F483479

General Info

Members Datasets Scaffolds Average Seq Length
851 384 834 171

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0196001|Ga0501032_0196001_298_906
Length 195
Sequence MMGQKLSGNRTIKTMIIFTTQTTRPLKRKNMQMKKLFLLAGFAAMALLSQAQKYAIIDTKYILDKLPEYKMAQKQLDDIAAGWQKDLDRMYKDYDAEQVMLSEDLRKKREDQLFQKEKNLRDLQRQRFGFEGDLFKTRQNLIKPIQDKVYNAVQKIAVQRGYDFILDKSEGITIIFADPKLDKSEDILRELGVKN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
7 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
8 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
9 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
10 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
11 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
12 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
13 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
14 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
15 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
16 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
17 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
18 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
22 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
212 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
225 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
242 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
243 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
244 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
245 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
246 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
247 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
248 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
249 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
250 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
251 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
252 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
253 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
254 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
255 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
256 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
257 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
312 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
328 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
329 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
330 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
331 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
332 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
333 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
334 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
335 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
336 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
337 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
338 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
339 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
342 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
343 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
354 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
355 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
356 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
357 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
358 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
359 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
360 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
361 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
362 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
363 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
364 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
365 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
366 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
367 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
368 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
372 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
373 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
374 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
375 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
376 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
377 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
378 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
379 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
380 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
381 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
382 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
384 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0.24
Isolates 2.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.4
Nodule 0
Rhizoplane 1.18
Rhizosphere 84.25
Stem 0
Stem Tuber 0
Unclassified 5.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1104021 2162886007 Bacteria 1312
2 JGI24740J21852_10001262 3300001979 Bacteria 11463
3 JGI24739J22299_10024864 3300001989 Bacteria 2109
4 JGI24744J21845_10006042 3300002077 Bacteria 2510
5 JGI25154J39366_1000003 3300002738 Bacteria 397627
6 JGI25157J39369_1008050 3300002741 Bacteria 1487
7 JGI25153J46596_10003159 3300003215 Bacteria 9290
8 JGI25153J46596_10007886 3300003215 Bacteria 5168
9 rootH1_10044617 3300003316 Bacteria 6195
10 rootH2_10076327 3300003320 Bacteria 11967
11 rootH2_10149464 3300003320 Bacteria 1461
12 rootH2_10206676 3300003320 Bacteria 1541
13 rootL2_10170793 3300003322 Bacteria 1028
14 rootH1_10014610 3300003316 Bacteria 16128
15 rootH1_10014610 3300003323 Bacteria 26841
16 rootH1_10014611 3300003323 Bacteria 2441
17 rootH1_10016772 3300003323 Bacteria 12240
18 JGI25160J50197_1001477 3300003354 Bacteria 11699
19 JGI25160J50197_1022441 3300003354 Bacteria 1850
20 Ga0055542_1001719 3300003762 Bacteria 9455
21 Ga0055526_1039510 3300003771 Bacteria 1201
22 Ga0055528_1000060 3300003790 Bacteria 87471
23 Ga0055530_10000378 3300003791 Bacteria 40399
24 Ga0055531_10030616 3300003794 Bacteria 1802
25 Ga0065165_1001923 3300005262 Bacteria 19827
26 Ga0065165_1016362 3300005262 Bacteria 2781
27 Ga0065165_1020820 3300005262 Bacteria 2296
28 Ga0065714_10137470 3300005288 Bacteria 1197
29 Ga0065704_10167542 3300005289 Bacteria 1312
30 Ga0065712_10030184 3300005290 Bacteria 1316
31 Ga0065712_10100308 3300005290 Bacteria 2066
32 Ga0065715_10282515 3300005293 Bacteria 1083
33 Ga0070658_10132184 3300005327 Bacteria 2080
34 Ga0070676_10009154 3300005328 Bacteria 5358
35 Ga0070676_10613325 3300005328 Bacteria 786
36 Ga0070676_11034973 3300005328 Bacteria 618
37 Ga0070683_100002314 3300005329 Bacteria 15105
38 Ga0070683_100085157 3300005329 Bacteria 2962
39 Ga0070683_100454177 3300005329 Bacteria 1223
40 Ga0070683_100861154 3300005329 Bacteria 869
41 Ga0070683_100981511 3300005329 Unclassified 811
42 Ga0070683_101251328 3300005329 Bacteria 713
43 Ga0070690_100024106 3300005330 Bacteria 3741
44 Ga0070690_100435643 3300005330 Bacteria 969
45 Ga0070670_100261512 3300005331 Bacteria 1508
46 Ga0070670_100308676 3300005331 Bacteria 1384
47 Ga0070670_100586191 3300005331 Bacteria 997
48 Ga0068869_100005175 3300005334 Bacteria 8185
49 Ga0068869_100008029 3300005334 Bacteria 6778
50 Ga0068869_100085491 3300005334 Bacteria 2362
51 Ga0068869_101105172 3300005334 Bacteria 694
52 Ga0070666_10026971 3300005335 Bacteria 3758
53 Ga0070666_10173715 3300005335 Bacteria 1510
54 Ga0070666_10187414 3300005335 Bacteria 1453
55 Ga0070666_10318735 3300005335 Bacteria 1109
56 Ga0070680_100010528 3300005336 Bacteria 7134
57 Ga0070682_100000019 3300005337 Bacteria 220844
58 Ga0070682_100049312 3300005337 Bacteria 2625
59 Ga0070682_100137593 3300005337 Bacteria 1661
60 Ga0070682_100174827 3300005337 Bacteria 1495
61 Ga0068868_100004324 3300005338 Bacteria 9953
62 Ga0068868_100083535 3300005338 Bacteria 2564
63 Ga0068868_100196500 3300005338 Bacteria 1680
64 Ga0068868_100361741 3300005338 Bacteria 1245
65 Ga0070660_100095233 3300005339 Bacteria 2353
66 Ga0070660_100100442 3300005339 Bacteria 2292
67 Ga0070660_100390403 3300005339 Bacteria 1150
68 Ga0070660_100584631 3300005339 Bacteria 933
69 Ga0070660_100942206 3300005339 Bacteria 729
70 Ga0070689_100021006 3300005340 Bacteria 4853
71 Ga0070689_100033467 3300005340 Bacteria 3917
72 Ga0070689_100306998 3300005340 Bacteria 1322
73 Ga0070691_10011739 3300005341 Bacteria 4007
74 Ga0070687_100129328 3300005343 Bacteria 1456
75 Ga0070687_100894375 3300005343 Bacteria 636
76 Ga0070661_100013425 3300005344 Bacteria 5749
77 Ga0070668_100039320 3300005347 Bacteria 3618
78 Ga0070668_100400452 3300005347 Bacteria 1172
79 Ga0070668_100480567 3300005347 Bacteria 1073
80 Ga0070669_100056017 3300005353 Bacteria 2890
81 Ga0070669_100280414 3300005353 Bacteria 1335
82 Ga0070669_100399589 3300005353 Bacteria 1124
83 Ga0070669_100597678 3300005353 Bacteria 924
84 Ga0070669_100781067 3300005353 Bacteria 811
85 Ga0070675_100041303 3300005354 Bacteria 3767
86 Ga0070675_100131302 3300005354 Bacteria 2135
87 Ga0070675_100138245 3300005354 Bacteria 2080
88 Ga0070675_100511190 3300005354 Bacteria 1083
89 Ga0070671_100044015 3300005355 Bacteria 3709
90 Ga0070671_100086837 3300005355 Bacteria 2618
91 Ga0070671_100623499 3300005355 Bacteria 933
92 Ga0070671_100722618 3300005355 Bacteria 865
93 Ga0070673_100033496 3300005364 Bacteria 3881
94 Ga0070673_100049643 3300005364 Bacteria 3277
95 Ga0070673_100170375 3300005364 Unclassified 1858
96 Ga0070673_100176585 3300005364 Bacteria 1826
97 Ga0070673_100758375 3300005364 Bacteria 894
98 Ga0070688_100039108 3300005365 Bacteria 2901
99 Ga0070688_100081027 3300005365 Bacteria 2101
100 Ga0070659_100186571 3300005366 Bacteria 1703
101 Ga0070667_100204460 3300005367 Bacteria 1753
102 Ga0070667_100833897 3300005367 Bacteria 857
103 Ga0070713_100315837 3300005436 Bacteria 1442
104 Ga0070701_11062070 3300005438 Bacteria 568
105 Ga0070705_100922302 3300005440 Bacteria 704
106 Ga0070663_100376714 3300005455 Bacteria 1155
107 Ga0070678_100007858 3300005456 Bacteria 6346
108 Ga0070678_100045789 3300005456 Bacteria 3132
109 Ga0070662_100020419 3300005457 Bacteria 4510
110 Ga0070662_100039935 3300005457 Bacteria 3340
111 Ga0070662_100061481 3300005457 Bacteria 2742
112 Ga0070662_100195335 3300005457 Bacteria 1602
113 Ga0070681_10058113 3300005458 Bacteria 3848
114 Ga0070681_10221963 3300005458 Bacteria 1805
115 Ga0068867_100027314 3300005459 Bacteria 4100
116 Ga0068867_100028644 3300005459 Bacteria 4011
117 Ga0068867_100040234 3300005459 Bacteria 3410
118 Ga0068867_100040241 3300005459 Bacteria 3410
119 Ga0068867_100240266 3300005459 Bacteria 1469
120 Ga0068867_100637137 3300005459 Bacteria 934
121 Ga0068867_100740619 3300005459 Unclassified 871
122 Ga0070685_10050637 3300005466 Bacteria 2400
123 Ga0070679_100000836 3300005530 Bacteria 26787
124 Ga0070679_100216934 3300005530 Bacteria 1875
125 Ga0070684_100000823 3300005535 Bacteria 21717
126 Ga0070684_100002886 3300005535 Bacteria 12774
127 Ga0070684_100738471 3300005535 Bacteria 919
128 Ga0070684_100754353 3300005535 Bacteria 909
129 Ga0070684_101133974 3300005535 Bacteria 735
130 Ga0068853_100007046 3300005539 Bacteria 8988
131 Ga0068853_100009327 3300005539 Bacteria 7911
132 Ga0068853_100176747 3300005539 Bacteria 1934
133 Ga0068853_100208699 3300005539 Bacteria 1780
134 Ga0068853_100519382 3300005539 Bacteria 1126
135 Ga0068853_100528449 3300005539 Bacteria 1116
136 Ga0068853_100692170 3300005539 Bacteria 972
137 Ga0068853_100917069 3300005539 Bacteria 842
138 Ga0070672_100003727 3300005543 Bacteria 9916
139 Ga0070672_100304310 3300005543 Bacteria 1352
140 Ga0070672_100335842 3300005543 Bacteria 1286
141 Ga0070686_100169323 3300005544 Bacteria 1544
142 Ga0070686_100192730 3300005544 Bacteria 1456
143 Ga0070686_100242940 3300005544 Bacteria 1312
144 Ga0070693_100224773 3300005547 Bacteria 1232
145 Ga0070693_100434145 3300005547 Bacteria 918
146 Ga0070665_100000014 3300005548 Bacteria 484881
147 Ga0070665_100062566 3300005548 Bacteria 3732
148 Ga0070665_100076597 3300005548 Bacteria 3351
149 Ga0070665_100448306 3300005548 Bacteria 1300
150 Ga0070665_100536497 3300005548 Bacteria 1182
151 Ga0068855_100006600 3300005563 Bacteria 14106
152 Ga0068855_100014225 3300005563 Bacteria 9586
153 Ga0068855_100024083 3300005563 Bacteria 7287
154 Ga0068855_100274060 3300005563 Bacteria 1875
155 Ga0070664_100009426 3300005564 Bacteria 7914
156 Ga0070664_100019327 3300005564 Bacteria 5605
157 Ga0070664_100026791 3300005564 Bacteria 4786
158 Ga0070664_100094916 3300005564 Bacteria 2587
159 Ga0070664_100368151 3300005564 Bacteria 1310
160 Ga0070664_100520085 3300005564 Bacteria 1098
161 Ga0070664_100839215 3300005564 Bacteria 860
162 Ga0070664_101318769 3300005564 Bacteria 682
163 Ga0068857_100004302 3300005577 Bacteria 12015
164 Ga0068857_100005247 3300005577 Bacteria 11033
165 Ga0068857_100024711 3300005577 Bacteria 5292
166 Ga0068857_100129622 3300005577 Bacteria 2274
167 Ga0068857_100193365 3300005577 Bacteria 1853
168 Ga0068857_100268357 3300005577 Bacteria 1568
169 Ga0068857_100372094 3300005577 Bacteria 1325
170 Ga0068857_100418476 3300005577 Bacteria 1249
171 Ga0068854_100124556 3300005578 Bacteria 1961
172 Ga0068854_100150217 3300005578 Bacteria 1795
173 Ga0068854_100179882 3300005578 Bacteria 1651
174 Ga0068854_100390486 3300005578 Bacteria 1149
175 Ga0068854_100444154 3300005578 Bacteria 1082
176 Ga0068854_100449009 3300005578 Bacteria 1076
177 Ga0068856_100055686 3300005614 Bacteria 3903
178 Ga0068856_100204401 3300005614 Bacteria 1990
179 Ga0068856_101136185 3300005614 Bacteria 798
180 Ga0070702_100466194 3300005615 Bacteria 920
181 Ga0068852_100000744 3300005616 Bacteria 21378
182 Ga0068852_100000989 3300005616 Bacteria 18732
183 Ga0068852_100045245 3300005616 Bacteria 3743
184 Ga0068852_100062865 3300005616 Bacteria 3230
185 Ga0068852_100228781 3300005616 Bacteria 1772
186 Ga0068852_100407428 3300005616 Bacteria 1339
187 Ga0068852_100854470 3300005616 Bacteria 926
188 Ga0068852_100916598 3300005616 Bacteria 894
189 Ga0068852_101566852 3300005616 Bacteria 681
190 Ga0068852_102019073 3300005616 Bacteria 599
191 Ga0068859_100001537 3300005617 Bacteria 23548
192 Ga0068859_100032421 3300005617 Bacteria 5249
193 Ga0068859_100071945 3300005617 Bacteria 3493
194 Ga0068859_100072317 3300005617 Bacteria 3485
195 Ga0068859_100094528 3300005617 Bacteria 3041
196 Ga0068864_100046635 3300005618 Bacteria 3719
197 Ga0068864_100062524 3300005618 Bacteria 3225
198 Ga0068864_100073120 3300005618 Bacteria 2989
199 Ga0068864_100102035 3300005618 Bacteria 2545
200 Ga0068864_100166759 3300005618 Bacteria 2006
201 Ga0068864_100206523 3300005618 Bacteria 1807
202 Ga0068864_100701604 3300005618 Bacteria 989
203 Ga0068864_101256703 3300005618 Bacteria 740
204 Ga0068866_10027049 3300005718 Bacteria 2716
205 Ga0068861_100300047 3300005719 Bacteria 1391
206 Ga0068861_100579650 3300005719 Bacteria 1027
207 Ga0068851_10091568 3300005834 Bacteria 1601
208 Ga0068851_10566615 3300005834 Bacteria 688
209 Ga0068863_100089444 3300005841 Bacteria 2919
210 Ga0068863_100111170 3300005841 Bacteria 2610
211 Ga0068863_100327519 3300005841 Bacteria 1489
212 Ga0068863_100469196 3300005841 Bacteria 1237
213 Ga0068858_100033772 3300005842 Bacteria 4744
214 Ga0068858_100100576 3300005842 Bacteria 2696
215 Ga0068858_100235320 3300005842 Bacteria 1737
216 Ga0068858_101123700 3300005842 Bacteria 772
217 Ga0068860_100000061 3300005843 Bacteria 192548
218 Ga0068860_100001341 3300005843 Bacteria 26789
219 Ga0068860_100076623 3300005843 Bacteria 3180
220 Ga0068860_100661574 3300005843 Bacteria 1053
221 Ga0068860_101823472 3300005843 Bacteria 630
222 Ga0068862_100005164 3300005844 Bacteria 10980
223 Ga0068862_100180767 3300005844 Bacteria 1893
224 Ga0081540_1002949 3300005983 Bacteria 13669
225 Ga0070715_10206605 3300006163 Bacteria 1001
226 Ga0075366_10018940 3300006195 Bacteria 3978
227 Ga0075366_10064494 3300006195 Bacteria 2178
228 Ga0075366_10239789 3300006195 Bacteria 1105
229 Ga0097621_100030125 3300006237 Bacteria 4293
230 Ga0097621_100049304 3300006237 Bacteria 3420
231 Ga0097621_100114616 3300006237 Bacteria 2281
232 Ga0097621_100257538 3300006237 Bacteria 1530
233 Ga0097621_100760265 3300006237 Bacteria 896
234 Ga0097621_100855367 3300006237 Bacteria 845
235 Ga0075370_10175079 3300006353 Bacteria 1262
236 Ga0068871_100004499 3300006358 Bacteria 9709
237 Ga0068871_100045959 3300006358 Bacteria 3516
238 Ga0068871_100114713 3300006358 Bacteria 2270
239 Ga0068871_100290087 3300006358 Bacteria 1433
240 Ga0068871_100428207 3300006358 Bacteria 1183
241 Ga0068871_100500703 3300006358 Bacteria 1095
242 Ga0068871_100563289 3300006358 Bacteria 1033
243 Ga0075434_100046233 3300006871 Bacteria 4320
244 Ga0075434_101518647 3300006871 Bacteria 679
245 Ga0068865_100160502 3300006881 Bacteria 1714
246 Ga0068865_100575481 3300006881 Bacteria 949
247 Ga0097620_100001537 3300006931 Bacteria 23548
248 Ga0097620_100032421 3300006931 Bacteria 5249
249 Ga0097620_100071946 3300006931 Bacteria 3493
250 Ga0097620_100072323 3300006931 Bacteria 3485
251 Ga0097620_100094524 3300006931 Bacteria 3041
252 Ga0097620_100303654 3300006931 Bacteria 1689
253 Ga0105251_10401389 3300009011 Bacteria 630
254 Ga0105240_10000800 3300009093 Bacteria 56989
255 Ga0105240_10012537 3300009093 Bacteria 11694
256 Ga0105240_10026787 3300009093 Bacteria 7561
257 Ga0105240_10073546 3300009093 Bacteria 4220
258 Ga0105240_10075380 3300009093 Bacteria 4161
259 Ga0105240_10194738 3300009093 Bacteria 2381
260 Ga0105240_10218061 3300009093 Bacteria 2224
261 Ga0111539_10011561 3300009094 Bacteria 11079
262 Ga0111539_10485090 3300009094 Bacteria 1440
263 Ga0105247_10848743 3300009101 Bacteria 701
264 Ga0114129_10353492 3300009147 Bacteria 1946
265 Ga0105241_10001809 3300009174 Bacteria 16223
266 Ga0105241_10042701 3300009174 Bacteria 3432
267 Ga0105241_10127807 3300009174 Bacteria 2054
268 Ga0105241_10131163 3300009174 Bacteria 2029
269 Ga0105241_10195624 3300009174 Bacteria 1686
270 Ga0105241_10267849 3300009174 Bacteria 1454
271 Ga0105241_10470012 3300009174 Bacteria 1116
272 Ga0105241_10490942 3300009174 Bacteria 1093
273 Ga0105241_10735234 3300009174 Bacteria 903
274 Ga0105242_10430846 3300009176 Bacteria 1238
275 Ga0105242_10700684 3300009176 Bacteria 991
276 Ga0105242_10939238 3300009176 Bacteria 868
277 Ga0105242_11147415 3300009176 Bacteria 794
278 Ga0105248_10173092 3300009177 Bacteria 2433
279 Ga0105248_10978259 3300009177 Bacteria 956
280 Ga0105237_10000453 3300009545 Bacteria 58200
281 Ga0105237_10003705 3300009545 Bacteria 18019
282 Ga0105237_10013196 3300009545 Bacteria 8669
283 Ga0105237_10023637 3300009545 Bacteria 6295
284 Ga0105237_10027884 3300009545 Bacteria 5755
285 Ga0105237_10336811 3300009545 Bacteria 1513
286 Ga0105237_11214807 3300009545 Bacteria 760
287 Ga0105238_10000592 3300009551 Bacteria 38095
288 Ga0105238_10041982 3300009551 Bacteria 4632
289 Ga0105238_10194684 3300009551 Bacteria 2003
290 Ga0105249_10010748 3300009553 Bacteria 8043
291 Ga0105249_10065163 3300009553 Bacteria 3351
292 Ga0105249_10139717 3300009553 Unclassified 2321
293 Ga0105249_10223534 3300009553 Bacteria 1854
294 Ga0105249_10361403 3300009553 Bacteria 1473
295 Ga0105249_10470530 3300009553 Bacteria 1298
296 Ga0105239_10000019 3300010375 Bacteria 273836
297 Ga0105239_10009226 3300010375 Bacteria 11159
298 Ga0105239_10012695 3300010375 Bacteria 9373
299 Ga0105239_10046242 3300010375 Bacteria 4769
300 Ga0105239_10061440 3300010375 Bacteria 4123
301 Ga0105239_10135680 3300010375 Bacteria 2739
302 Ga0105239_10323457 3300010375 Bacteria 1739
303 Ga0105239_11084666 3300010375 Bacteria 921
304 Ga0105246_10158024 3300011119 Bacteria 1724
305 Ga0105246_10234822 3300011119 Bacteria 1446
306 Ga0105246_10391604 3300011119 Bacteria 1151
307 Ga0105246_10781393 3300011119 Bacteria 845
308 Ga0157373_10040922 3300013100 Bacteria 3315
309 Ga0157373_10072818 3300013100 Bacteria 2425
310 Ga0157373_10347797 3300013100 Bacteria 1057
311 Ga0157371_10006990 3300013102 Bacteria 9185
312 Ga0157371_10083130 3300013102 Bacteria 2267
313 Ga0157371_10491596 3300013102 Bacteria 905
314 Ga0157371_10806392 3300013102 Bacteria 708
315 Ga0157370_10005329 3300013104 Bacteria 14440
316 Ga0157370_10068911 3300013104 Bacteria 3342
317 Ga0157370_10115104 3300013104 Bacteria 2512
318 Ga0157370_10374315 3300013104 Bacteria 1312
319 Ga0157370_10413071 3300013104 Bacteria 1242
320 Ga0157369_10027331 3300013105 Bacteria 6326
321 Ga0157369_10095175 3300013105 Bacteria 3178
322 Ga0157369_10172833 3300013105 Bacteria 2276
323 Ga0157369_10861572 3300013105 Bacteria 930
324 Ga0157374_10000011 3300013296 Bacteria 466749
325 Ga0157374_10003407 3300013296 Bacteria 13350
326 Ga0157374_10041765 3300013296 Bacteria 4228
327 Ga0157374_10094013 3300013296 Bacteria 2864
328 Ga0157374_10596660 3300013296 Bacteria 1114
329 Ga0157374_10893854 3300013296 Bacteria 906
330 Ga0157378_10003727 3300013297 Bacteria 13508
331 Ga0157378_10006316 3300013297 Bacteria 10381
332 Ga0157378_10067129 3300013297 Bacteria 3214
333 Ga0157378_10309789 3300013297 Bacteria 1531
334 Ga0157378_10746527 3300013297 Bacteria 1001
335 Ga0157378_11098334 3300013297 Bacteria 832
336 Ga0163162_10010130 3300013306 Bacteria 9161
337 Ga0163162_10161533 3300013306 Bacteria 2362
338 Ga0163162_10544113 3300013306 Bacteria 1290
339 Ga0163162_10863198 3300013306 Bacteria 1020
340 Ga0163162_10931612 3300013306 Unclassified 980
341 Ga0163162_11698972 3300013306 Bacteria 721
342 Ga0157372_10002332 3300013307 Bacteria 20561
343 Ga0157372_10007698 3300013307 Bacteria 11455
344 Ga0157372_10023290 3300013307 Bacteria 6712
345 Ga0157372_10032041 3300013307 Bacteria 5760
346 Ga0157372_10058652 3300013307 Bacteria 4304
347 Ga0157372_10149086 3300013307 Bacteria 2698
348 Ga0157372_10154609 3300013307 Bacteria 2649
349 Ga0157372_10157431 3300013307 Bacteria 2624
350 Ga0157372_10188258 3300013307 Bacteria 2390
351 Ga0157372_10190800 3300013307 Bacteria 2374
352 Ga0157372_10226830 3300013307 Bacteria 2166
353 Ga0157372_10378590 3300013307 Bacteria 1649
354 Ga0157372_10729009 3300013307 Bacteria 1153
355 Ga0157372_10936892 3300013307 Bacteria 1004
356 Ga0157372_11135030 3300013307 Bacteria 904
357 Ga0157372_11243537 3300013307 Bacteria 860
358 Ga0157375_10034814 3300013308 Bacteria 4800
359 Ga0157375_10160091 3300013308 Bacteria 2392
360 Ga0157375_10378034 3300013308 Bacteria 1583
361 Ga0157375_10387368 3300013308 Bacteria 1564
362 Ga0157375_11084865 3300013308 Bacteria 937
363 Ga0157375_11127115 3300013308 Bacteria 919
364 Ga0163163_10001351 3300014325 Bacteria 20695
365 Ga0163163_10047872 3300014325 Bacteria 4203
366 Ga0163163_10102798 3300014325 Bacteria 2882
367 Ga0163163_10242874 3300014325 Bacteria 1851
368 Ga0163163_10258236 3300014325 Bacteria 1793
369 Ga0163163_10303744 3300014325 Bacteria 1648
370 Ga0163163_10850863 3300014325 Bacteria 975
371 Ga0157380_10012066 3300014326 Bacteria 6255
372 Ga0157380_10027166 3300014326 Bacteria 4351
373 Ga0157380_10095826 3300014326 Bacteria 2459
374 Ga0157380_10160068 3300014326 Bacteria 1956
375 Ga0157380_10407296 3300014326 Bacteria 1292
376 Ga0157380_10526802 3300014326 Unclassified 1154
377 Ga0157380_10865854 3300014326 Bacteria 927
378 Ga0157377_10012474 3300014745 Bacteria 4275
379 Ga0157377_10215119 3300014745 Bacteria 1227
380 Ga0157377_10633331 3300014745 Bacteria 767
381 Ga0157379_10081736 3300014968 Bacteria 2894
382 Ga0157379_10107120 3300014968 Bacteria 2509
383 Ga0157379_10117040 3300014968 Bacteria 2397
384 Ga0157379_10268713 3300014968 Bacteria 1550
385 Ga0157379_10451648 3300014968 Bacteria 1187
386 Ga0157376_10011577 3300014969 Bacteria 6510
387 Ga0157376_10013360 3300014969 Bacteria 6124
388 Ga0157376_10038551 3300014969 Bacteria 3889
389 Ga0157376_10208176 3300014969 Bacteria 1804
390 Ga0157376_10306843 3300014969 Bacteria 1504
391 Ga0182005_1000069 3300015265 Bacteria 85864
392 Ga0182005_1093902 3300015265 Unclassified 836
393 Ga0163161_10060640 3300017792 Bacteria 2753
394 Ga0163161_10071098 3300017792 Bacteria 2545
395 Ga0213876_10006978 3300021384 Bacteria 6156
396 Ga0209436_100329 3300025208 Bacteria 21518
397 Ga0209258_100032 3300025242 Bacteria 452764
398 Ga0209258_112036 3300025242 Bacteria 1073
399 Ga0207425_1024802 3300025245 Bacteria 1242
400 Ga0209646_1000004 3300025246 Bacteria 786587
401 Ga0209646_1000921 3300025246 Bacteria 9416
402 Ga0209026_1000192 3300025250 Bacteria 88221
403 Ga0209148_1000186 3300025254 Bacteria 117677
404 Ga0209129_1020980 3300025258 Bacteria 1205
405 Ga0209673_1000258 3300025273 Bacteria 100207
406 Ga0209675_1029097 3300025291 Bacteria 1334
407 Ga0209564_1006138 3300025295 Bacteria 6588
408 Ga0209758_1009737 3300025297 Bacteria 5903
409 Ga0209758_1019239 3300025297 Bacteria 3302
410 Ga0209050_1001018 3300025298 Bacteria 34976
411 Ga0207426_1000033 3300025302 Bacteria 455976
412 Ga0207426_1000594 3300025302 Bacteria 47795
413 Ga0207426_1000780 3300025302 Bacteria 34922
414 Ga0209051_1012467 3300025303 Bacteria 4110
415 Ga0209257_1002472 3300025304 Bacteria 18282
416 Ga0207697_10062396 3300025315 Bacteria 1552
417 Ga0207697_10144527 3300025315 Bacteria 1033
418 Ga0207656_10065045 3300025321 Bacteria 1609
419 Ga0207656_10231017 3300025321 Bacteria 902
420 Ga0207642_10144822 3300025899 Bacteria 1257
421 Ga0207688_10320785 3300025901 Bacteria 950
422 Ga0207680_10154004 3300025903 Bacteria 1535
423 Ga0207680_10566749 3300025903 Bacteria 811
424 Ga0207647_10006690 3300025904 Bacteria 8375
425 Ga0207647_10058415 3300025904 Bacteria 2362
426 Ga0207645_10008702 3300025907 Bacteria 7066
427 Ga0207645_10088406 3300025907 Bacteria 1992
428 Ga0207645_10442261 3300025907 Bacteria 877
429 Ga0207705_10028584 3300025909 Bacteria 3975
430 Ga0207705_10937142 3300025909 Unclassified 670
431 Ga0207654_10006717 3300025911 Bacteria 5784
432 Ga0207654_10185651 3300025911 Bacteria 1359
433 Ga0207654_10203308 3300025911 Bacteria 1305
434 Ga0207654_10313121 3300025911 Bacteria 1071
435 Ga0207707_10722912 3300025912 Bacteria 835
436 Ga0207695_10001230 3300025913 Bacteria 43841
437 Ga0207695_10009898 3300025913 Bacteria 11715
438 Ga0207695_10010595 3300025913 Bacteria 11268
439 Ga0207695_10014509 3300025913 Bacteria 9326
440 Ga0207695_10038750 3300025913 Bacteria 5126
441 Ga0207695_10560677 3300025913 Bacteria 1024
442 Ga0207671_10000311 3300025914 Bacteria 71753
443 Ga0207671_10002781 3300025914 Bacteria 18252
444 Ga0207671_10007499 3300025914 Bacteria 9463
445 Ga0207671_10012770 3300025914 Bacteria 6733
446 Ga0207671_10016200 3300025914 Bacteria 5803
447 Ga0207671_10063777 3300025914 Bacteria 2738
448 Ga0207660_10085252 3300025917 Bacteria 2330
449 Ga0207660_10099412 3300025917 Bacteria 2171
450 Ga0207660_10124974 3300025917 Bacteria 1953
451 Ga0207662_10049076 3300025918 Bacteria 2503
452 Ga0207662_10566324 3300025918 Bacteria 788
453 Ga0207657_10013163 3300025919 Bacteria 8122
454 Ga0207657_10043217 3300025919 Bacteria 3971
455 Ga0207657_10102440 3300025919 Bacteria 2374
456 Ga0207657_10142429 3300025919 Bacteria 1958
457 Ga0207657_10526935 3300025919 Bacteria 924
458 Ga0207649_10110237 3300025920 Bacteria 1837
459 Ga0207652_10002760 3300025921 Bacteria 14747
460 Ga0207652_10208279 3300025921 Bacteria 1760
461 Ga0207681_10112954 3300025923 Bacteria 1980
462 Ga0207681_10178699 3300025923 Bacteria 1615
463 Ga0207681_10243250 3300025923 Bacteria 1401
464 Ga0207694_10017189 3300025924 Bacteria 5466
465 Ga0207694_10060474 3300025924 Bacteria 2948
466 Ga0207694_10345824 3300025924 Bacteria 1230
467 Ga0207650_10132445 3300025925 Bacteria 1952
468 Ga0207650_10184171 3300025925 Bacteria 1666
469 Ga0207650_11375286 3300025925 Bacteria 601
470 Ga0207659_10008828 3300025926 Bacteria 6280
471 Ga0207659_10087627 3300025926 Bacteria 2318
472 Ga0207659_10147520 3300025926 Bacteria 1833
473 Ga0207659_10620642 3300025926 Bacteria 923
474 Ga0207659_11329245 3300025926 Unclassified 617
475 Ga0207700_10307286 3300025928 Bacteria 1371
476 Ga0207644_10670155 3300025931 Bacteria 864
477 Ga0207706_10009283 3300025933 Bacteria 9031
478 Ga0207706_10034680 3300025933 Bacteria 4489
479 Ga0207706_10131220 3300025933 Bacteria 2204
480 Ga0207686_10032197 3300025934 Bacteria 3119
481 Ga0207670_10093564 3300025936 Bacteria 2130
482 Ga0207670_10274523 3300025936 Bacteria 1312
483 Ga0207670_11029954 3300025936 Bacteria 693
484 Ga0207669_10272702 3300025937 Bacteria 1272
485 Ga0207669_10413314 3300025937 Bacteria 1060
486 Ga0207704_10680428 3300025938 Bacteria 850
487 Ga0207665_10964611 3300025939 Bacteria 678
488 Ga0207691_10006189 3300025940 Bacteria 11561
489 Ga0207691_10147063 3300025940 Bacteria 2073
490 Ga0207691_10321301 3300025940 Bacteria 1327
491 Ga0207691_10332236 3300025940 Bacteria 1302
492 Ga0207711_10156808 3300025941 Bacteria 2058
493 Ga0207689_10005993 3300025942 Bacteria 10751
494 Ga0207689_10019558 3300025942 Bacteria 5706
495 Ga0207689_10084542 3300025942 Bacteria 2608
496 Ga0207689_10155883 3300025942 Bacteria 1883
497 Ga0207661_10019604 3300025944 Bacteria 5046
498 Ga0207661_10133031 3300025944 Bacteria 2133
499 Ga0207661_10151192 3300025944 Bacteria 2007
500 Ga0207661_10908778 3300025944 Bacteria 811
501 Ga0207661_11403932 3300025944 Bacteria 641
502 Ga0207679_10001675 3300025945 Bacteria 13804
503 Ga0207679_10032297 3300025945 Bacteria 3673
504 Ga0207667_10000098 3300025949 Bacteria 140051
505 Ga0207667_10017026 3300025949 Bacteria 8198
506 Ga0207667_10062322 3300025949 Bacteria 3900
507 Ga0207667_10096038 3300025949 Bacteria 3059
508 Ga0207667_10270369 3300025949 Bacteria 1738
509 Ga0207667_10475313 3300025949 Bacteria 1269
510 Ga0207651_10280758 3300025960 Bacteria 1376
511 Ga0207651_10366333 3300025960 Bacteria 1218
512 Ga0207712_10078276 3300025961 Bacteria 2399
513 Ga0207668_10210037 3300025972 Bacteria 1556
514 Ga0207668_10252966 3300025972 Bacteria 1432
515 Ga0207640_10131713 3300025981 Bacteria 1809
516 Ga0207640_10172343 3300025981 Bacteria 1614
517 Ga0207640_10337458 3300025981 Bacteria 1206
518 Ga0207640_10412645 3300025981 Bacteria 1103
519 Ga0207640_10709979 3300025981 Bacteria 863
520 Ga0207658_10031002 3300025986 Bacteria 3793
521 Ga0207658_10196180 3300025986 Bacteria 1682
522 Ga0207658_10391583 3300025986 Bacteria 1219
523 Ga0207658_10490319 3300025986 Bacteria 1093
524 Ga0207658_10559709 3300025986 Bacteria 1024
525 Ga0207677_11665365 3300026023 Bacteria 591
526 Ga0207703_11110466 3300026035 Bacteria 760
527 Ga0207639_10015901 3300026041 Bacteria 5314
528 Ga0207639_10083313 3300026041 Bacteria 2538
529 Ga0207639_10150844 3300026041 Bacteria 1946
530 Ga0207639_10181205 3300026041 Bacteria 1792
531 Ga0207639_10194763 3300026041 Bacteria 1734
532 Ga0207639_10196563 3300026041 Bacteria 1727
533 Ga0207639_10215795 3300026041 Bacteria 1654
534 Ga0207639_10336027 3300026041 Bacteria 1345
535 Ga0207639_10355955 3300026041 Bacteria 1309
536 Ga0207639_10712315 3300026041 Bacteria 932
537 Ga0207678_10081466 3300026067 Bacteria 2770
538 Ga0207678_10260923 3300026067 Bacteria 1485
539 Ga0207702_10026609 3300026078 Bacteria 4803
540 Ga0207702_10335412 3300026078 Bacteria 1443
541 Ga0207702_10522585 3300026078 Bacteria 1159
542 Ga0207641_10149855 3300026088 Bacteria 2112
543 Ga0207641_10170700 3300026088 Bacteria 1985
544 Ga0207641_10374416 3300026088 Bacteria 1362
545 Ga0207641_10552503 3300026088 Unclassified 1123
546 Ga0207648_10012780 3300026089 Bacteria 7844
547 Ga0207648_10023408 3300026089 Bacteria 5533
548 Ga0207648_10044966 3300026089 Bacteria 3873
549 Ga0207648_10248184 3300026089 Bacteria 1586
550 Ga0207648_10439860 3300026089 Bacteria 1186
551 Ga0207648_10781897 3300026089 Bacteria 888
552 Ga0207676_10087749 3300026095 Bacteria 2545
553 Ga0207676_10101172 3300026095 Bacteria 2389
554 Ga0207676_10172812 3300026095 Bacteria 1884
555 Ga0207676_10206081 3300026095 Bacteria 1741
556 Ga0207674_10000969 3300026116 Bacteria 37567
557 Ga0207674_10014175 3300026116 Bacteria 8811
558 Ga0207674_10014702 3300026116 Bacteria 8631
559 Ga0207674_10025103 3300026116 Bacteria 6360
560 Ga0207674_10034066 3300026116 Bacteria 5326
561 Ga0207674_10185220 3300026116 Bacteria 2033
562 Ga0207674_10660554 3300026116 Unclassified 1009
563 Ga0207674_11172619 3300026116 Bacteria 738
564 Ga0207674_11684163 3300026116 Bacteria 602
565 Ga0207675_100266147 3300026118 Bacteria 1662
566 Ga0207675_100329200 3300026118 Bacteria 1493
567 Ga0207675_100830925 3300026118 Bacteria 938
568 Ga0207675_101435595 3300026118 Bacteria 711
569 Ga0207675_101651844 3300026118 Bacteria 661
570 Ga0207683_10004664 3300026121 Bacteria 11817
571 Ga0207683_10045803 3300026121 Bacteria 3825
572 Ga0207683_10100616 3300026121 Bacteria 2581
573 Ga0207698_10021209 3300026142 Bacteria 4488
574 Ga0207698_10051034 3300026142 Bacteria 3160
575 Ga0207698_10052541 3300026142 Bacteria 3123
576 Ga0207698_10174898 3300026142 Bacteria 1895
577 Ga0207698_10345297 3300026142 Bacteria 1403
578 Ga0207698_10809631 3300026142 Bacteria 939
579 Ga0207698_10859943 3300026142 Bacteria 912
580 Ga0209969_1023408 3300027360 Bacteria 926
581 Ga0209995_1004101 3300027471 Bacteria 2325
582 Ga0209971_1041396 3300027682 Unclassified 1109
583 Ga0209974_10068612 3300027876 Bacteria 1207
584 Ga0207428_10130466 3300027907 Bacteria 1923
585 Ga0268266_10008277 3300028379 Bacteria 9267
586 Ga0268266_10062165 3300028379 Bacteria 3222
587 Ga0268266_10094525 3300028379 Bacteria 2624
588 Ga0268266_10472899 3300028379 Bacteria 1194
589 Ga0268265_10015032 3300028380 Bacteria 5286
590 Ga0268265_10595482 3300028380 Bacteria 1056
591 Ga0268264_10000079 3300028381 Bacteria 249516
592 Ga0268264_10007764 3300028381 Bacteria 8933
593 Ga0268264_10015227 3300028381 Bacteria 6309
594 Ga0268264_10258960 3300028381 Bacteria 1620
595 Ga0268264_11495320 3300028381 Bacteria 686
596 Ga0307517_10327950 3300028786 Bacteria 843
597 Ga0307515_10000001 3300028794 Bacteria 4259510
598 Ga0307515_10000059 3300028794 Bacteria 257520
599 Ga0307511_10022566 3300030521 Bacteria 5895
600 Ga0265327_10000013 3300031251 Bacteria 519549
601 Ga0265327_10000030 3300031251 Bacteria 333531
602 Ga0265327_10057725 3300031251 Bacteria 1996
603 Ga0307513_10178127 3300031456 Bacteria 1993
604 Ga0307514_10338550 3300031649 Bacteria 812
605 Ga0265314_10132806 3300031711 Bacteria 1550
606 Ga0307516_10003458 3300031730 Bacteria 20249
607 Ga0307516_10241696 3300031730 Bacteria 1503
608 Ga0307413_10406011 3300031824 Bacteria 1069
609 Ga0307410_10358699 3300031852 Unclassified 1167
610 Ga0307410_10404322 3300031852 Bacteria 1104
611 Ga0307409_100654231 3300031995 Bacteria 1045
612 Ga0307416_100747113 3300032002 Bacteria 1071
613 Ga0307416_101483349 3300032002 Bacteria 784
614 Ga0307414_10074124 3300032004 Bacteria 2465
615 Ga0307414_11313697 3300032004 Bacteria 671
616 Ga0307411_10860403 3300032005 Bacteria 803
617 Ga0307415_100755866 3300032126 Bacteria 883
618 Ga0307415_101102587 3300032126 Bacteria 743
619 Ga0307510_10009446 3300033180 Bacteria 11614
620 Ga0316214_1038468 3300033545 Bacteria 685
621 Ga0373934_0198739 3300035086 Bacteria 825
622 Ga0373953_0080711 3300035117 Bacteria 1352
623 Ga0373954_0166526 3300035118 Bacteria 1079
624 Ga0373955_0070860 3300035172 Bacteria 1948
625 Ga0373924_0133640 3300035410 Bacteria 1080
626 Ga0373935_0138643 3300035692 Bacteria 1641
627 Ga0373935_0194986 3300035692 Bacteria 1397
628 Ga0373937_0040867 3300036401 Bacteria 4228
629 Ga0373925_0119354 3300037068 Bacteria 2046
630 Ga0395899_0012303 3300037312 Bacteria 6555
631 Ga0395899_0078033 3300037312 Bacteria 2415
632 Ga0395900_0015690 3300037418 Bacteria 7722
633 Ga0395900_0187516 3300037418 Bacteria 2099
634 Ga0395898_0024421 3300037466 Bacteria 6096
635 Ga0395905_0002365 3300037471 Bacteria 21010
636 Ga0395905_0065491 3300037471 Bacteria 3402
637 Ga0395901_0004445 3300038443 Bacteria 14139
638 Ga0395901_0431605 3300038443 Bacteria 1350
639 Ga0436365_0311643 3300039437 Bacteria 16902
640 Ga0436365_0918024 3300039437 Bacteria 720
641 Ga0436362_0886610 3300039453 Bacteria 775
642 Ga0439436_0000160 3300041404 Bacteria 15790
643 Ga0439436_0038169 3300041404 Bacteria 1382
644 Ga0439439_0002072 3300041406 Bacteria 4180
645 Ga0439465_0040095 3300041413 Bacteria 1513
646 Ga0451802_1207351 3300041460 Bacteria 983
647 Ga0451851_0296872 3300041507 Bacteria 591
648 Ga0451843_0090240 3300041509 Bacteria 633
649 Ga0451843_1769404 3300041509 Bacteria 977
650 Ga0439431_0000806 3300041997 Bacteria 6768
651 Ga0439433_0021554 3300041999 Bacteria 1442
652 Ga0439445_0057213 3300042004 Bacteria 1061
653 Ga0439449_0008071 3300042007 Bacteria 4000
654 Ga0439449_0013227 3300042007 Bacteria 3104
655 Ga0439449_0017949 3300042007 Bacteria 2656
656 Ga0439449_0187938 3300042007 Bacteria 773
657 Ga0439457_003842 3300042014 Bacteria 4024
658 Ga0439462_0014378 3300042015 Bacteria 2033
659 Ga0439462_0117773 3300042015 Bacteria 738
660 Ga0450898_009254 3300042134 Bacteria 1572
661 Ga0450899_043287 3300042135 Bacteria 566
662 Ga0450908_056495 3300042184 Bacteria 686
663 Ga0439434_0037134 3300042435 Bacteria 1491
664 Ga0450893_0039269 3300042532 Bacteria 864
665 Ga0451577_0493722 3300042876 Bacteria 1111
666 Ga0466969_0048045 3300044656 Bacteria 2111
667 Ga0466972_0000082 3300044658 Bacteria 88592
668 Ga0466972_0000146 3300044658 Bacteria 57580
669 Ga0466972_0015319 3300044658 Bacteria 3833
670 Ga0466972_0024449 3300044658 Bacteria 2997
671 Ga0466972_0031023 3300044658 Bacteria 2631
672 Ga0453683_0111624 3300044673 Bacteria 1719
673 Ga0466965_0075261 3300044683 Bacteria 1702
674 Ga0466965_0126383 3300044683 Bacteria 1323
675 Ga0466965_0270324 3300044683 Bacteria 916
676 Ga0466966_0165376 3300044684 Bacteria 1346
677 Ga0453684_0157320 3300044712 Bacteria 2692
678 Ga0453684_0183866 3300044712 Bacteria 2451
679 Ga0453684_0890069 3300044712 Bacteria 954
680 Ga0466968_0046866 3300044735 Bacteria 1837
681 Ga0466970_0170791 3300044765 Bacteria 1205
682 Ga0466957_0000381 3300044842 Bacteria 21723
683 Ga0466957_0006481 3300044842 Bacteria 6610
684 Ga0466957_0426924 3300044842 Bacteria 910
685 Ga0466959_0032925 3300045049 Bacteria 3836
686 Ga0466959_0112955 3300045049 Bacteria 1937
687 Ga0451576_0381844 3300045051 Bacteria 1477
688 Ga0466958_0032173 3300045836 Bacteria 3120
689 Ga0495592_0374909 3300046454 Bacteria 907
690 Ga0495629_0099643 3300046459 Bacteria 2028
691 Ga0495638_0009863 3300046460 Bacteria 6665
692 Ga0495653_0292053 3300046463 Bacteria 1066
693 Ga0495650_0044451 3300046471 Bacteria 1878
694 Ga0495664_0284396 3300046477 Bacteria 999
695 Ga0495606_0034998 3300046507 Bacteria 3439
696 Ga0495608_0026304 3300046511 Bacteria 3968
697 Ga0495630_0146876 3300046517 Bacteria 1793
698 Ga0495632_0321043 3300046519 Bacteria 684
699 Ga0495648_0001246 3300046524 Bacteria 25445
700 Ga0495652_0042704 3300046529 Bacteria 3909
701 Ga0495652_0521171 3300046529 Bacteria 821
702 Ga0495586_0214507 3300046535 Bacteria 1093
703 Ga0495587_0047268 3300046536 Bacteria 2552
704 Ga0495598_0090883 3300046537 Bacteria 995
705 Ga0495645_0075044 3300046543 Bacteria 2434
706 Ga0495667_0213350 3300046559 Bacteria 1233
707 Ga0495668_0000202 3300046616 Bacteria 87083
708 Ga0495634_0375114 3300046642 Bacteria 848
709 Ga0495634_0511427 3300046642 Bacteria 703
710 Ga0495611_0001026 3300046648 Bacteria 14788
711 Ga0495625_0092176 3300046660 Bacteria 2094
712 Ga0495635_0031039 3300046663 Bacteria 3712
713 Ga0495669_0291642 3300046684 Bacteria 786
714 Ga0495649_0431637 3300046694 Bacteria 659
715 Ga0495649_0451804 3300046694 Bacteria 642
716 Ga0495600_0018974 3300046809 Bacteria 4389
717 Ga0495604_0071896 3300047317 Bacteria 2616
718 Ga0495674_0218995 3300047319 Bacteria 1574
719 Ga0495676_0848344 3300047321 Bacteria 587
720 Ga0495687_000886 3300047443 Bacteria 31629
721 Ga0495684_0141387 3300047471 Bacteria 1804
722 Ga0495686_0225644 3300047472 Bacteria 1063
723 Ga0495686_0265761 3300047472 Bacteria 959
724 Ga0496100_0550662 3300048903 Bacteria 892
725 Ga0496101_0042227 3300048904 Bacteria 3255
726 Ga0496105_0366662 3300048908 Bacteria 1148
727 Ga0496106_0181322 3300048909 Bacteria 1672
728 Ga0496109_0355081 3300048912 Bacteria 1385
729 Ga0496110_0459186 3300048913 Bacteria 1161
730 Ga0496114_0000538 3300048917 Bacteria 27938
731 Ga0496114_0050742 3300048917 Bacteria 3454
732 Ga0496115_0744153 3300048918 Bacteria 767
733 Ga0496124_0049547 3300048927 Bacteria 3583
734 Ga0501298_108037 3300049521 Bacteria 642
735 Ga0501335_007011 3300049551 Bacteria 1035
736 Ga0501031_0024784 3300049568 Bacteria 3911
737 Ga0501032_0009186 3300049569 Bacteria 7166
738 Ga0501032_0196001 3300049569 Bacteria 1319
739 Ga0501034_0000004 3300049571 Bacteria 382255
740 Ga0501034_0030378 3300049571 Bacteria 5493
741 Ga0501034_0152617 3300049571 Bacteria 2285
742 Ga0501036_0210844 3300049572 Bacteria 1632
743 Ga0501037_0019254 3300049573 Bacteria 5032
744 Ga0501037_0044258 3300049573 Bacteria 3269
745 Ga0501038_0048321 3300049574 Unclassified 3682
746 Ga0501038_0058848 3300049574 Bacteria 3293
747 Ga0501038_0751902 3300049574 Bacteria 727
748 Ga0501039_0156785 3300049575 Bacteria 1789
749 Ga0501040_0168557 3300049576 Unclassified 1550
750 Ga0501043_0019687 3300049579 Bacteria 5300
751 Ga0501046_0077826 3300049580 Bacteria 2567
752 Ga0501047_0107962 3300049581 Bacteria 2665
753 Ga0501047_0258382 3300049581 Bacteria 1590
754 Ga0501047_0259607 3300049581 Bacteria 1585
755 Ga0501068_0213485 3300049584 Unclassified 1226
756 Ga0501070_0228816 3300049586 Bacteria 1524
757 Ga0501072_0129038 3300049588 Bacteria 2015
758 Ga0501202_001707 3300049652 Bacteria 3561
759 Ga0501217_026917 3300049661 Bacteria 1392
760 Ga0501222_013011 3300049662 Bacteria 1096
761 Ga0501223_009110 3300049663 Bacteria 2015
762 Ga0501228_022452 3300049666 Bacteria 723
763 Ga0501235_059660 3300049669 Bacteria 892
764 Ga0501236_045667 3300049670 Bacteria 738
765 Ga0501240_072150 3300049673 Bacteria 627
766 Ga0501252_021502 3300049682 Bacteria 846
767 Ga0501259_090520 3300049688 Bacteria 687
768 Ga0501221_116871 3300049704 Bacteria 678
769 Ga0501225_0001644 3300049705 Bacteria 6977
770 Ga0501245_027499 3300049708 Bacteria 923
771 Ga0501080_0266670 3300049742 Bacteria 1559
772 Ga0501241_003800 3300049758 Bacteria 2845
773 Ga0501266_002964 3300049763 Bacteria 2115
774 Ga0501273_064702 3300049770 Bacteria 583
775 Ga0501035_0058002 3300049822 Bacteria 3451
776 Ga0501044_0057853 3300049823 Bacteria 3977
777 Ga0501044_0249915 3300049823 Bacteria 1715
778 Ga0501204_042040 3300049850 Bacteria 673
779 nmdc:mga0k408_152717_c1 3300050493 Bacteria 1375
780 nmdc:mga0k408_347611_c1 3300050493 Bacteria 884
781 nmdc:mga0k408_365215_c1 3300050493 Bacteria 860
782 nmdc:mga0k408_83869_c1 3300050493 Bacteria 1869
783 nmdc:mga07m45_100577_c1 3300050496 Bacteria 1660
784 nmdc:mga07m45_177196_c1 3300050496 Bacteria 1239
785 nmdc:mga05p37_278481_c1 3300050507 Bacteria 1996
786 nmdc:mga08y16_7939_c1 3300050511 Bacteria 11107
787 nmdc:mga0n895_40693_c1 3300050512 Bacteria 4515
788 Ga0495619_0293753 3300053085 Bacteria 1126
789 Ga0500578_0000063 3300053086 Bacteria 117869
790 Ga0500578_0234069 3300053086 Bacteria 1112
791 Ga0500644_0000042 3300053088 Bacteria 76909
792 Ga0500644_0029590 3300053088 Bacteria 1724
793 Ga0500646_0002688 3300053090 Bacteria 4591
794 Ga0500646_0058349 3300053090 Bacteria 1130
795 Ga0500583_0000076 3300053092 Bacteria 59162
796 Ga0500583_0011401 3300053092 Bacteria 3348
797 Ga0500583_0026172 3300053092 Bacteria 2501
798 Ga0500651_0453384 3300053093 Bacteria 713
799 Ga0500650_0106245 3300053098 Bacteria 1312
800 Ga0500562_000013 3300053108 Bacteria 150003
801 Ga0500569_000551 3300053109 Bacteria 6285
802 Ga0500572_003120 3300053111 Bacteria 3843
803 Ga0500594_0019590 3300053118 Bacteria 1679
804 Ga0500607_024676 3300053121 Bacteria 3354
805 Ga0500628_023766 3300053129 Bacteria 1266
806 Ga0500642_0057945 3300053130 Bacteria 1730
807 Ga0500652_007276 3300053131 Bacteria 3614
808 Ga0500655_080816 3300053133 Bacteria 669
809 Ga0500658_0013681 3300053134 Bacteria 3000
810 Ga0500559_0007408 3300053136 Bacteria 4866
811 Ga0500568_0000080 3300053139 Bacteria 92694
812 Ga0500568_0065045 3300053139 Bacteria 1404
813 Ga0500577_0000839 3300053142 Bacteria 7946
814 Ga0500588_0054050 3300053146 Bacteria 1263
815 Ga0500590_066310 3300053148 Bacteria 1802
816 Ga0500590_214684 3300053148 Bacteria 800
817 Ga0500616_0074910 3300053153 Bacteria 1715
818 Ga0500616_0080468 3300053153 Bacteria 1638
819 Ga0500616_0226325 3300053153 Bacteria 812
820 Ga0500622_0000242 3300053156 Bacteria 56575
821 Ga0500622_0000939 3300053156 Bacteria 24779
822 Ga0500622_0006674 3300053156 Bacteria 6650
823 Ga0500633_0002773 3300053160 Bacteria 3682
824 Ga0500636_0278058 3300053177 Bacteria 837
825 Ga0500637_0215991 3300053178 Bacteria 1086
826 Ga0500584_075481 3300053726 Bacteria 1459
827 Ga0500611_000060 3300053727 Bacteria 47744
828 Ga0500661_005067 3300055283 Bacteria 2468
829 Ga0500661_014284 3300055283 Bacteria 1429
830 Ga0587077_012566 3300059493 Bacteria 1356
831 Ga0466962_0005005 3300061719 Bacteria 6372
832 Ga0466962_0088987 3300061719 Bacteria 1479
833 Ga0466962_0092693 3300061719 Bacteria 1448
834 Ga0466962_0180847 3300061719 Bacteria 1028

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_10234822 Ga0105246_102348222 144
2 3300013296 Ga0157374_10041765 Ga0157374_100417655 144
3 3300013297 Ga0157378_10003727 Ga0157378_1000372712 144
4 3300049850 Ga0501204_042040 Ga0501204_042040_19_507 153
5 3300013307 Ga0157372_10188258 Ga0157372_101882583 154
6 3300014326 Ga0157380_10526802 Ga0157380_105268021 154
7 3300037312 Ga0395899_0078033 Ga0395899_0078033_959_1471 155
8 3300037418 Ga0395900_0187516 Ga0395900_0187516_494_1006 155
9 3300037471 Ga0395905_0002365 Ga0395905_0002365_9646_10158 155
10 3300037471 Ga0395905_0065491 Ga0395905_0065491_1815_2327 155
11 3300038443 Ga0395901_0431605 Ga0395901_0431605_28_540 155
12 3300005353 Ga0070669_100597678 Ga0070669_1005976782 156
13 3300005843 Ga0068860_101823472 Ga0068860_1018234721 156
14 3300013307 Ga0157372_10032041 Ga0157372_100320413 156
15 3300028381 Ga0268264_11495320 Ga0268264_114953201 156
16 3300045049 Ga0466959_0032925 Ga0466959_0032925_514_1026 156
17 3300045836 Ga0466958_0032173 Ga0466958_0032173_368_880 156
18 3300061719 Ga0466962_0005005 Ga0466962_0005005_3947_4459 156
19 3300006871 Ga0075434_100046233 Ga0075434_1000462332 157
20 3300013297 Ga0157378_11098334 Ga0157378_110983341 157
21 3300014968 Ga0157379_10268713 Ga0157379_102687132 157
22 3300032002 Ga0307416_100747113 Ga0307416_1007471132 157
23 3300050512 nmdc:mga0n895_40693_c1 nmdc:mga0n895_40693_c1_3251_3760 157
24 3300041404 Ga0439436_0000160 Ga0439436_0000160_1568_2047 159
25 3300041406 Ga0439439_0002072 Ga0439439_0002072_1646_2125 159
26 3300041999 Ga0439433_0021554 Ga0439433_0021554_371_850 159
27 3300042007 Ga0439449_0013227 Ga0439449_0013227_898_1377 159
28 3300042014 Ga0439457_003842 Ga0439457_003842_1190_1669 159
29 3300042015 Ga0439462_0014378 Ga0439462_0014378_938_1417 159
30 3300042135 Ga0450899_043287 Ga0450899_043287_17_496 159
31 3300005329 Ga0070683_100981511 Ga0070683_1009815112 160
32 3300005458 Ga0070681_10221963 Ga0070681_102219633 160
33 3300013100 Ga0157373_10040922 Ga0157373_100409222 160
34 3300025912 Ga0207707_10722912 Ga0207707_107229122 160
35 3300027360 Ga0209969_1023408 Ga0209969_10234082 160
36 3300027471 Ga0209995_1004101 Ga0209995_10041012 160
37 3300027682 Ga0209971_1041396 Ga0209971_10413962 160
38 3300027876 Ga0209974_10068612 Ga0209974_100686121 160
39 3300028794 Ga0307515_10000059 Ga0307515_10000059144 160
40 3300005354 Ga0070675_100511190 Ga0070675_1005111901 161
41 3300014968 Ga0157379_10451648 Ga0157379_104516482 161
42 3300025926 Ga0207659_11329245 Ga0207659_113292451 161
43 3300026118 Ga0207675_101651844 Ga0207675_1016518441 162
44 3300049568 Ga0501031_0024784 Ga0501031_0024784_2930_3448 162
45 3300049569 Ga0501032_0196001 Ga0501032_0196001_298_906 162
46 3300049572 Ga0501036_0210844 Ga0501036_0210844_10_528 162
47 3300049573 Ga0501037_0044258 Ga0501037_0044258_1188_1706 162
48 3300049574 Ga0501038_0048321 Ga0501038_0048321_1668_2249 162
49 3300049576 Ga0501040_0168557 Ga0501040_0168557_946_1464 162
50 3300049580 Ga0501046_0077826 Ga0501046_0077826_985_1503 162
51 3300049584 Ga0501068_0213485 Ga0501068_0213485_277_885 162
52 3300049588 Ga0501072_0129038 Ga0501072_0129038_82_600 162
53 3300049822 Ga0501035_0058002 Ga0501035_0058002_1590_2108 162
54 3300013307 Ga0157372_10058652 Ga0157372_100586522 163
55 3300013307 Ga0157372_11243537 Ga0157372_112435371 163
56 3300025321 Ga0207656_10231017 Ga0207656_102310171 163
57 3300026089 Ga0207648_10439860 Ga0207648_104398601 163
58 3300005335 Ga0070666_10173715 Ga0070666_101737152 164
59 3300006237 Ga0097621_100114616 Ga0097621_1001146162 164
60 3300013307 Ga0157372_10226830 Ga0157372_102268303 164
61 3300014326 Ga0157380_10865854 Ga0157380_108658542 164
62 3300031852 Ga0307410_10404322 Ga0307410_104043222 164
63 3300031995 Ga0307409_100654231 Ga0307409_1006542311 165
64 3300039437 Ga0436365_0918024 Ga0436365_0918024_99_614 165
65 3300049662 Ga0501222_013011 Ga0501222_013011_51_575 165
66 3300049666 Ga0501228_022452 Ga0501228_022452_171_695 165
67 3300049669 Ga0501235_059660 Ga0501235_059660_22_546 165
68 3300049673 Ga0501240_072150 Ga0501240_072150_44_568 165
69 3300049682 Ga0501252_021502 Ga0501252_021502_29_553 165
70 3300049708 Ga0501245_027499 Ga0501245_027499_380_904 165
71 3300049763 Ga0501266_002964 Ga0501266_002964_633_1157 165
72 iso_pu_bacteria 2738541278 2738725600 165
73 3300005618 Ga0068864_101256703 Ga0068864_1012567031 166
74 3300048917 Ga0496114_0000538 Ga0496114_0000538_3857_4369 166
75 3300053090 Ga0500646_0058349 Ga0500646_0058349_193_693 166
76 3300053108 Ga0500562_000013 Ga0500562_000013_57498_57998 166
77 3300053118 Ga0500594_0019590 Ga0500594_0019590_309_809 166
78 iso_pu_bacteria 2929154850 2929159597 166
79 3300005335 Ga0070666_10187414 Ga0070666_101874142 167
80 3300005367 Ga0070667_100833897 Ga0070667_1008338971 167
81 3300005539 Ga0068853_100528449 Ga0068853_1005284492 167
82 3300005614 Ga0068856_100055686 Ga0068856_1000556862 167
83 3300005616 Ga0068852_100045245 Ga0068852_1000452454 167
84 3300005616 Ga0068852_100916598 Ga0068852_1009165982 167
85 3300005618 Ga0068864_100046635 Ga0068864_1000466354 167
86 3300009545 Ga0105237_10003705 Ga0105237_1000370513 167
87 3300009545 Ga0105237_10013196 Ga0105237_100131967 167
88 3300010375 Ga0105239_10009226 Ga0105239_100092262 167
89 3300013306 Ga0163162_10863198 Ga0163162_108631982 167
90 3300025911 Ga0207654_10006717 Ga0207654_100067173 167
91 3300025913 Ga0207695_10014509 Ga0207695_100145095 167
92 3300025914 Ga0207671_10002781 Ga0207671_100027817 167
93 3300025914 Ga0207671_10007499 Ga0207671_100074995 167
94 3300025914 Ga0207671_10012770 Ga0207671_100127702 167
95 3300025924 Ga0207694_10017189 Ga0207694_100171894 167
96 3300025949 Ga0207667_10475313 Ga0207667_104753132 167
97 3300025986 Ga0207658_10490319 Ga0207658_104903191 167
98 3300026041 Ga0207639_10196563 Ga0207639_101965632 167
99 3300026078 Ga0207702_10335412 Ga0207702_103354122 167
100 3300026095 Ga0207676_10206081 Ga0207676_102060811 167
101 3300026142 Ga0207698_10021209 Ga0207698_100212092 167
102 3300042876 Ga0451577_0493722 Ga0451577_0493722_110_628 167
103 3300044683 Ga0466965_0270324 Ga0466965_0270324_202_711 167
104 3300044712 Ga0453684_0157320 Ga0453684_0157320_523_1041 167
105 3300049742 Ga0501080_0266670 Ga0501080_0266670_873_1382 167
106 3300055283 Ga0500661_014284 Ga0500661_014284_679_1182 167
107 3300061719 Ga0466962_0180847 Ga0466962_0180847_502_1011 167
108 iso_pu_bacteria 2818991442 2819574675 167
109 iso_pu_bacteria 2818991460 2819676574 167
110 iso_pu_bacteria 2821136567 2821140766 167
111 iso_pu_bacteria 2840677318 2840678472 167
112 iso_pu_bacteria 2883068021 2883071389 167
113 iso_pu_bacteria 2884791551 2884796437 167
114 iso_pu_bacteria 2896085136 2896086290 167
115 iso_pu_bacteria 2896109856 2896113417 167
116 iso_pu_bacteria 2904467357 2904471268 167
117 iso_pu_bacteria 2929177148 2929178050 167
118 iso_pu_bacteria 2929239360 2929240378 167
119 iso_pu_bacteria 2929921140 2929922125 167
120 iso_pu_bacteria 2945977869 2945980410 167
121 iso_pu_bacteria 2946013367 2946013727 167
122 iso_pu_bacteria 8003151029 8003155660 167
123 3300003320 rootH2_10149464 rootH2_101494642 168
124 3300005290 Ga0065712_10030184 Ga0065712_100301842 168
125 3300005331 Ga0070670_100261512 Ga0070670_1002615122 168
126 3300005338 Ga0068868_100083535 Ga0068868_1000835352 168
127 3300005339 Ga0070660_100584631 Ga0070660_1005846311 168
128 3300005343 Ga0070687_100894375 Ga0070687_1008943751 168
129 3300005347 Ga0070668_100400452 Ga0070668_1004004522 168
130 3300005353 Ga0070669_100399589 Ga0070669_1003995892 168
131 3300005354 Ga0070675_100131302 Ga0070675_1001313022 168
132 3300005355 Ga0070671_100722618 Ga0070671_1007226181 168
133 3300005364 Ga0070673_100176585 Ga0070673_1001765852 168
134 3300005459 Ga0068867_100740619 Ga0068867_1007406192 168
135 3300005539 Ga0068853_100917069 Ga0068853_1009170691 168
136 3300005543 Ga0070672_100335842 Ga0070672_1003358422 168
137 3300005577 Ga0068857_100004302 Ga0068857_1000043021 168
138 3300005577 Ga0068857_100372094 Ga0068857_1003720942 168
139 3300005578 Ga0068854_100124556 Ga0068854_1001245563 168
140 3300005616 Ga0068852_100000989 Ga0068852_10000098917 168
141 3300005843 Ga0068860_100661574 Ga0068860_1006615742 168
142 3300006163 Ga0070715_10206605 Ga0070715_102066052 168
143 3300006237 Ga0097621_100030125 Ga0097621_1000301252 168
144 3300006358 Ga0068871_100004499 Ga0068871_1000044992 168
145 3300009093 Ga0105240_10000800 Ga0105240_1000080024 168
146 3300009093 Ga0105240_10073546 Ga0105240_100735465 168
147 3300009093 Ga0105240_10194738 Ga0105240_101947382 168
148 3300009174 Ga0105241_10001809 Ga0105241_100018098 168
149 3300009174 Ga0105241_10042701 Ga0105241_100427011 168
150 3300009176 Ga0105242_10700684 Ga0105242_107006842 168
151 3300009545 Ga0105237_10027884 Ga0105237_100278847 168
152 3300009545 Ga0105237_10336811 Ga0105237_103368112 168
153 3300009545 Ga0105237_11214807 Ga0105237_112148072 168
154 3300009551 Ga0105238_10000592 Ga0105238_1000059221 168
155 3300009551 Ga0105238_10041982 Ga0105238_100419825 168
156 3300009553 Ga0105249_10361403 Ga0105249_103614032 168
157 3300010375 Ga0105239_10061440 Ga0105239_100614402 168
158 3300013104 Ga0157370_10005329 Ga0157370_1000532914 168
159 3300013105 Ga0157369_10027331 Ga0157369_100273312 168
160 3300013296 Ga0157374_10893854 Ga0157374_108938541 168
161 3300013297 Ga0157378_10006316 Ga0157378_100063162 168
162 3300013307 Ga0157372_10002332 Ga0157372_100023325 168
163 3300013307 Ga0157372_10023290 Ga0157372_100232906 168
164 3300014325 Ga0163163_10303744 Ga0163163_103037442 168
165 3300014326 Ga0157380_10095826 Ga0157380_100958263 168
166 3300017792 Ga0163161_10071098 Ga0163161_100710983 168
167 3300025904 Ga0207647_10006690 Ga0207647_100066905 168
168 3300025907 Ga0207645_10442261 Ga0207645_104422612 168
169 3300025913 Ga0207695_10001230 Ga0207695_1000123043 168
170 3300025913 Ga0207695_10010595 Ga0207695_100105957 168
171 3300025914 Ga0207671_10063777 Ga0207671_100637773 168
172 3300025918 Ga0207662_10566324 Ga0207662_105663241 168
173 3300025919 Ga0207657_10526935 Ga0207657_105269351 168
174 3300025923 Ga0207681_10112954 Ga0207681_101129542 168
175 3300025924 Ga0207694_10345824 Ga0207694_103458242 168
176 3300025925 Ga0207650_10184171 Ga0207650_101841713 168
177 3300025926 Ga0207659_10147520 Ga0207659_101475203 168
178 3300025937 Ga0207669_10413314 Ga0207669_104133142 168
179 3300025940 Ga0207691_10321301 Ga0207691_103213012 168
180 3300025949 Ga0207667_10000098 Ga0207667_10000098108 168
181 3300025960 Ga0207651_10366333 Ga0207651_103663332 168
182 3300025981 Ga0207640_10131713 Ga0207640_101317132 168
183 3300026041 Ga0207639_10083313 Ga0207639_100833132 168
184 3300026041 Ga0207639_10150844 Ga0207639_101508441 168
185 3300026041 Ga0207639_10215795 Ga0207639_102157952 168
186 3300026116 Ga0207674_10000969 Ga0207674_1000096939 168
187 3300026116 Ga0207674_10660554 Ga0207674_106605542 168
188 3300031711 Ga0265314_10132806 Ga0265314_101328062 168
189 3300031730 Ga0307516_10003458 Ga0307516_100034582 168
190 3300031730 Ga0307516_10241696 Ga0307516_102416962 168
191 3300031824 Ga0307413_10406011 Ga0307413_104060112 168
192 3300031852 Ga0307410_10358699 Ga0307410_103586992 168
193 3300032002 Ga0307416_101483349 Ga0307416_1014833491 168
194 3300032004 Ga0307414_11313697 Ga0307414_113136971 168
195 3300032005 Ga0307411_10860403 Ga0307411_108604032 168
196 3300032126 Ga0307415_101102587 Ga0307415_1011025871 168
197 3300046460 Ga0495638_0009863 Ga0495638_0009863_1756_2277 168
198 3300048918 Ga0496115_0744153 Ga0496115_0744153_177_689 168
199 3300053093 Ga0500651_0453384 Ga0500651_0453384_135_656 168
200 3300053133 Ga0500655_080816 Ga0500655_080816_92_613 168
201 3300053139 Ga0500568_0000080 Ga0500568_0000080_64316_64825 168
202 3300053148 Ga0500590_214684 Ga0500590_214684_203_724 168
203 3300053178 Ga0500637_0215991 Ga0500637_0215991_431_952 168
204 iso_pu_bacteria 2818991444 2819585677 168
205 3300002077 JGI24744J21845_10006042 JGI24744J21845_100060424 169
206 3300003316 rootH1_10044617 rootH1_100446177 169
207 3300003320 rootH2_10076327 rootH2_100763277 169
208 3300003323 rootH1_10016772 rootH1_1001677214 169
209 3300005288 Ga0065714_10137470 Ga0065714_101374702 169
210 3300005328 Ga0070676_10009154 Ga0070676_100091542 169
211 3300005329 Ga0070683_100002314 Ga0070683_1000023149 169
212 3300005329 Ga0070683_101251328 Ga0070683_1012513281 169
213 3300005330 Ga0070690_100024106 Ga0070690_1000241062 169
214 3300005334 Ga0068869_100005175 Ga0068869_1000051756 169
215 3300005334 Ga0068869_100008029 Ga0068869_1000080292 169
216 3300005334 Ga0068869_101105172 Ga0068869_1011051721 169
217 3300005335 Ga0070666_10026971 Ga0070666_100269712 169
218 3300005335 Ga0070666_10318735 Ga0070666_103187352 169
219 3300005337 Ga0070682_100049312 Ga0070682_1000493121 169
220 3300005338 Ga0068868_100004324 Ga0068868_1000043244 169
221 3300005338 Ga0068868_100196500 Ga0068868_1001965002 169
222 3300005339 Ga0070660_100390403 Ga0070660_1003904032 169
223 3300005340 Ga0070689_100021006 Ga0070689_1000210066 169
224 3300005340 Ga0070689_100033467 Ga0070689_1000334674 169
225 3300005341 Ga0070691_10011739 Ga0070691_100117392 169
226 3300005344 Ga0070661_100013425 Ga0070661_1000134258 169
227 3300005353 Ga0070669_100056017 Ga0070669_1000560173 169
228 3300005353 Ga0070669_100781067 Ga0070669_1007810671 169
229 3300005355 Ga0070671_100044015 Ga0070671_1000440156 169
230 3300005355 Ga0070671_100086837 Ga0070671_1000868372 169
231 3300005364 Ga0070673_100033496 Ga0070673_1000334962 169
232 3300005364 Ga0070673_100049643 Ga0070673_1000496435 169
233 3300005365 Ga0070688_100039108 Ga0070688_1000391082 169
234 3300005365 Ga0070688_100081027 Ga0070688_1000810273 169
235 3300005366 Ga0070659_100186571 Ga0070659_1001865712 169
236 3300005440 Ga0070705_100922302 Ga0070705_1009223021 169
237 3300005456 Ga0070678_100007858 Ga0070678_1000078582 169
238 3300005457 Ga0070662_100020419 Ga0070662_1000204192 169
239 3300005457 Ga0070662_100039935 Ga0070662_1000399352 169
240 3300005457 Ga0070662_100195335 Ga0070662_1001953352 169
241 3300005459 Ga0068867_100028644 Ga0068867_1000286445 169
242 3300005459 Ga0068867_100040234 Ga0068867_1000402342 169
243 3300005459 Ga0068867_100637137 Ga0068867_1006371372 169
244 3300005466 Ga0070685_10050637 Ga0070685_100506373 169
245 3300005535 Ga0070684_100000823 Ga0070684_1000008238 169
246 3300005535 Ga0070684_100002886 Ga0070684_1000028866 169
247 3300005535 Ga0070684_100738471 Ga0070684_1007384711 169
248 3300005535 Ga0070684_100754353 Ga0070684_1007543532 169
249 3300005539 Ga0068853_100007046 Ga0068853_1000070467 169
250 3300005539 Ga0068853_100208699 Ga0068853_1002086992 169
251 3300005539 Ga0068853_100692170 Ga0068853_1006921701 169
252 3300005544 Ga0070686_100192730 Ga0070686_1001927302 169
253 3300005544 Ga0070686_100242940 Ga0070686_1002429402 169
254 3300005548 Ga0070665_100000014 Ga0070665_100000014200 169
255 3300005548 Ga0070665_100062566 Ga0070665_1000625663 169
256 3300005548 Ga0070665_100076597 Ga0070665_1000765972 169
257 3300005548 Ga0070665_100448306 Ga0070665_1004483061 169
258 3300005563 Ga0068855_100014225 Ga0068855_10001422513 169
259 3300005563 Ga0068855_100024083 Ga0068855_1000240831 169
260 3300005564 Ga0070664_100009426 Ga0070664_1000094265 169
261 3300005564 Ga0070664_100019327 Ga0070664_1000193274 169
262 3300005564 Ga0070664_100026791 Ga0070664_1000267917 169
263 3300005564 Ga0070664_100094916 Ga0070664_1000949161 169
264 3300005564 Ga0070664_100368151 Ga0070664_1003681512 169
265 3300005564 Ga0070664_100520085 Ga0070664_1005200852 169
266 3300005577 Ga0068857_100005247 Ga0068857_1000052472 169
267 3300005577 Ga0068857_100129622 Ga0068857_1001296222 169
268 3300005577 Ga0068857_100268357 Ga0068857_1002683572 169
269 3300005578 Ga0068854_100179882 Ga0068854_1001798822 169
270 3300005614 Ga0068856_100204401 Ga0068856_1002044012 169
271 3300005614 Ga0068856_101136185 Ga0068856_1011361852 169
272 3300005616 Ga0068852_100407428 Ga0068852_1004074282 169
273 3300005617 Ga0068859_100072317 Ga0068859_1000723172 169
274 3300005618 Ga0068864_100062524 Ga0068864_1000625242 169
275 3300005618 Ga0068864_100102035 Ga0068864_1001020352 169
276 3300005618 Ga0068864_100701604 Ga0068864_1007016042 169
277 3300005718 Ga0068866_10027049 Ga0068866_100270493 169
278 3300005841 Ga0068863_100111170 Ga0068863_1001111702 169
279 3300005841 Ga0068863_100469196 Ga0068863_1004691962 169
280 3300005842 Ga0068858_100033772 Ga0068858_1000337723 169
281 3300005842 Ga0068858_100100576 Ga0068858_1001005763 169
282 3300005842 Ga0068858_100235320 Ga0068858_1002353202 169
283 3300005842 Ga0068858_101123700 Ga0068858_1011237001 169
284 3300005843 Ga0068860_100000061 Ga0068860_1000000614 169
285 3300005844 Ga0068862_100180767 Ga0068862_1001807672 169
286 3300005983 Ga0081540_1002949 Ga0081540_100294914 169
287 3300006195 Ga0075366_10018940 Ga0075366_100189403 169
288 3300006195 Ga0075366_10239789 Ga0075366_102397892 169
289 3300006237 Ga0097621_100049304 Ga0097621_1000493045 169
290 3300006237 Ga0097621_100257538 Ga0097621_1002575382 169
291 3300006237 Ga0097621_100855367 Ga0097621_1008553671 169
292 3300006358 Ga0068871_100045959 Ga0068871_1000459592 169
293 3300006358 Ga0068871_100114713 Ga0068871_1001147133 169
294 3300006358 Ga0068871_100290087 Ga0068871_1002900872 169
295 3300006358 Ga0068871_100500703 Ga0068871_1005007032 169
296 3300006871 Ga0075434_101518647 Ga0075434_1015186471 169
297 3300006881 Ga0068865_100160502 Ga0068865_1001605022 169
298 3300006931 Ga0097620_100072323 Ga0097620_1000723232 169
299 3300006931 Ga0097620_100303654 Ga0097620_1003036542 169
300 3300009011 Ga0105251_10401389 Ga0105251_104013891 169
301 3300009093 Ga0105240_10026787 Ga0105240_100267876 169
302 3300009093 Ga0105240_10075380 Ga0105240_100753802 169
303 3300009093 Ga0105240_10218061 Ga0105240_102180612 169
304 3300009094 Ga0111539_10485090 Ga0111539_104850901 169
305 3300009147 Ga0114129_10353492 Ga0114129_103534922 169
306 3300009174 Ga0105241_10127807 Ga0105241_101278073 169
307 3300009174 Ga0105241_10131163 Ga0105241_101311632 169
308 3300009174 Ga0105241_10195624 Ga0105241_101956242 169
309 3300009174 Ga0105241_10470012 Ga0105241_104700122 169
310 3300009174 Ga0105241_10735234 Ga0105241_107352342 169
311 3300009176 Ga0105242_11147415 Ga0105242_111474152 169
312 3300009177 Ga0105248_10173092 Ga0105248_101730923 169
313 3300009177 Ga0105248_10978259 Ga0105248_109782592 169
314 3300009545 Ga0105237_10000453 Ga0105237_1000045353 169
315 3300009545 Ga0105237_10023637 Ga0105237_100236373 169
316 3300009551 Ga0105238_10194684 Ga0105238_101946842 169
317 3300009553 Ga0105249_10010748 Ga0105249_100107482 169
318 3300009553 Ga0105249_10223534 Ga0105249_102235342 169
319 3300010375 Ga0105239_10000019 Ga0105239_1000001961 169
320 3300010375 Ga0105239_10012695 Ga0105239_100126952 169
321 3300010375 Ga0105239_10046242 Ga0105239_100462422 169
322 3300010375 Ga0105239_11084666 Ga0105239_110846662 169
323 3300011119 Ga0105246_10391604 Ga0105246_103916042 169
324 3300013100 Ga0157373_10072818 Ga0157373_100728182 169
325 3300013100 Ga0157373_10347797 Ga0157373_103477972 169
326 3300013104 Ga0157370_10413071 Ga0157370_104130711 169
327 3300013296 Ga0157374_10000011 Ga0157374_10000011348 169
328 3300013296 Ga0157374_10003407 Ga0157374_1000340715 169
329 3300013296 Ga0157374_10094013 Ga0157374_100940133 169
330 3300013297 Ga0157378_10309789 Ga0157378_103097892 169
331 3300013306 Ga0163162_10010130 Ga0163162_1001013013 169
332 3300013306 Ga0163162_10161533 Ga0163162_101615332 169
333 3300013307 Ga0157372_10007698 Ga0157372_1000769811 169
334 3300013307 Ga0157372_10190800 Ga0157372_101908003 169
335 3300013307 Ga0157372_10936892 Ga0157372_109368921 169
336 3300013307 Ga0157372_11135030 Ga0157372_111350302 169
337 3300013308 Ga0157375_10034814 Ga0157375_100348145 169
338 3300013308 Ga0157375_10160091 Ga0157375_101600912 169
339 3300013308 Ga0157375_10378034 Ga0157375_103780342 169
340 3300013308 Ga0157375_10387368 Ga0157375_103873683 169
341 3300014325 Ga0163163_10001351 Ga0163163_1000135114 169
342 3300014325 Ga0163163_10047872 Ga0163163_100478722 169
343 3300014325 Ga0163163_10850863 Ga0163163_108508632 169
344 3300014326 Ga0157380_10160068 Ga0157380_101600683 169
345 3300014326 Ga0157380_10407296 Ga0157380_104072962 169
346 3300014745 Ga0157377_10012474 Ga0157377_100124743 169
347 3300014745 Ga0157377_10215119 Ga0157377_102151192 169
348 3300014745 Ga0157377_10633331 Ga0157377_106333312 169
349 3300014968 Ga0157379_10107120 Ga0157379_101071202 169
350 3300014968 Ga0157379_10117040 Ga0157379_101170403 169
351 3300014969 Ga0157376_10011577 Ga0157376_100115776 169
352 3300014969 Ga0157376_10013360 Ga0157376_100133604 169
353 3300014969 Ga0157376_10038551 Ga0157376_100385512 169
354 3300014969 Ga0157376_10208176 Ga0157376_102081762 169
355 3300017792 Ga0163161_10060640 Ga0163161_100606402 169
356 3300025242 Ga0209258_112036 Ga0209258_1120361 169
357 3300025246 Ga0209646_1000921 Ga0209646_10009219 169
358 3300025315 Ga0207697_10144527 Ga0207697_101445271 169
359 3300025899 Ga0207642_10144822 Ga0207642_101448222 169
360 3300025901 Ga0207688_10320785 Ga0207688_103207851 169
361 3300025903 Ga0207680_10154004 Ga0207680_101540043 169
362 3300025904 Ga0207647_10058415 Ga0207647_100584154 169
363 3300025907 Ga0207645_10008702 Ga0207645_100087022 169
364 3300025911 Ga0207654_10185651 Ga0207654_101856512 169
365 3300025911 Ga0207654_10203308 Ga0207654_102033082 169
366 3300025913 Ga0207695_10038750 Ga0207695_100387504 169
367 3300025913 Ga0207695_10560677 Ga0207695_105606772 169
368 3300025914 Ga0207671_10000311 Ga0207671_1000031124 169
369 3300025914 Ga0207671_10016200 Ga0207671_100162005 169
370 3300025919 Ga0207657_10043217 Ga0207657_100432172 169
371 3300025919 Ga0207657_10142429 Ga0207657_101424292 169
372 3300025920 Ga0207649_10110237 Ga0207649_101102372 169
373 3300025923 Ga0207681_10178699 Ga0207681_101786992 169
374 3300025924 Ga0207694_10060474 Ga0207694_100604742 169
375 3300025925 Ga0207650_10132445 Ga0207650_101324452 169
376 3300025925 Ga0207650_11375286 Ga0207650_113752861 169
377 3300025931 Ga0207644_10670155 Ga0207644_106701551 169
378 3300025933 Ga0207706_10009283 Ga0207706_100092832 169
379 3300025933 Ga0207706_10034680 Ga0207706_100346806 169
380 3300025934 Ga0207686_10032197 Ga0207686_100321972 169
381 3300025936 Ga0207670_10093564 Ga0207670_100935642 169
382 3300025939 Ga0207665_10964611 Ga0207665_109646111 169
383 3300025940 Ga0207691_10147063 Ga0207691_101470632 169
384 3300025941 Ga0207711_10156808 Ga0207711_101568082 169
385 3300025942 Ga0207689_10019558 Ga0207689_100195584 169
386 3300025942 Ga0207689_10155883 Ga0207689_101558832 169
387 3300025944 Ga0207661_10019604 Ga0207661_100196046 169
388 3300025944 Ga0207661_10133031 Ga0207661_101330312 169
389 3300025944 Ga0207661_11403932 Ga0207661_114039321 169
390 3300025945 Ga0207679_10001675 Ga0207679_100016758 169
391 3300025945 Ga0207679_10032297 Ga0207679_100322972 169
392 3300025949 Ga0207667_10096038 Ga0207667_100960383 169
393 3300025981 Ga0207640_10337458 Ga0207640_103374582 169
394 3300025986 Ga0207658_10031002 Ga0207658_100310022 169
395 3300025986 Ga0207658_10196180 Ga0207658_101961802 169
396 3300026035 Ga0207703_11110466 Ga0207703_111104662 169
397 3300026041 Ga0207639_10194763 Ga0207639_101947632 169
398 3300026041 Ga0207639_10355955 Ga0207639_103559552 169
399 3300026041 Ga0207639_10712315 Ga0207639_107123152 169
400 3300026067 Ga0207678_10081466 Ga0207678_100814662 169
401 3300026078 Ga0207702_10522585 Ga0207702_105225852 169
402 3300026088 Ga0207641_10170700 Ga0207641_101707001 169
403 3300026088 Ga0207641_10374416 Ga0207641_103744162 169
404 3300026089 Ga0207648_10012780 Ga0207648_100127804 169
405 3300026089 Ga0207648_10023408 Ga0207648_100234084 169
406 3300026089 Ga0207648_10248184 Ga0207648_102481842 169
407 3300026095 Ga0207676_10101172 Ga0207676_101011723 169
408 3300026095 Ga0207676_10172812 Ga0207676_101728122 169
409 3300026116 Ga0207674_10014175 Ga0207674_100141755 169
410 3300026116 Ga0207674_10014702 Ga0207674_100147024 169
411 3300026116 Ga0207674_10025103 Ga0207674_100251036 169
412 3300026116 Ga0207674_10185220 Ga0207674_101852202 169
413 3300026118 Ga0207675_100266147 Ga0207675_1002661472 169
414 3300026118 Ga0207675_101435595 Ga0207675_1014355951 169
415 3300026121 Ga0207683_10004664 Ga0207683_100046642 169
416 3300026142 Ga0207698_10052541 Ga0207698_100525412 169
417 3300026142 Ga0207698_10174898 Ga0207698_101748982 169
418 3300028379 Ga0268266_10008277 Ga0268266_100082772 169
419 3300028379 Ga0268266_10062165 Ga0268266_100621655 169
420 3300028379 Ga0268266_10094525 Ga0268266_100945253 169
421 3300028380 Ga0268265_10595482 Ga0268265_105954822 169
422 3300028381 Ga0268264_10000079 Ga0268264_10000079178 169
423 3300028786 Ga0307517_10327950 Ga0307517_103279502 169
424 3300030521 Ga0307511_10022566 Ga0307511_100225665 169
425 3300031456 Ga0307513_10178127 Ga0307513_101781273 169
426 3300032126 Ga0307415_100755866 Ga0307415_1007558662 169
427 3300035086 Ga0373934_0198739 Ga0373934_0198739_238_750 169
428 3300035117 Ga0373953_0080711 Ga0373953_0080711_94_606 169
429 3300035118 Ga0373954_0166526 Ga0373954_0166526_507_1019 169
430 3300035172 Ga0373955_0070860 Ga0373955_0070860_1337_1849 169
431 3300035410 Ga0373924_0133640 Ga0373924_0133640_302_814 169
432 3300035692 Ga0373935_0138643 Ga0373935_0138643_506_1018 169
433 3300036401 Ga0373937_0040867 Ga0373937_0040867_323_835 169
434 3300037068 Ga0373925_0119354 Ga0373925_0119354_784_1296 169
435 3300041507 Ga0451851_0296872 Ga0451851_0296872_44_553 169
436 3300041509 Ga0451843_1769404 Ga0451843_1769404_369_881 169
437 3300042007 Ga0439449_0008071 Ga0439449_0008071_640_1149 169
438 3300042015 Ga0439462_0117773 Ga0439462_0117773_24_533 169
439 3300042532 Ga0450893_0039269 Ga0450893_0039269_117_626 169
440 3300044656 Ga0466969_0048045 Ga0466969_0048045_1510_2019 169
441 3300044658 Ga0466972_0000082 Ga0466972_0000082_84315_84830 169
442 3300044658 Ga0466972_0024449 Ga0466972_0024449_1608_2168 169
443 3300044658 Ga0466972_0031023 Ga0466972_0031023_432_950 169
444 3300044683 Ga0466965_0126383 Ga0466965_0126383_244_753 169
445 3300044684 Ga0466966_0165376 Ga0466966_0165376_114_626 169
446 3300044712 Ga0453684_0890069 Ga0453684_0890069_427_939 169
447 3300044735 Ga0466968_0046866 Ga0466968_0046866_774_1292 169
448 3300044842 Ga0466957_0000381 Ga0466957_0000381_9887_10402 169
449 3300044842 Ga0466957_0006481 Ga0466957_0006481_4350_4865 169
450 3300046454 Ga0495592_0374909 Ga0495592_0374909_213_725 169
451 3300046459 Ga0495629_0099643 Ga0495629_0099643_224_736 169
452 3300046463 Ga0495653_0292053 Ga0495653_0292053_62_574 169
453 3300046477 Ga0495664_0284396 Ga0495664_0284396_272_784 169
454 3300046511 Ga0495608_0026304 Ga0495608_0026304_3362_3874 169
455 3300046517 Ga0495630_0146876 Ga0495630_0146876_1087_1599 169
456 3300046524 Ga0495648_0001246 Ga0495648_0001246_1942_2457 169
457 3300046529 Ga0495652_0042704 Ga0495652_0042704_188_700 169
458 3300046536 Ga0495587_0047268 Ga0495587_0047268_213_725 169
459 3300046559 Ga0495667_0213350 Ga0495667_0213350_418_930 169
460 3300046616 Ga0495668_0000202 Ga0495668_0000202_2542_3051 169
461 3300046642 Ga0495634_0375114 Ga0495634_0375114_152_664 169
462 3300046642 Ga0495634_0511427 Ga0495634_0511427_73_585 169
463 3300046648 Ga0495611_0001026 Ga0495611_0001026_9886_10398 169
464 3300046663 Ga0495635_0031039 Ga0495635_0031039_2957_3469 169
465 3300046684 Ga0495669_0291642 Ga0495669_0291642_216_728 169
466 3300046694 Ga0495649_0451804 Ga0495649_0451804_110_625 169
467 3300046809 Ga0495600_0018974 Ga0495600_0018974_674_1186 169
468 3300047317 Ga0495604_0071896 Ga0495604_0071896_975_1487 169
469 3300047319 Ga0495674_0218995 Ga0495674_0218995_984_1496 169
470 3300047321 Ga0495676_0848344 Ga0495676_0848344_45_557 169
471 3300047443 Ga0495687_000886 Ga0495687_000886_29737_30252 169
472 3300047471 Ga0495684_0141387 Ga0495684_0141387_586_1098 169
473 3300047472 Ga0495686_0265761 Ga0495686_0265761_30_542 169
474 3300048903 Ga0496100_0550662 Ga0496100_0550662_336_848 169
475 3300048904 Ga0496101_0042227 Ga0496101_0042227_2060_2572 169
476 3300048908 Ga0496105_0366662 Ga0496105_0366662_59_571 169
477 3300048909 Ga0496106_0181322 Ga0496106_0181322_772_1284 169
478 3300048912 Ga0496109_0355081 Ga0496109_0355081_849_1361 169
479 3300048913 Ga0496110_0459186 Ga0496110_0459186_620_1132 169
480 3300048917 Ga0496114_0050742 Ga0496114_0050742_194_706 169
481 3300049521 Ga0501298_108037 Ga0501298_108037_62_574 169
482 3300049574 Ga0501038_0751902 Ga0501038_0751902_23_532 169
483 3300049581 Ga0501047_0258382 Ga0501047_0258382_421_939 169
484 3300049581 Ga0501047_0259607 Ga0501047_0259607_935_1444 169
485 3300049652 Ga0501202_001707 Ga0501202_001707_2407_2919 169
486 3300049661 Ga0501217_026917 Ga0501217_026917_334_846 169
487 3300049663 Ga0501223_009110 Ga0501223_009110_913_1425 169
488 3300049670 Ga0501236_045667 Ga0501236_045667_32_544 169
489 3300049688 Ga0501259_090520 Ga0501259_090520_135_647 169
490 3300049705 Ga0501225_0001644 Ga0501225_0001644_2434_2943 169
491 3300049770 Ga0501273_064702 Ga0501273_064702_23_535 169
492 3300049823 Ga0501044_0057853 Ga0501044_0057853_1705_2214 169
493 3300049823 Ga0501044_0249915 Ga0501044_0249915_813_1322 169
494 3300050493 nmdc:mga0k408_152717_c1 nmdc:mga0k408_152717_c1_113_622 169
495 3300050493 nmdc:mga0k408_347611_c1 nmdc:mga0k408_347611_c1_266_781 169
496 3300050493 nmdc:mga0k408_365215_c1 nmdc:mga0k408_365215_c1_332_841 169
497 3300050493 nmdc:mga0k408_83869_c1 nmdc:mga0k408_83869_c1_683_1198 169
498 3300050507 nmdc:mga05p37_278481_c1 nmdc:mga05p37_278481_c1_443_952 169
499 3300053085 Ga0495619_0293753 Ga0495619_0293753_599_1111 169
500 3300053086 Ga0500578_0000063 Ga0500578_0000063_63546_64055 169
501 3300053086 Ga0500578_0234069 Ga0500578_0234069_168_683 169
502 3300053088 Ga0500644_0029590 Ga0500644_0029590_209_724 169
503 3300053092 Ga0500583_0000076 Ga0500583_0000076_8929_9444 169
504 3300053092 Ga0500583_0011401 Ga0500583_0011401_1872_2384 169
505 3300053098 Ga0500650_0106245 Ga0500650_0106245_712_1227 169
506 3300053111 Ga0500572_003120 Ga0500572_003120_1861_2370 169
507 3300053130 Ga0500642_0057945 Ga0500642_0057945_901_1446 169
508 3300053153 Ga0500616_0074910 Ga0500616_0074910_627_1136 169
509 3300053156 Ga0500622_0006674 Ga0500622_0006674_1216_1731 169
510 3300053177 Ga0500636_0278058 Ga0500636_0278058_132_641 169
511 3300053726 Ga0500584_075481 Ga0500584_075481_868_1377 169
512 3300061719 Ga0466962_0088987 Ga0466962_0088987_679_1194 169
513 3300061719 Ga0466962_0092693 Ga0466962_0092693_499_1008 169
514 3300005290 Ga0065712_10100308 Ga0065712_101003082 170
515 3300005293 Ga0065715_10282515 Ga0065715_102825152 170
516 3300005327 Ga0070658_10132184 Ga0070658_101321843 170
517 3300005328 Ga0070676_10613325 Ga0070676_106133251 170
518 3300005328 Ga0070676_11034973 Ga0070676_110349731 170
519 3300005329 Ga0070683_100454177 Ga0070683_1004541772 170
520 3300005329 Ga0070683_100861154 Ga0070683_1008611542 170
521 3300005330 Ga0070690_100435643 Ga0070690_1004356432 170
522 3300005331 Ga0070670_100586191 Ga0070670_1005861912 170
523 3300005334 Ga0068869_100085491 Ga0068869_1000854912 170
524 3300005336 Ga0070680_100010528 Ga0070680_1000105283 170
525 3300005337 Ga0070682_100000019 Ga0070682_100000019148 170
526 3300005337 Ga0070682_100174827 Ga0070682_1001748273 170
527 3300005338 Ga0068868_100361741 Ga0068868_1003617412 170
528 3300005339 Ga0070660_100095233 Ga0070660_1000952332 170
529 3300005339 Ga0070660_100100442 Ga0070660_1001004422 170
530 3300005347 Ga0070668_100039320 Ga0070668_1000393202 170
531 3300005347 Ga0070668_100480567 Ga0070668_1004805672 170
532 3300005354 Ga0070675_100041303 Ga0070675_1000413032 170
533 3300005354 Ga0070675_100138245 Ga0070675_1001382452 170
534 3300005355 Ga0070671_100623499 Ga0070671_1006234992 170
535 3300005364 Ga0070673_100758375 Ga0070673_1007583752 170
536 3300005367 Ga0070667_100204460 Ga0070667_1002044602 170
537 3300005456 Ga0070678_100045789 Ga0070678_1000457892 170
538 3300005458 Ga0070681_10058113 Ga0070681_100581133 170
539 3300005459 Ga0068867_100027314 Ga0068867_1000273143 170
540 3300005459 Ga0068867_100040241 Ga0068867_1000402412 170
541 3300005459 Ga0068867_100240266 Ga0068867_1002402663 170
542 3300005530 Ga0070679_100000836 Ga0070679_10000083619 170
543 3300005539 Ga0068853_100009327 Ga0068853_1000093279 170
544 3300005539 Ga0068853_100176747 Ga0068853_1001767473 170
545 3300005539 Ga0068853_100519382 Ga0068853_1005193822 170
546 3300005543 Ga0070672_100003727 Ga0070672_1000037279 170
547 3300005543 Ga0070672_100304310 Ga0070672_1003043102 170
548 3300005563 Ga0068855_100006600 Ga0068855_1000066004 170
549 3300005563 Ga0068855_100274060 Ga0068855_1002740602 170
550 3300005564 Ga0070664_100839215 Ga0070664_1008392152 170
551 3300005564 Ga0070664_101318769 Ga0070664_1013187692 170
552 3300005577 Ga0068857_100193365 Ga0068857_1001933652 170
553 3300005578 Ga0068854_100150217 Ga0068854_1001502172 170
554 3300005578 Ga0068854_100444154 Ga0068854_1004441542 170
555 3300005616 Ga0068852_100000744 Ga0068852_10000074422 170
556 3300005616 Ga0068852_100228781 Ga0068852_1002287812 170
557 3300005616 Ga0068852_102019073 Ga0068852_1020190731 170
558 3300005617 Ga0068859_100001537 Ga0068859_1000015372 170
559 3300005617 Ga0068859_100032421 Ga0068859_1000324212 170
560 3300005617 Ga0068859_100071945 Ga0068859_1000719452 170
561 3300005617 Ga0068859_100094528 Ga0068859_1000945282 170
562 3300005618 Ga0068864_100073120 Ga0068864_1000731205 170
563 3300005719 Ga0068861_100579650 Ga0068861_1005796502 170
564 3300005834 Ga0068851_10091568 Ga0068851_100915682 170
565 3300005834 Ga0068851_10566615 Ga0068851_105666151 170
566 3300005841 Ga0068863_100089444 Ga0068863_1000894445 170
567 3300005841 Ga0068863_100327519 Ga0068863_1003275192 170
568 3300005843 Ga0068860_100001341 Ga0068860_1000013413 170
569 3300005843 Ga0068860_100076623 Ga0068860_1000766232 170
570 3300005844 Ga0068862_100005164 Ga0068862_1000051647 170
571 3300006237 Ga0097621_100760265 Ga0097621_1007602652 170
572 3300006353 Ga0075370_10175079 Ga0075370_101750791 170
573 3300006881 Ga0068865_100575481 Ga0068865_1005754812 170
574 3300006931 Ga0097620_100001537 Ga0097620_1000015372 170
575 3300006931 Ga0097620_100032421 Ga0097620_1000324212 170
576 3300006931 Ga0097620_100071946 Ga0097620_1000719462 170
577 3300006931 Ga0097620_100094524 Ga0097620_1000945242 170
578 3300009094 Ga0111539_10011561 Ga0111539_1001156111 170
579 3300009101 Ga0105247_10848743 Ga0105247_108487431 170
580 3300009174 Ga0105241_10267849 Ga0105241_102678492 170
581 3300009176 Ga0105242_10430846 Ga0105242_104308462 170
582 3300009553 Ga0105249_10065163 Ga0105249_100651632 170
583 3300009553 Ga0105249_10139717 Ga0105249_101397171 170
584 3300011119 Ga0105246_10158024 Ga0105246_101580243 170
585 3300013102 Ga0157371_10006990 Ga0157371_100069907 170
586 3300013104 Ga0157370_10068911 Ga0157370_100689115 170
587 3300013105 Ga0157369_10172833 Ga0157369_101728332 170
588 3300013105 Ga0157369_10861572 Ga0157369_108615722 170
589 3300013297 Ga0157378_10746527 Ga0157378_107465272 170
590 3300013306 Ga0163162_10931612 Ga0163162_109316122 170
591 3300013306 Ga0163162_11698972 Ga0163162_116989722 170
592 3300013307 Ga0157372_10149086 Ga0157372_101490862 170
593 3300013307 Ga0157372_10154609 Ga0157372_101546092 170
594 3300013307 Ga0157372_10729009 Ga0157372_107290092 170
595 3300013308 Ga0157375_11127115 Ga0157375_111271151 170
596 3300014325 Ga0163163_10102798 Ga0163163_101027983 170
597 3300014325 Ga0163163_10242874 Ga0163163_102428742 170
598 3300014325 Ga0163163_10258236 Ga0163163_102582362 170
599 3300014326 Ga0157380_10012066 Ga0157380_100120667 170
600 3300014326 Ga0157380_10027166 Ga0157380_100271662 170
601 3300014968 Ga0157379_10081736 Ga0157379_100817362 170
602 3300014969 Ga0157376_10306843 Ga0157376_103068432 170
603 3300025315 Ga0207697_10062396 Ga0207697_100623962 170
604 3300025321 Ga0207656_10065045 Ga0207656_100650453 170
605 3300025907 Ga0207645_10088406 Ga0207645_100884062 170
606 3300025909 Ga0207705_10028584 Ga0207705_100285846 170
607 3300025911 Ga0207654_10313121 Ga0207654_103131212 170
608 3300025917 Ga0207660_10085252 Ga0207660_100852522 170
609 3300025917 Ga0207660_10099412 Ga0207660_100994123 170
610 3300025919 Ga0207657_10013163 Ga0207657_100131633 170
611 3300025919 Ga0207657_10102440 Ga0207657_101024402 170
612 3300025921 Ga0207652_10002760 Ga0207652_1000276011 170
613 3300025926 Ga0207659_10008828 Ga0207659_100088288 170
614 3300025926 Ga0207659_10087627 Ga0207659_100876272 170
615 3300025936 Ga0207670_11029954 Ga0207670_110299541 170
616 3300025938 Ga0207704_10680428 Ga0207704_106804281 170
617 3300025940 Ga0207691_10006189 Ga0207691_100061896 170
618 3300025940 Ga0207691_10332236 Ga0207691_103322362 170
619 3300025942 Ga0207689_10005993 Ga0207689_100059932 170
620 3300025942 Ga0207689_10084542 Ga0207689_100845422 170
621 3300025949 Ga0207667_10017026 Ga0207667_100170267 170
622 3300025949 Ga0207667_10062322 Ga0207667_100623222 170
623 3300025949 Ga0207667_10270369 Ga0207667_102703693 170
624 3300025960 Ga0207651_10280758 Ga0207651_102807582 170
625 3300025961 Ga0207712_10078276 Ga0207712_100782762 170
626 3300025972 Ga0207668_10210037 Ga0207668_102100372 170
627 3300025972 Ga0207668_10252966 Ga0207668_102529662 170
628 3300025981 Ga0207640_10412645 Ga0207640_104126452 170
629 3300025981 Ga0207640_10709979 Ga0207640_107099792 170
630 3300025986 Ga0207658_10391583 Ga0207658_103915832 170
631 3300026023 Ga0207677_11665365 Ga0207677_116653651 170
632 3300026041 Ga0207639_10015901 Ga0207639_100159012 170
633 3300026041 Ga0207639_10181205 Ga0207639_101812052 170
634 3300026041 Ga0207639_10336027 Ga0207639_103360272 170
635 3300026078 Ga0207702_10026609 Ga0207702_100266094 170
636 3300026088 Ga0207641_10149855 Ga0207641_101498552 170
637 3300026088 Ga0207641_10552503 Ga0207641_105525032 170
638 3300026089 Ga0207648_10044966 Ga0207648_100449662 170
639 3300026118 Ga0207675_100329200 Ga0207675_1003292002 170
640 3300026121 Ga0207683_10045803 Ga0207683_100458037 170
641 3300026121 Ga0207683_10100616 Ga0207683_101006162 170
642 3300026142 Ga0207698_10051034 Ga0207698_100510342 170
643 3300027907 Ga0207428_10130466 Ga0207428_101304662 170
644 3300028380 Ga0268265_10015032 Ga0268265_100150323 170
645 3300028381 Ga0268264_10007764 Ga0268264_100077647 170
646 3300028381 Ga0268264_10015227 Ga0268264_100152273 170
647 3300028381 Ga0268264_10258960 Ga0268264_102589602 170
648 3300028794 Ga0307515_10000001 Ga0307515_100000012308 170
649 3300031251 Ga0265327_10000013 Ga0265327_10000013284 170
650 3300031649 Ga0307514_10338550 Ga0307514_103385501 170
651 3300032004 Ga0307414_10074124 Ga0307414_100741243 170
652 3300033180 Ga0307510_10009446 Ga0307510_100094462 170
653 3300033545 Ga0316214_1038468 Ga0316214_10384681 170
654 3300037312 Ga0395899_0012303 Ga0395899_0012303_4854_5366 170
655 3300037418 Ga0395900_0015690 Ga0395900_0015690_2051_2563 170
656 3300037466 Ga0395898_0024421 Ga0395898_0024421_4854_5366 170
657 3300038443 Ga0395901_0004445 Ga0395901_0004445_601_1113 170
658 3300041460 Ga0451802_1207351 Ga0451802_1207351_10_522 170
659 3300041509 Ga0451843_0090240 Ga0451843_0090240_67_579 170
660 3300042007 Ga0439449_0187938 Ga0439449_0187938_13_534 170
661 3300042134 Ga0450898_009254 Ga0450898_009254_804_1319 170
662 3300042184 Ga0450908_056495 Ga0450908_056495_89_604 170
663 3300042435 Ga0439434_0037134 Ga0439434_0037134_292_807 170
664 3300044673 Ga0453683_0111624 Ga0453683_0111624_524_1036 170
665 3300044712 Ga0453684_0183866 Ga0453684_0183866_1297_1809 170
666 3300045051 Ga0451576_0381844 Ga0451576_0381844_483_995 170
667 3300046471 Ga0495650_0044451 Ga0495650_0044451_960_1475 170
668 3300046507 Ga0495606_0034998 Ga0495606_0034998_2178_2714 170
669 3300046537 Ga0495598_0090883 Ga0495598_0090883_347_859 170
670 3300046660 Ga0495625_0092176 Ga0495625_0092176_1466_1978 170
671 3300046694 Ga0495649_0431637 Ga0495649_0431637_126_638 170
672 3300047472 Ga0495686_0225644 Ga0495686_0225644_164_676 170
673 3300049551 Ga0501335_007011 Ga0501335_007011_256_768 170
674 3300049569 Ga0501032_0009186 Ga0501032_0009186_258_770 170
675 3300049571 Ga0501034_0000004 Ga0501034_0000004_308725_309237 170
676 3300049571 Ga0501034_0152617 Ga0501034_0152617_1506_2018 170
677 3300049573 Ga0501037_0019254 Ga0501037_0019254_1275_1787 170
678 3300049574 Ga0501038_0058848 Ga0501038_0058848_2153_2665 170
679 3300049575 Ga0501039_0156785 Ga0501039_0156785_353_865 170
680 3300049579 Ga0501043_0019687 Ga0501043_0019687_4763_5275 170
681 3300049581 Ga0501047_0107962 Ga0501047_0107962_406_918 170
682 3300049586 Ga0501070_0228816 Ga0501070_0228816_121_633 170
683 3300049704 Ga0501221_116871 Ga0501221_116871_98_610 170
684 3300050511 nmdc:mga08y16_7939_c1 nmdc:mga08y16_7939_c1_9646_10164 170
685 3300053129 Ga0500628_023766 Ga0500628_023766_560_1072 170
686 3300053146 Ga0500588_0054050 Ga0500588_0054050_217_729 170
687 3300053153 Ga0500616_0226325 Ga0500616_0226325_132_644 170
688 3300053156 Ga0500622_0000242 Ga0500622_0000242_22314_22826 170
689 3300053727 Ga0500611_000060 Ga0500611_000060_26100_26615 170
690 3300059493 Ga0587077_012566 Ga0587077_012566_690_1202 170
691 2162886007 SwRhRL2b_contig_1104021 SwRhRL2b_0737.00007120 171
692 3300001979 JGI24740J21852_10001262 JGI24740J21852_100012624 171
693 3300001989 JGI24739J22299_10024864 JGI24739J22299_100248642 171
694 3300002738 JGI25154J39366_1000003 JGI25154J39366_1000003134 171
695 3300002741 JGI25157J39369_1008050 JGI25157J39369_10080502 171
696 3300003215 JGI25153J46596_10003159 JGI25153J46596_100031596 171
697 3300003215 JGI25153J46596_10007886 JGI25153J46596_100078864 171
698 3300003320 rootH2_10206676 rootH2_102066762 171
699 3300003322 rootL2_10170793 rootL2_101707932 171
700 3300003323 rootH1_10014610 rootH1_1001461017 171
701 3300003323 rootH1_10014611 rootH1_100146112 171
702 3300003354 JGI25160J50197_1001477 JGI25160J50197_100147710 171
703 3300003354 JGI25160J50197_1022441 JGI25160J50197_10224413 171
704 3300003762 Ga0055542_1001719 Ga0055542_10017195 171
705 3300003771 Ga0055526_1039510 Ga0055526_10395102 171
706 3300003790 Ga0055528_1000060 Ga0055528_100006033 171
707 3300003791 Ga0055530_10000378 Ga0055530_1000037815 171
708 3300003794 Ga0055531_10030616 Ga0055531_100306161 171
709 3300005262 Ga0065165_1001923 Ga0065165_100192310 171
710 3300005262 Ga0065165_1016362 Ga0065165_10163622 171
711 3300005262 Ga0065165_1020820 Ga0065165_10208202 171
712 3300005289 Ga0065704_10167542 Ga0065704_101675422 171
713 3300005329 Ga0070683_100085157 Ga0070683_1000851573 171
714 3300005331 Ga0070670_100308676 Ga0070670_1003086762 171
715 3300005337 Ga0070682_100137593 Ga0070682_1001375932 171
716 3300005339 Ga0070660_100942206 Ga0070660_1009422061 171
717 3300005340 Ga0070689_100306998 Ga0070689_1003069982 171
718 3300005343 Ga0070687_100129328 Ga0070687_1001293282 171
719 3300005353 Ga0070669_100280414 Ga0070669_1002804142 171
720 3300005364 Ga0070673_100170375 Ga0070673_1001703752 171
721 3300005436 Ga0070713_100315837 Ga0070713_1003158372 171
722 3300005438 Ga0070701_11062070 Ga0070701_110620701 171
723 3300005455 Ga0070663_100376714 Ga0070663_1003767142 171
724 3300005457 Ga0070662_100061481 Ga0070662_1000614812 171
725 3300005530 Ga0070679_100216934 Ga0070679_1002169342 171
726 3300005535 Ga0070684_101133974 Ga0070684_1011339741 171
727 3300005544 Ga0070686_100169323 Ga0070686_1001693232 171
728 3300005547 Ga0070693_100224773 Ga0070693_1002247732 171
729 3300005547 Ga0070693_100434145 Ga0070693_1004341451 171
730 3300005548 Ga0070665_100536497 Ga0070665_1005364972 171
731 3300005577 Ga0068857_100024711 Ga0068857_1000247116 171
732 3300005577 Ga0068857_100418476 Ga0068857_1004184762 171
733 3300005578 Ga0068854_100390486 Ga0068854_1003904862 171
734 3300005578 Ga0068854_100449009 Ga0068854_1004490091 171
735 3300005615 Ga0070702_100466194 Ga0070702_1004661942 171
736 3300005616 Ga0068852_100062865 Ga0068852_1000628653 171
737 3300005616 Ga0068852_100854470 Ga0068852_1008544701 171
738 3300005616 Ga0068852_101566852 Ga0068852_1015668521 171
739 3300005618 Ga0068864_100166759 Ga0068864_1001667592 171
740 3300005618 Ga0068864_100206523 Ga0068864_1002065232 171
741 3300005719 Ga0068861_100300047 Ga0068861_1003000472 171
742 3300006195 Ga0075366_10064494 Ga0075366_100644941 171
743 3300006358 Ga0068871_100428207 Ga0068871_1004282072 171
744 3300006358 Ga0068871_100563289 Ga0068871_1005632892 171
745 3300009093 Ga0105240_10012537 Ga0105240_1001253710 171
746 3300009174 Ga0105241_10490942 Ga0105241_104909422 171
747 3300009176 Ga0105242_10939238 Ga0105242_109392382 171
748 3300009553 Ga0105249_10470530 Ga0105249_104705302 171
749 3300010375 Ga0105239_10135680 Ga0105239_101356802 171
750 3300010375 Ga0105239_10323457 Ga0105239_103234572 171
751 3300011119 Ga0105246_10781393 Ga0105246_107813931 171
752 3300013102 Ga0157371_10083130 Ga0157371_100831302 171
753 3300013102 Ga0157371_10491596 Ga0157371_104915961 171
754 3300013102 Ga0157371_10806392 Ga0157371_108063922 171
755 3300013104 Ga0157370_10115104 Ga0157370_101151042 171
756 3300013104 Ga0157370_10374315 Ga0157370_103743152 171
757 3300013105 Ga0157369_10095175 Ga0157369_100951752 171
758 3300013296 Ga0157374_10596660 Ga0157374_105966601 171
759 3300013297 Ga0157378_10067129 Ga0157378_100671292 171
760 3300013306 Ga0163162_10544113 Ga0163162_105441132 171
761 3300013307 Ga0157372_10157431 Ga0157372_101574312 171
762 3300013307 Ga0157372_10378590 Ga0157372_103785902 171
763 3300013308 Ga0157375_11084865 Ga0157375_110848651 171
764 3300015265 Ga0182005_1000069 Ga0182005_100006956 171
765 3300015265 Ga0182005_1093902 Ga0182005_10939022 171
766 3300021384 Ga0213876_10006978 Ga0213876_100069784 171
767 3300025208 Ga0209436_100329 Ga0209436_10032919 171
768 3300025242 Ga0209258_100032 Ga0209258_100032217 171
769 3300025245 Ga0207425_1024802 Ga0207425_10248022 171
770 3300025246 Ga0209646_1000004 Ga0209646_1000004204 171
771 3300025250 Ga0209026_1000192 Ga0209026_100019227 171
772 3300025254 Ga0209148_1000186 Ga0209148_100018692 171
773 3300025258 Ga0209129_1020980 Ga0209129_10209802 171
774 3300025273 Ga0209673_1000258 Ga0209673_100025882 171
775 3300025291 Ga0209675_1029097 Ga0209675_10290972 171
776 3300025295 Ga0209564_1006138 Ga0209564_10061384 171
777 3300025297 Ga0209758_1009737 Ga0209758_10097374 171
778 3300025297 Ga0209758_1019239 Ga0209758_10192395 171
779 3300025298 Ga0209050_1001018 Ga0209050_100101816 171
780 3300025302 Ga0207426_1000033 Ga0207426_1000033290 171
781 3300025302 Ga0207426_1000594 Ga0207426_100059415 171
782 3300025302 Ga0207426_1000780 Ga0207426_100078024 171
783 3300025303 Ga0209051_1012467 Ga0209051_10124674 171
784 3300025304 Ga0209257_1002472 Ga0209257_100247214 171
785 3300025903 Ga0207680_10566749 Ga0207680_105667492 171
786 3300025909 Ga0207705_10937142 Ga0207705_109371421 171
787 3300025913 Ga0207695_10009898 Ga0207695_100098985 171
788 3300025917 Ga0207660_10124974 Ga0207660_101249742 171
789 3300025918 Ga0207662_10049076 Ga0207662_100490762 171
790 3300025921 Ga0207652_10208279 Ga0207652_102082792 171
791 3300025923 Ga0207681_10243250 Ga0207681_102432502 171
792 3300025926 Ga0207659_10620642 Ga0207659_106206422 171
793 3300025928 Ga0207700_10307286 Ga0207700_103072862 171
794 3300025933 Ga0207706_10131220 Ga0207706_101312202 171
795 3300025936 Ga0207670_10274523 Ga0207670_102745232 171
796 3300025937 Ga0207669_10272702 Ga0207669_102727022 171
797 3300025944 Ga0207661_10151192 Ga0207661_101511922 171
798 3300025944 Ga0207661_10908778 Ga0207661_109087782 171
799 3300025981 Ga0207640_10172343 Ga0207640_101723432 171
800 3300025986 Ga0207658_10559709 Ga0207658_105597092 171
801 3300026067 Ga0207678_10260923 Ga0207678_102609232 171
802 3300026089 Ga0207648_10781897 Ga0207648_107818972 171
803 3300026095 Ga0207676_10087749 Ga0207676_100877492 171
804 3300026116 Ga0207674_10034066 Ga0207674_100340662 171
805 3300026116 Ga0207674_11172619 Ga0207674_111726191 171
806 3300026116 Ga0207674_11684163 Ga0207674_116841631 171
807 3300026118 Ga0207675_100830925 Ga0207675_1008309252 171
808 3300026142 Ga0207698_10345297 Ga0207698_103452972 171
809 3300026142 Ga0207698_10809631 Ga0207698_108096312 171
810 3300026142 Ga0207698_10859943 Ga0207698_108599431 171
811 3300028379 Ga0268266_10472899 Ga0268266_104728992 171
812 3300031251 Ga0265327_10000030 Ga0265327_100000304 171
813 3300031251 Ga0265327_10057725 Ga0265327_100577252 171
814 3300035692 Ga0373935_0194986 Ga0373935_0194986_579_1094 171
815 3300039437 Ga0436365_0311643 Ga0436365_0311643_2310_2825 171
816 3300039453 Ga0436362_0886610 Ga0436362_0886610_212_727 171
817 3300041404 Ga0439436_0038169 Ga0439436_0038169_829_1359 171
818 3300041413 Ga0439465_0040095 Ga0439465_0040095_124_639 171
819 3300041997 Ga0439431_0000806 Ga0439431_0000806_1674_2189 171
820 3300042004 Ga0439445_0057213 Ga0439445_0057213_193_708 171
821 3300042007 Ga0439449_0017949 Ga0439449_0017949_507_1037 171
822 3300044658 Ga0466972_0000146 Ga0466972_0000146_26920_27435 171
823 3300044658 Ga0466972_0015319 Ga0466972_0015319_776_1291 171
824 3300044683 Ga0466965_0075261 Ga0466965_0075261_969_1487 171
825 3300044765 Ga0466970_0170791 Ga0466970_0170791_78_593 171
826 3300044842 Ga0466957_0426924 Ga0466957_0426924_160_675 171
827 3300045049 Ga0466959_0112955 Ga0466959_0112955_1144_1659 171
828 3300046519 Ga0495632_0321043 Ga0495632_0321043_151_669 171
829 3300046529 Ga0495652_0521171 Ga0495652_0521171_105_620 171
830 3300046535 Ga0495586_0214507 Ga0495586_0214507_97_612 171
831 3300046543 Ga0495645_0075044 Ga0495645_0075044_1842_2357 171
832 3300048927 Ga0496124_0049547 Ga0496124_0049547_1043_1561 171
833 3300049571 Ga0501034_0030378 Ga0501034_0030378_4258_4773 171
834 3300049758 Ga0501241_003800 Ga0501241_003800_116_652 171
835 3300050496 nmdc:mga07m45_100577_c1 nmdc:mga07m45_100577_c1_1072_1590 171
836 3300050496 nmdc:mga07m45_177196_c1 nmdc:mga07m45_177196_c1_651_1166 171
837 3300053088 Ga0500644_0000042 Ga0500644_0000042_43585_44100 171
838 3300053090 Ga0500646_0002688 Ga0500646_0002688_2609_3127 171
839 3300053092 Ga0500583_0026172 Ga0500583_0026172_706_1224 171
840 3300053109 Ga0500569_000551 Ga0500569_000551_4453_4971 171
841 3300053121 Ga0500607_024676 Ga0500607_024676_775_1290 171
842 3300053131 Ga0500652_007276 Ga0500652_007276_678_1196 171
843 3300053134 Ga0500658_0013681 Ga0500658_0013681_1844_2362 171
844 3300053136 Ga0500559_0007408 Ga0500559_0007408_818_1333 171
845 3300053139 Ga0500568_0065045 Ga0500568_0065045_54_572 171
846 3300053142 Ga0500577_0000839 Ga0500577_0000839_4768_5286 171
847 3300053148 Ga0500590_066310 Ga0500590_066310_698_1213 171
848 3300053153 Ga0500616_0080468 Ga0500616_0080468_617_1135 171
849 3300053156 Ga0500622_0000939 Ga0500622_0000939_16858_17388 171
850 3300053160 Ga0500633_0002773 Ga0500633_0002773_2654_3169 171
851 3300055283 Ga0500661_005067 Ga0500661_005067_604_1119 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03938

OmpH

Outer membrane protein (OmpH-like)

53

191

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f6j-assembly1.cif.gz_C crystal structure of the pdzd8 coiled-coil domain - rab7 complex 0.8048 35 99
4kqt-assembly1.cif.gz_A crystal structure of a putative outer membrane chaperone (omph-like) (cc_1914) from caulobacter crescentus cb15 at 2.83 a resolution (psi community target, shapiro) 0.7636 21 167
4l0r-assembly1.cif.gz_A crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a. 0.7214 43 122
4afl-assembly2.cif.gz_B the crystal structure of the ing4 dimerization domain reveals the functional organization of the ing family of chromatin binding proteins. 0.6929 30 127
4l0r-assembly1.cif.gz_A crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a. 0.6837 43 122
ID Description Score Start End Superfamily
4l0rB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.844 42 99 1.20.58.90
4javA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.829 39 99 1.10.287.130
af_Q4CPK5_36_242_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.7418 33 99 1.20.1270.60
af_Q4E676_32_269_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.7409 33 99 1.20.1270.60
af_Q498T3_2_102_1.20.81.10 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain 0.7273 29 133 1.20.81.10
ID Description Score Start End GO Terms
AF-X0YLK7-F1-model_v4 Outer membrane chaperone Skp (OmpH) 0.9799 28 168 GO:0005829
GO:0022417
GO:0050821
GO:0051082
GO:0061077
AF-A0A3D1CW46-F1-model_v4 OmpH family outer membrane protein 0.9781 26 168 GO:0005829
GO:0022417
GO:0050821
GO:0051082
GO:0061077
AF-A0A846FRX5-F1-model_v4 deleted 0.9709 20 167
AF-A0A7C5QEA2-F1-model_v4 OmpH family outer membrane protein 0.9696 20 168 GO:0005829
GO:0022417
GO:0050821
GO:0051082
GO:0061077
AF-D5BFN0-F1-model_v4 OmpH family outer membrane protein 0.9682 28 168 GO:0005829
GO:0022417
GO:0050821
GO:0051082
GO:0061077

Feature Viewer

pLDDT pTM Quality
88.79 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map