293753 | Ga0495619_0293753_599_1111 | 169 |
| 500 | 3300053086 | Ga0500578_0000063 | Ga0500578_0000063_63546_64055 | 169 |
| 501 | 3300053086 | Ga0500578_0234069 | Ga0500578_0234069_168_683 | 169 |
| 502 | 3300053088 | Ga0500644_0029590 | Ga0500644_0029590_209_724 | 169 |
| 503 | 3300053092 | Ga0500583_0000076 | Ga0500583_0000076_8929_9444 | 169 |
| 504 | 3300053092 | Ga0500583_0011401 | Ga0500583_0011401_1872_2384 | 169 |
| 505 | 3300053098 | Ga0500650_0106245 | Ga0500650_0106245_712_1227 | 169 |
| 506 | 3300053111 | Ga0500572_003120 | Ga0500572_003120_1861_2370 | 169 |
| 507 | 3300053130 | Ga0500642_0057945 | Ga0500642_0057945_901_1446 | 169 |
| 508 | 3300053153 | Ga0500616_0074910 | Ga0500616_0074910_627_1136 | 169 |
| 509 | 3300053156 | Ga0500622_0006674 | Ga0500622_0006674_1216_1731 | 169 |
| 510 | 3300053177 | Ga0500636_0278058 | Ga0500636_0278058_132_641 | 169 |
| 511 | 3300053726 | Ga0500584_075481 | Ga0500584_075481_868_1377 | 169 |
| 512 | 3300061719 | Ga0466962_0088987 | Ga0466962_0088987_679_1194 | 169 |
| 513 | 3300061719 | Ga0466962_0092693 | Ga0466962_0092693_499_1008 | 169 |
| 514 | 3300005290 | Ga0065712_10100308 | Ga0065712_101003082 | 170 |
| 515 | 3300005293 | Ga0065715_10282515 | Ga0065715_102825152 | 170 |
| 516 | 3300005327 | Ga0070658_10132184 | Ga0070658_101321843 | 170 |
| 517 | 3300005328 | Ga0070676_10613325 | Ga0070676_106133251 | 170 |
| 518 | 3300005328 | Ga0070676_11034973 | Ga0070676_110349731 | 170 |
| 519 | 3300005329 | Ga0070683_100454177 | Ga0070683_1004541772 | 170 |
| 520 | 3300005329 | Ga0070683_100861154 | Ga0070683_1008611542 | 170 |
| 521 | 3300005330 | Ga0070690_100435643 | Ga0070690_1004356432 | 170 |
| 522 | 3300005331 | Ga0070670_100586191 | Ga0070670_1005861912 | 170 |
| 523 | 3300005334 | Ga0068869_100085491 | Ga0068869_1000854912 | 170 |
| 524 | 3300005336 | Ga0070680_100010528 | Ga0070680_1000105283 | 170 |
| 525 | 3300005337 | Ga0070682_100000019 | Ga0070682_100000019148 | 170 |
| 526 | 3300005337 | Ga0070682_100174827 | Ga0070682_1001748273 | 170 |
| 527 | 3300005338 | Ga0068868_100361741 | Ga0068868_1003617412 | 170 |
| 528 | 3300005339 | Ga0070660_100095233 | Ga0070660_1000952332 | 170 |
| 529 | 3300005339 | Ga0070660_100100442 | Ga0070660_1001004422 | 170 |
| 530 | 3300005347 | Ga0070668_100039320 | Ga0070668_1000393202 | 170 |
| 531 | 3300005347 | Ga0070668_100480567 | Ga0070668_1004805672 | 170 |
| 532 | 3300005354 | Ga0070675_100041303 | Ga0070675_1000413032 | 170 |
| 533 | 3300005354 | Ga0070675_100138245 | Ga0070675_1001382452 | 170 |
| 534 | 3300005355 | Ga0070671_100623499 | Ga0070671_1006234992 | 170 |
| 535 | 3300005364 | Ga0070673_100758375 | Ga0070673_1007583752 | 170 |
| 536 | 3300005367 | Ga0070667_100204460 | Ga0070667_1002044602 | 170 |
| 537 | 3300005456 | Ga0070678_100045789 | Ga0070678_1000457892 | 170 |
| 538 | 3300005458 | Ga0070681_10058113 | Ga0070681_100581133 | 170 |
| 539 | 3300005459 | Ga0068867_100027314 | Ga0068867_1000273143 | 170 |
| 540 | 3300005459 | Ga0068867_100040241 | Ga0068867_1000402412 | 170 |
| 541 | 3300005459 | Ga0068867_100240266 | Ga0068867_1002402663 | 170 |
| 542 | 3300005530 | Ga0070679_100000836 | Ga0070679_10000083619 | 170 |
| 543 | 3300005539 | Ga0068853_100009327 | Ga0068853_1000093279 | 170 |
| 544 | 3300005539 | Ga0068853_100176747 | Ga0068853_1001767473 | 170 |
| 545 | 3300005539 | Ga0068853_100519382 | Ga0068853_1005193822 | 170 |
| 546 | 3300005543 | Ga0070672_100003727 | Ga0070672_1000037279 | 170 |
| 547 | 3300005543 | Ga0070672_100304310 | Ga0070672_1003043102 | 170 |
| 548 | 3300005563 | Ga0068855_100006600 | Ga0068855_1000066004 | 170 |
| 549 | 3300005563 | Ga0068855_100274060 | Ga0068855_1002740602 | 170 |
| 550 | 3300005564 | Ga0070664_100839215 | Ga0070664_1008392152 | 170 |
| 551 | 3300005564 | Ga0070664_101318769 | Ga0070664_1013187692 | 170 |
| 552 | 3300005577 | Ga0068857_100193365 | Ga0068857_1001933652 | 170 |
| 553 | 3300005578 | Ga0068854_100150217 | Ga0068854_1001502172 | 170 |
| 554 | 3300005578 | Ga0068854_100444154 | Ga0068854_1004441542 | 170 |
| 555 | 3300005616 | Ga0068852_100000744 | Ga0068852_10000074422 | 170 |
| 556 | 3300005616 | Ga0068852_100228781 | Ga0068852_1002287812 | 170 |
| 557 | 3300005616 | Ga0068852_102019073 | Ga0068852_1020190731 | 170 |
| 558 | 3300005617 | Ga0068859_100001537 | Ga0068859_1000015372 | 170 |
| 559 | 3300005617 | Ga0068859_100032421 | Ga0068859_1000324212 | 170 |
| 560 | 3300005617 | Ga0068859_100071945 | Ga0068859_1000719452 | 170 |
| 561 | 3300005617 | Ga0068859_100094528 | Ga0068859_1000945282 | 170 |
| 562 | 3300005618 | Ga0068864_100073120 | Ga0068864_1000731205 | 170 |
| 563 | 3300005719 | Ga0068861_100579650 | Ga0068861_1005796502 | 170 |
| 564 | 3300005834 | Ga0068851_10091568 | Ga0068851_100915682 | 170 |
| 565 | 3300005834 | Ga0068851_10566615 | Ga0068851_105666151 | 170 |
| 566 | 3300005841 | Ga0068863_100089444 | Ga0068863_1000894445 | 170 |
| 567 | 3300005841 | Ga0068863_100327519 | Ga0068863_1003275192 | 170 |
| 568 | 3300005843 | Ga0068860_100001341 | Ga0068860_1000013413 | 170 |
| 569 | 3300005843 | Ga0068860_100076623 | Ga0068860_1000766232 | 170 |
| 570 | 3300005844 | Ga0068862_100005164 | Ga0068862_1000051647 | 170 |
| 571 | 3300006237 | Ga0097621_100760265 | Ga0097621_1007602652 | 170 |
| 572 | 3300006353 | Ga0075370_10175079 | Ga0075370_101750791 | 170 |
| 573 | 3300006881 | Ga0068865_100575481 | Ga0068865_1005754812 | 170 |
| 574 | 3300006931 | Ga0097620_100001537 | Ga0097620_1000015372 | 170 |
| 575 | 3300006931 | Ga0097620_100032421 | Ga0097620_1000324212 | 170 |
| 576 | 3300006931 | Ga0097620_100071946 | Ga0097620_1000719462 | 170 |
| 577 | 3300006931 | Ga0097620_100094524 | Ga0097620_1000945242 | 170 |
| 578 | 3300009094 | Ga0111539_10011561 | Ga0111539_1001156111 | 170 |
| 579 | 3300009101 | Ga0105247_10848743 | Ga0105247_108487431 | 170 |
| 580 | 3300009174 | Ga0105241_10267849 | Ga0105241_102678492 | 170 |
| 581 | 3300009176 | Ga0105242_10430846 | Ga0105242_104308462 | 170 |
| 582 | 3300009553 | Ga0105249_10065163 | Ga0105249_100651632 | 170 |
| 583 | 3300009553 | Ga0105249_10139717 | Ga0105249_101397171 | 170 |
| 584 | 3300011119 | Ga0105246_10158024 | Ga0105246_101580243 | 170 |
| 585 | 3300013102 | Ga0157371_10006990 | Ga0157371_100069907 | 170 |
| 586 | 3300013104 | Ga0157370_10068911 | Ga0157370_100689115 | 170 |
| 587 | 3300013105 | Ga0157369_10172833 | Ga0157369_101728332 | 170 |
| 588 | 3300013105 | Ga0157369_10861572 | Ga0157369_108615722 | 170 |
| 589 | 3300013297 | Ga0157378_10746527 | Ga0157378_107465272 | 170 |
| 590 | 3300013306 | Ga0163162_10931612 | Ga0163162_109316122 | 170 |
| 591 | 3300013306 | Ga0163162_11698972 | Ga0163162_116989722 | 170 |
| 592 | 3300013307 | Ga0157372_10149086 | Ga0157372_101490862 | 170 |
| 593 | 3300013307 | Ga0157372_10154609 | Ga0157372_101546092 | 170 |
| 594 | 3300013307 | Ga0157372_10729009 | Ga0157372_107290092 | 170 |
| 595 | 3300013308 | Ga0157375_11127115 | Ga0157375_111271151 | 170 |
| 596 | 3300014325 | Ga0163163_10102798 | Ga0163163_101027983 | 170 |
| 597 | 3300014325 | Ga0163163_10242874 | Ga0163163_102428742 | 170 |
| 598 | 3300014325 | Ga0163163_10258236 | Ga0163163_102582362 | 170 |
| 599 | 3300014326 | Ga0157380_10012066 | Ga0157380_100120667 | 170 |
| 600 | 3300014326 | Ga0157380_10027166 | Ga0157380_100271662 | 170 |
| 601 | 3300014968 | Ga0157379_10081736 | Ga0157379_100817362 | 170 |
| 602 | 3300014969 | Ga0157376_10306843 | Ga0157376_103068432 | 170 |
| 603 | 3300025315 | Ga0207697_10062396 | Ga0207697_100623962 | 170 |
| 604 | 3300025321 | Ga0207656_10065045 | Ga0207656_100650453 | 170 |
| 605 | 3300025907 | Ga0207645_10088406 | Ga0207645_100884062 | 170 |
| 606 | 3300025909 | Ga0207705_10028584 | Ga0207705_100285846 | 170 |
| 607 | 3300025911 | Ga0207654_10313121 | Ga0207654_103131212 | 170 |
| 608 | 3300025917 | Ga0207660_10085252 | Ga0207660_100852522 | 170 |
| 609 | 3300025917 | Ga0207660_10099412 | Ga0207660_100994123 | 170 |
| 610 | 3300025919 | Ga0207657_10013163 | Ga0207657_100131633 | 170 |
| 611 | 3300025919 | Ga0207657_10102440 | Ga0207657_101024402 | 170 |
| 612 | 3300025921 | Ga0207652_10002760 | Ga0207652_1000276011 | 170 |
| 613 | 3300025926 | Ga0207659_10008828 | Ga0207659_100088288 | 170 |
| 614 | 3300025926 | Ga0207659_10087627 | Ga0207659_100876272 | 170 |
| 615 | 3300025936 | Ga0207670_11029954 | Ga0207670_110299541 | 170 |
| 616 | 3300025938 | Ga0207704_10680428 | Ga0207704_106804281 | 170 |
| 617 | 3300025940 | Ga0207691_10006189 | Ga0207691_100061896 | 170 |
| 618 | 3300025940 | Ga0207691_10332236 | Ga0207691_103322362 | 170 |
| 619 | 3300025942 | Ga0207689_10005993 | Ga0207689_100059932 | 170 |
| 620 | 3300025942 | Ga0207689_10084542 | Ga0207689_100845422 | 170 |
| 621 | 3300025949 | Ga0207667_10017026 | Ga0207667_100170267 | 170 |
| 622 | 3300025949 | Ga0207667_10062322 | Ga0207667_100623222 | 170 |
| 623 | 3300025949 | Ga0207667_10270369 | Ga0207667_102703693 | 170 |
| 624 | 3300025960 | Ga0207651_10280758 | Ga0207651_102807582 | 170 |
| 625 | 3300025961 | Ga0207712_10078276 | Ga0207712_100782762 | 170 |
| 626 | 3300025972 | Ga0207668_10210037 | Ga0207668_102100372 | 170 |
| 627 | 3300025972 | Ga0207668_10252966 | Ga0207668_102529662 | 170 |
| 628 | 3300025981 | Ga0207640_10412645 | Ga0207640_104126452 | 170 |
| 629 | 3300025981 | Ga0207640_10709979 | Ga0207640_107099792 | 170 |
| 630 | 3300025986 | Ga0207658_10391583 | Ga0207658_103915832 | 170 |
| 631 | 3300026023 | Ga0207677_11665365 | Ga0207677_116653651 | 170 |
| 632 | 3300026041 | Ga0207639_10015901 | Ga0207639_100159012 | 170 |
| 633 | 3300026041 | Ga0207639_10181205 | Ga0207639_101812052 | 170 |
| 634 | 3300026041 | Ga0207639_10336027 | Ga0207639_103360272 | 170 |
| 635 | 3300026078 | Ga0207702_10026609 | Ga0207702_100266094 | 170 |
| 636 | 3300026088 | Ga0207641_10149855 | Ga0207641_101498552 | 170 |
| 637 | 3300026088 | Ga0207641_10552503 | Ga0207641_105525032 | 170 |
| 638 | 3300026089 | Ga0207648_10044966 | Ga0207648_100449662 | 170 |
| 639 | 3300026118 | Ga0207675_100329200 | Ga0207675_1003292002 | 170 |
| 640 | 3300026121 | Ga0207683_10045803 | Ga0207683_100458037 | 170 |
| 641 | 3300026121 | Ga0207683_10100616 | Ga0207683_101006162 | 170 |
| 642 | 3300026142 | Ga0207698_10051034 | Ga0207698_100510342 | 170 |
| 643 | 3300027907 | Ga0207428_10130466 | Ga0207428_101304662 | 170 |
| 644 | 3300028380 | Ga0268265_10015032 | Ga0268265_100150323 | 170 |
| 645 | 3300028381 | Ga0268264_10007764 | Ga0268264_100077647 | 170 |
| 646 | 3300028381 | Ga0268264_10015227 | Ga0268264_100152273 | 170 |
| 647 | 3300028381 | Ga0268264_10258960 | Ga0268264_102589602 | 170 |
| 648 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012308 | 170 |
| 649 | 3300031251 | Ga0265327_10000013 | Ga0265327_10000013284 | 170 |
| 650 | 3300031649 | Ga0307514_10338550 | Ga0307514_103385501 | 170 |
| 651 | 3300032004 | Ga0307414_10074124 | Ga0307414_100741243 | 170 |
| 652 | 3300033180 | Ga0307510_10009446 | Ga0307510_100094462 | 170 |
| 653 | 3300033545 | Ga0316214_1038468 | Ga0316214_10384681 | 170 |
| 654 | 3300037312 | Ga0395899_0012303 | Ga0395899_0012303_4854_5366 | 170 |
| 655 | 3300037418 | Ga0395900_0015690 | Ga0395900_0015690_2051_2563 | 170 |
| 656 | 3300037466 | Ga0395898_0024421 | Ga0395898_0024421_4854_5366 | 170 |
| 657 | 3300038443 | Ga0395901_0004445 | Ga0395901_0004445_601_1113 | 170 |
| 658 | 3300041460 | Ga0451802_1207351 | Ga0451802_1207351_10_522 | 170 |
| 659 | 3300041509 | Ga0451843_0090240 | Ga0451843_0090240_67_579 | 170 |
| 660 | 3300042007 | Ga0439449_0187938 | Ga0439449_0187938_13_534 | 170 |
| 661 | 3300042134 | Ga0450898_009254 | Ga0450898_009254_804_1319 | 170 |
| 662 | 3300042184 | Ga0450908_056495 | Ga0450908_056495_89_604 | 170 |
| 663 | 3300042435 | Ga0439434_0037134 | Ga0439434_0037134_292_807 | 170 |
| 664 | 3300044673 | Ga0453683_0111624 | Ga0453683_0111624_524_1036 | 170 |
| 665 | 3300044712 | Ga0453684_0183866 | Ga0453684_0183866_1297_1809 | 170 |
| 666 | 3300045051 | Ga0451576_0381844 | Ga0451576_0381844_483_995 | 170 |
| 667 | 3300046471 | Ga0495650_0044451 | Ga0495650_0044451_960_1475 | 170 |
| 668 | 3300046507 | Ga0495606_0034998 | Ga0495606_0034998_2178_2714 | 170 |
| 669 | 3300046537 | Ga0495598_0090883 | Ga0495598_0090883_347_859 | 170 |
| 670 | 3300046660 | Ga0495625_0092176 | Ga0495625_0092176_1466_1978 | 170 |
| 671 | 3300046694 | Ga0495649_0431637 | Ga0495649_0431637_126_638 | 170 |
| 672 | 3300047472 | Ga0495686_0225644 | Ga0495686_0225644_164_676 | 170 |
| 673 | 3300049551 | Ga0501335_007011 | Ga0501335_007011_256_768 | 170 |
| 674 | 3300049569 | Ga0501032_0009186 | Ga0501032_0009186_258_770 | 170 |
| 675 | 3300049571 | Ga0501034_0000004 | Ga0501034_0000004_308725_309237 | 170 |
| 676 | 3300049571 | Ga0501034_0152617 | Ga0501034_0152617_1506_2018 | 170 |
| 677 | 3300049573 | Ga0501037_0019254 | Ga0501037_0019254_1275_1787 | 170 |
| 678 | 3300049574 | Ga0501038_0058848 | Ga0501038_0058848_2153_2665 | 170 |
| 679 | 3300049575 | Ga0501039_0156785 | Ga0501039_0156785_353_865 | 170 |
| 680 | 3300049579 | Ga0501043_0019687 | Ga0501043_0019687_4763_5275 | 170 |
| 681 | 3300049581 | Ga0501047_0107962 | Ga0501047_0107962_406_918 | 170 |
| 682 | 3300049586 | Ga0501070_0228816 | Ga0501070_0228816_121_633 | 170 |
| 683 | 3300049704 | Ga0501221_116871 | Ga0501221_116871_98_610 | 170 |
| 684 | 3300050511 | nmdc:mga08y16_7939_c1 | nmdc:mga08y16_7939_c1_9646_10164 | 170 |
| 685 | 3300053129 | Ga0500628_023766 | Ga0500628_023766_560_1072 | 170 |
| 686 | 3300053146 | Ga0500588_0054050 | Ga0500588_0054050_217_729 | 170 |
| 687 | 3300053153 | Ga0500616_0226325 | Ga0500616_0226325_132_644 | 170 |
| 688 | 3300053156 | Ga0500622_0000242 | Ga0500622_0000242_22314_22826 | 170 |
| 689 | 3300053727 | Ga0500611_000060 | Ga0500611_000060_26100_26615 | 170 |
| 690 | 3300059493 | Ga0587077_012566 | Ga0587077_012566_690_1202 | 170 |
| 691 | 2162886007 | SwRhRL2b_contig_1104021 | SwRhRL2b_0737.00007120 | 171 |
| 692 | 3300001979 | JGI24740J21852_10001262 | JGI24740J21852_100012624 | 171 |
| 693 | 3300001989 | JGI24739J22299_10024864 | JGI24739J22299_100248642 | 171 |
| 694 | 3300002738 | JGI25154J39366_1000003 | JGI25154J39366_1000003134 | 171 |
| 695 | 3300002741 | JGI25157J39369_1008050 | JGI25157J39369_10080502 | 171 |
| 696 | 3300003215 | JGI25153J46596_10003159 | JGI25153J46596_100031596 | 171 |
| 697 | 3300003215 | JGI25153J46596_10007886 | JGI25153J46596_100078864 | 171 |
| 698 | 3300003320 | rootH2_10206676 | rootH2_102066762 | 171 |
| 699 | 3300003322 | rootL2_10170793 | rootL2_101707932 | 171 |
| 700 | 3300003323 | rootH1_10014610 | rootH1_1001461017 | 171 |
| 701 | 3300003323 | rootH1_10014611 | rootH1_100146112 | 171 |
| 702 | 3300003354 | JGI25160J50197_1001477 | JGI25160J50197_100147710 | 171 |
| 703 | 3300003354 | JGI25160J50197_1022441 | JGI25160J50197_10224413 | 171 |
| 704 | 3300003762 | Ga0055542_1001719 | Ga0055542_10017195 | 171 |
| 705 | 3300003771 | Ga0055526_1039510 | Ga0055526_10395102 | 171 |
| 706 | 3300003790 | Ga0055528_1000060 | Ga0055528_100006033 | 171 |
| 707 | 3300003791 | Ga0055530_10000378 | Ga0055530_1000037815 | 171 |
| 708 | 3300003794 | Ga0055531_10030616 | Ga0055531_100306161 | 171 |
| 709 | 3300005262 | Ga0065165_1001923 | Ga0065165_100192310 | 171 |
| 710 | 3300005262 | Ga0065165_1016362 | Ga0065165_10163622 | 171 |
| 711 | 3300005262 | Ga0065165_1020820 | Ga0065165_10208202 | 171 |
| 712 | 3300005289 | Ga0065704_10167542 | Ga0065704_101675422 | 171 |
| 713 | 3300005329 | Ga0070683_100085157 | Ga0070683_1000851573 | 171 |
| 714 | 3300005331 | Ga0070670_100308676 | Ga0070670_1003086762 | 171 |
| 715 | 3300005337 | Ga0070682_100137593 | Ga0070682_1001375932 | 171 |
| 716 | 3300005339 | Ga0070660_100942206 | Ga0070660_1009422061 | 171 |
| 717 | 3300005340 | Ga0070689_100306998 | Ga0070689_1003069982 | 171 |
| 718 | 3300005343 | Ga0070687_100129328 | Ga0070687_1001293282 | 171 |
| 719 | 3300005353 | Ga0070669_100280414 | Ga0070669_1002804142 | 171 |
| 720 | 3300005364 | Ga0070673_100170375 | Ga0070673_1001703752 | 171 |
| 721 | 3300005436 | Ga0070713_100315837 | Ga0070713_1003158372 | 171 |
| 722 | 3300005438 | Ga0070701_11062070 | Ga0070701_110620701 | 171 |
| 723 | 3300005455 | Ga0070663_100376714 | Ga0070663_1003767142 | 171 |
| 724 | 3300005457 | Ga0070662_100061481 | Ga0070662_1000614812 | 171 |
| 725 | 3300005530 | Ga0070679_100216934 | Ga0070679_1002169342 | 171 |
| 726 | 3300005535 | Ga0070684_101133974 | Ga0070684_1011339741 | 171 |
| 727 | 3300005544 | Ga0070686_100169323 | Ga0070686_1001693232 | 171 |
| 728 | 3300005547 | Ga0070693_100224773 | Ga0070693_1002247732 | 171 |
| 729 | 3300005547 | Ga0070693_100434145 | Ga0070693_1004341451 | 171 |
| 730 | 3300005548 | Ga0070665_100536497 | Ga0070665_1005364972 | 171 |
| 731 | 3300005577 | Ga0068857_100024711 | Ga0068857_1000247116 | 171 |
| 732 | 3300005577 | Ga0068857_100418476 | Ga0068857_1004184762 | 171 |
| 733 | 3300005578 | Ga0068854_100390486 | Ga0068854_1003904862 | 171 |
| 734 | 3300005578 | Ga0068854_100449009 | Ga0068854_1004490091 | 171 |
| 735 | 3300005615 | Ga0070702_100466194 | Ga0070702_1004661942 | 171 |
| 736 | 3300005616 | Ga0068852_100062865 | Ga0068852_1000628653 | 171 |
| 737 | 3300005616 | Ga0068852_100854470 | Ga0068852_1008544701 | 171 |
| 738 | 3300005616 | Ga0068852_101566852 | Ga0068852_1015668521 | 171 |
| 739 | 3300005618 | Ga0068864_100166759 | Ga0068864_1001667592 | 171 |
| 740 | 3300005618 | Ga0068864_100206523 | Ga0068864_1002065232 | 171 |
| 741 | 3300005719 | Ga0068861_100300047 | Ga0068861_1003000472 | 171 |
| 742 | 3300006195 | Ga0075366_10064494 | Ga0075366_100644941 | 171 |
| 743 | 3300006358 | Ga0068871_100428207 | Ga0068871_1004282072 | 171 |
| 744 | 3300006358 | Ga0068871_100563289 | Ga0068871_1005632892 | 171 |
| 745 | 3300009093 | Ga0105240_10012537 | Ga0105240_1001253710 | 171 |
| 746 | 3300009174 | Ga0105241_10490942 | Ga0105241_104909422 | 171 |
| 747 | 3300009176 | Ga0105242_10939238 | Ga0105242_109392382 | 171 |
| 748 | 3300009553 | Ga0105249_10470530 | Ga0105249_104705302 | 171 |
| 749 | 3300010375 | Ga0105239_10135680 | Ga0105239_101356802 | 171 |
| 750 | 3300010375 | Ga0105239_10323457 | Ga0105239_103234572 | 171 |
| 751 | 3300011119 | Ga0105246_10781393 | Ga0105246_107813931 | 171 |
| 752 | 3300013102 | Ga0157371_10083130 | Ga0157371_100831302 | 171 |
| 753 | 3300013102 | Ga0157371_10491596 | Ga0157371_104915961 | 171 |
| 754 | 3300013102 | Ga0157371_10806392 | Ga0157371_108063922 | 171 |
| 755 | 3300013104 | Ga0157370_10115104 | Ga0157370_101151042 | 171 |
| 756 | 3300013104 | Ga0157370_10374315 | Ga0157370_103743152 | 171 |
| 757 | 3300013105 | Ga0157369_10095175 | Ga0157369_100951752 | 171 |
| 758 | 3300013296 | Ga0157374_10596660 | Ga0157374_105966601 | 171 |
| 759 | 3300013297 | Ga0157378_10067129 | Ga0157378_100671292 | 171 |
| 760 | 3300013306 | Ga0163162_10544113 | Ga0163162_105441132 | 171 |
| 761 | 3300013307 | Ga0157372_10157431 | Ga0157372_101574312 | 171 |
| 762 | 3300013307 | Ga0157372_10378590 | Ga0157372_103785902 | 171 |
| 763 | 3300013308 | Ga0157375_11084865 | Ga0157375_110848651 | 171 |
| 764 | 3300015265 | Ga0182005_1000069 | Ga0182005_100006956 | 171 |
| 765 | 3300015265 | Ga0182005_1093902 | Ga0182005_10939022 | 171 |
| 766 | 3300021384 | Ga0213876_10006978 | Ga0213876_100069784 | 171 |
| 767 | 3300025208 | Ga0209436_100329 | Ga0209436_10032919 | 171 |
| 768 | 3300025242 | Ga0209258_100032 | Ga0209258_100032217 | 171 |
| 769 | 3300025245 | Ga0207425_1024802 | Ga0207425_10248022 | 171 |
| 770 | 3300025246 | Ga0209646_1000004 | Ga0209646_1000004204 | 171 |
| 771 | 3300025250 | Ga0209026_1000192 | Ga0209026_100019227 | 171 |
| 772 | 3300025254 | Ga0209148_1000186 | Ga0209148_100018692 | 171 |
| 773 | 3300025258 | Ga0209129_1020980 | Ga0209129_10209802 | 171 |
| 774 | 3300025273 | Ga0209673_1000258 | Ga0209673_100025882 | 171 |
| 775 | 3300025291 | Ga0209675_1029097 | Ga0209675_10290972 | 171 |
| 776 | 3300025295 | Ga0209564_1006138 | Ga0209564_10061384 | 171 |
| 777 | 3300025297 | Ga0209758_1009737 | Ga0209758_10097374 | 171 |
| 778 | 3300025297 | Ga0209758_1019239 | Ga0209758_10192395 | 171 |
| 779 | 3300025298 | Ga0209050_1001018 | Ga0209050_100101816 | 171 |
| 780 | 3300025302 | Ga0207426_1000033 | Ga0207426_1000033290 | 171 |
| 781 | 3300025302 | Ga0207426_1000594 | Ga0207426_100059415 | 171 |
| 782 | 3300025302 | Ga0207426_1000780 | Ga0207426_100078024 | 171 |
| 783 | 3300025303 | Ga0209051_1012467 | Ga0209051_10124674 | 171 |
| 784 | 3300025304 | Ga0209257_1002472 | Ga0209257_100247214 | 171 |
| 785 | 3300025903 | Ga0207680_10566749 | Ga0207680_105667492 | 171 |
| 786 | 3300025909 | Ga0207705_10937142 | Ga0207705_109371421 | 171 |
| 787 | 3300025913 | Ga0207695_10009898 | Ga0207695_100098985 | 171 |
| 788 | 3300025917 | Ga0207660_10124974 | Ga0207660_101249742 | 171 |
| 789 | 3300025918 | Ga0207662_10049076 | Ga0207662_100490762 | 171 |
| 790 | 3300025921 | Ga0207652_10208279 | Ga0207652_102082792 | 171 |
| 791 | 3300025923 | Ga0207681_10243250 | Ga0207681_102432502 | 171 |
| 792 | 3300025926 | Ga0207659_10620642 | Ga0207659_106206422 | 171 |
| 793 | 3300025928 | Ga0207700_10307286 | Ga0207700_103072862 | 171 |
| 794 | 3300025933 | Ga0207706_10131220 | Ga0207706_101312202 | 171 |
| 795 | 3300025936 | Ga0207670_10274523 | Ga0207670_102745232 | 171 |
| 796 | 3300025937 | Ga0207669_10272702 | Ga0207669_102727022 | 171 |
| 797 | 3300025944 | Ga0207661_10151192 | Ga0207661_101511922 | 171 |
| 798 | 3300025944 | Ga0207661_10908778 | Ga0207661_109087782 | 171 |
| 799 | 3300025981 | Ga0207640_10172343 | Ga0207640_101723432 | 171 |
| 800 | 3300025986 | Ga0207658_10559709 | Ga0207658_105597092 | 171 |
| 801 | 3300026067 | Ga0207678_10260923 | Ga0207678_102609232 | 171 |
| 802 | 3300026089 | Ga0207648_10781897 | Ga0207648_107818972 | 171 |
| 803 | 3300026095 | Ga0207676_10087749 | Ga0207676_100877492 | 171 |
| 804 | 3300026116 | Ga0207674_10034066 | Ga0207674_100340662 | 171 |
| 805 | 3300026116 | Ga0207674_11172619 | Ga0207674_111726191 | 171 |
| 806 | 3300026116 | Ga0207674_11684163 | Ga0207674_116841631 | 171 |
| 807 | 3300026118 | Ga0207675_100830925 | Ga0207675_1008309252 | 171 |
| 808 | 3300026142 | Ga0207698_10345297 | Ga0207698_103452972 | 171 |
| 809 | 3300026142 | Ga0207698_10809631 | Ga0207698_108096312 | 171 |
| 810 | 3300026142 | Ga0207698_10859943 | Ga0207698_108599431 | 171 |
| 811 | 3300028379 | Ga0268266_10472899 | Ga0268266_104728992 | 171 |
| 812 | 3300031251 | Ga0265327_10000030 | Ga0265327_100000304 | 171 |
| 813 | 3300031251 | Ga0265327_10057725 | Ga0265327_100577252 | 171 |
| 814 | 3300035692 | Ga0373935_0194986 | Ga0373935_0194986_579_1094 | 171 |
| 815 | 3300039437 | Ga0436365_0311643 | Ga0436365_0311643_2310_2825 | 171 |
| 816 | 3300039453 | Ga0436362_0886610 | Ga0436362_0886610_212_727 | 171 |
| 817 | 3300041404 | Ga0439436_0038169 | Ga0439436_0038169_829_1359 | 171 |
| 818 | 3300041413 | Ga0439465_0040095 | Ga0439465_0040095_124_639 | 171 |
| 819 | 3300041997 | Ga0439431_0000806 | Ga0439431_0000806_1674_2189 | 171 |
| 820 | 3300042004 | Ga0439445_0057213 | Ga0439445_0057213_193_708 | 171 |
| 821 | 3300042007 | Ga0439449_0017949 | Ga0439449_0017949_507_1037 | 171 |
| 822 | 3300044658 | Ga0466972_0000146 | Ga0466972_0000146_26920_27435 | 171 |
| 823 | 3300044658 | Ga0466972_0015319 | Ga0466972_0015319_776_1291 | 171 |
| 824 | 3300044683 | Ga0466965_0075261 | Ga0466965_0075261_969_1487 | 171 |
| 825 | 3300044765 | Ga0466970_0170791 | Ga0466970_0170791_78_593 | 171 |
| 826 | 3300044842 | Ga0466957_0426924 | Ga0466957_0426924_160_675 | 171 |
| 827 | 3300045049 | Ga0466959_0112955 | Ga0466959_0112955_1144_1659 | 171 |
| 828 | 3300046519 | Ga0495632_0321043 | Ga0495632_0321043_151_669 | 171 |
| 829 | 3300046529 | Ga0495652_0521171 | Ga0495652_0521171_105_620 | 171 |
| 830 | 3300046535 | Ga0495586_0214507 | Ga0495586_0214507_97_612 | 171 |
| 831 | 3300046543 | Ga0495645_0075044 | Ga0495645_0075044_1842_2357 | 171 |
| 832 | 3300048927 | Ga0496124_0049547 | Ga0496124_0049547_1043_1561 | 171 |
| 833 | 3300049571 | Ga0501034_0030378 | Ga0501034_0030378_4258_4773 | 171 |
| 834 | 3300049758 | Ga0501241_003800 | Ga0501241_003800_116_652 | 171 |
| 835 | 3300050496 | nmdc:mga07m45_100577_c1 | nmdc:mga07m45_100577_c1_1072_1590 | 171 |
| 836 | 3300050496 | nmdc:mga07m45_177196_c1 | nmdc:mga07m45_177196_c1_651_1166 | 171 |
| 837 | 3300053088 | Ga0500644_0000042 | Ga0500644_0000042_43585_44100 | 171 |
| 838 | 3300053090 | Ga0500646_0002688 | Ga0500646_0002688_2609_3127 | 171 |
| 839 | 3300053092 | Ga0500583_0026172 | Ga0500583_0026172_706_1224 | 171 |
| 840 | 3300053109 | Ga0500569_000551 | Ga0500569_000551_4453_4971 | 171 |
| 841 | 3300053121 | Ga0500607_024676 | Ga0500607_024676_775_1290 | 171 |
| 842 | 3300053131 | Ga0500652_007276 | Ga0500652_007276_678_1196 | 171 |
| 843 | 3300053134 | Ga0500658_0013681 | Ga0500658_0013681_1844_2362 | 171 |
| 844 | 3300053136 | Ga0500559_0007408 | Ga0500559_0007408_818_1333 | 171 |
| 845 | 3300053139 | Ga0500568_0065045 | Ga0500568_0065045_54_572 | 171 |
| 846 | 3300053142 | Ga0500577_0000839 | Ga0500577_0000839_4768_5286 | 171 |
| 847 | 3300053148 | Ga0500590_066310 | Ga0500590_066310_698_1213 | 171 |
| 848 | 3300053153 | Ga0500616_0080468 | Ga0500616_0080468_617_1135 | 171 |
| 849 | 3300053156 | Ga0500622_0000939 | Ga0500622_0000939_16858_17388 | 171 |
| 850 | 3300053160 | Ga0500633_0002773 | Ga0500633_0002773_2654_3169 | 171 |
| 851 | 3300055283 | Ga0500661_005067 | Ga0500661_005067_604_1119 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7f6j-assembly1.cif.gz_C | crystal structure of the pdzd8 coiled-coil domain - rab7 complex | 0.8048 | 35 | 99 |
| 4kqt-assembly1.cif.gz_A | crystal structure of a putative outer membrane chaperone (omph-like) (cc_1914) from caulobacter crescentus cb15 at 2.83 a resolution (psi community target, shapiro) | 0.7636 | 21 | 167 |
| 4l0r-assembly1.cif.gz_A | crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a. | 0.7214 | 43 | 122 |
| 4afl-assembly2.cif.gz_B | the crystal structure of the ing4 dimerization domain reveals the functional organization of the ing family of chromatin binding proteins. | 0.6929 | 30 | 127 |
| 4l0r-assembly1.cif.gz_A | crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a. | 0.6837 | 43 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4l0rB00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.844 | 42 | 99 | 1.20.58.90 |
| 4javA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain | 0.829 | 39 | 99 | 1.10.287.130 |
| af_Q4CPK5_36_242_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.7418 | 33 | 99 | 1.20.1270.60 |
| af_Q4E676_32_269_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.7409 | 33 | 99 | 1.20.1270.60 |
| af_Q498T3_2_102_1.20.81.10 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain | 0.7273 | 29 | 133 | 1.20.81.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0YLK7-F1-model_v4 | Outer membrane chaperone Skp (OmpH) | 0.9799 | 28 | 168 |
GO:0005829
GO:0022417 GO:0050821 GO:0051082 GO:0061077 |
| AF-A0A3D1CW46-F1-model_v4 | OmpH family outer membrane protein | 0.9781 | 26 | 168 |
GO:0005829
GO:0022417 GO:0050821 GO:0051082 GO:0061077 |
| AF-A0A846FRX5-F1-model_v4 | deleted | 0.9709 | 20 | 167 |
|
| AF-A0A7C5QEA2-F1-model_v4 | OmpH family outer membrane protein | 0.9696 | 20 | 168 |
GO:0005829
GO:0022417 GO:0050821 GO:0051082 GO:0061077 |
| AF-D5BFN0-F1-model_v4 | OmpH family outer membrane protein | 0.9682 | 28 | 168 |
GO:0005829
GO:0022417 GO:0050821 GO:0051082 GO:0061077 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar