F483480
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 851 | 418 | 850 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0360168|Ga0501032_0360168_162_677 |
| Length | 171 |
| Sequence | LIQSKDPPPARAEVAAGEGETSMSGLSIRDGEWVVVCDGAKALVLQNNGDAKFPNLKTIEVFEQKDLATHEQGSDAPGRAVNSVGNMRSSVEQTDWHDQAERQFLAQLVRHLEAAVTAGKTKSLVMIAPPRALGMLRPAYSNGLRGAIRAELDKDLVKVPVHEIERRLSSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 17 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 112 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 113 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 114 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 134 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 135 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 234 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 235 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 241 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 243 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 249 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 250 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 251 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 252 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 253 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 254 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 255 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 257 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 263 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 267 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 280 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 281 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 283 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 284 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 285 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 288 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 289 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 290 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 291 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 292 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 293 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 294 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 295 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 296 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 356 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 357 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 358 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 364 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 394 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 396 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 410 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 412 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 413 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 414 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 415 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 417 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.06 |
| Metatranscriptomes | 0.82 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.88 |
| Nodule | 0.12 |
| Rhizoplane | 6.7 |
| Rhizosphere | 91.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1716414 | 2162886007 | Bacteria | 971 |
| 2 | 2214739662 | 2209111006 | Bacteria | 3880 |
| 3 | ARSoilYngRDRAFT_c00052 | 3300000042 | Bacteria | 18640 |
| 4 | ARcpr5yngRDRAFT_c000147 | 3300000043 | Bacteria | 11218 |
| 5 | ARSoilOldRDRAFT_c000002 | 3300000044 | Bacteria | 66650 |
| 6 | ARCol0oldRDRAFT_c00693 | 3300000045 | Bacteria | 2922 |
| 7 | ARCol0yngRDRAFT_1000005 | 3300000652 | Bacteria | 47205 |
| 8 | JGI24739J22299_10173016 | 3300001989 | Unclassified | 636 |
| 9 | JGI24737J22298_10000816 | 3300001990 | Bacteria | 11065 |
| 10 | JGI24737J22298_10009462 | 3300001990 | Bacteria | 3238 |
| 11 | JGI24738J21930_10000057 | 3300002075 | Bacteria | 23075 |
| 12 | JGI24749J21850_1002009 | 3300002076 | Bacteria | 2874 |
| 13 | JGI24749J21850_1007925 | 3300002076 | Bacteria | 1478 |
| 14 | JGI24744J21845_10000508 | 3300002077 | Bacteria | 6926 |
| 15 | JGI24033J26618_1000475 | 3300002155 | Bacteria | 3941 |
| 16 | JGI24034J26672_10108639 | 3300002239 | Unclassified | 528 |
| 17 | Ga0065717_1004452 | 3300005276 | Bacteria | 1035 |
| 18 | Ga0065716_1002247 | 3300005277 | Bacteria | 2038 |
| 19 | Ga0065704_10006448 | 3300005289 | Bacteria | 4479 |
| 20 | Ga0065712_10004316 | 3300005290 | Bacteria | 3995 |
| 21 | Ga0065712_10005073 | 3300005290 | Bacteria | 6697 |
| 22 | Ga0065712_10362046 | 3300005290 | Bacteria | 774 |
| 23 | Ga0065715_10002538 | 3300005293 | Bacteria | 13621 |
| 24 | Ga0065707_10035590 | 3300005295 | Bacteria | 1479 |
| 25 | Ga0070676_10003844 | 3300005328 | Bacteria | 7882 |
| 26 | Ga0070676_10523261 | 3300005328 | Bacteria | 845 |
| 27 | Ga0070683_100115014 | 3300005329 | Bacteria | 2539 |
| 28 | Ga0070683_100231273 | 3300005329 | Bacteria | 1757 |
| 29 | Ga0070683_102181136 | 3300005329 | Unclassified | 532 |
| 30 | Ga0070690_100000189 | 3300005330 | Bacteria | 31730 |
| 31 | Ga0070690_100001958 | 3300005330 | Bacteria | 10955 |
| 32 | Ga0070690_100019725 | 3300005330 | Bacteria | 4098 |
| 33 | Ga0070670_100007955 | 3300005331 | Bacteria | 9019 |
| 34 | Ga0070670_101035706 | 3300005331 | Bacteria | 747 |
| 35 | Ga0070677_10000347 | 3300005333 | Bacteria | 16155 |
| 36 | Ga0068869_100151596 | 3300005334 | Bacteria | 1798 |
| 37 | Ga0070666_10001280 | 3300005335 | Bacteria | 15216 |
| 38 | Ga0070666_10016467 | 3300005335 | Bacteria | 4729 |
| 39 | Ga0070666_10914347 | 3300005335 | Bacteria | 649 |
| 40 | Ga0070680_100003903 | 3300005336 | Bacteria | 11153 |
| 41 | Ga0070680_100011404 | 3300005336 | Bacteria | 6874 |
| 42 | Ga0070680_100013996 | 3300005336 | Bacteria | 6262 |
| 43 | Ga0070680_100255672 | 3300005336 | Bacteria | 1482 |
| 44 | Ga0070680_100999539 | 3300005336 | Bacteria | 722 |
| 45 | Ga0070682_100006959 | 3300005337 | Bacteria | 6359 |
| 46 | Ga0070682_100027997 | 3300005337 | Bacteria | 3386 |
| 47 | Ga0070682_100076704 | 3300005337 | Bacteria | 2152 |
| 48 | Ga0070682_100398681 | 3300005337 | Bacteria | 1040 |
| 49 | Ga0068868_100002148 | 3300005338 | Bacteria | 13618 |
| 50 | Ga0068868_100016286 | 3300005338 | Bacteria | 5517 |
| 51 | Ga0070660_100001222 | 3300005339 | Bacteria | 17467 |
| 52 | Ga0070660_100039588 | 3300005339 | Bacteria | 3584 |
| 53 | Ga0070660_100094640 | 3300005339 | Bacteria | 2360 |
| 54 | Ga0070660_100136966 | 3300005339 | Bacteria | 1962 |
| 55 | Ga0070689_100000770 | 3300005340 | Bacteria | 19626 |
| 56 | Ga0070689_100151653 | 3300005340 | Bacteria | 1869 |
| 57 | Ga0070691_10088289 | 3300005341 | Bacteria | 1526 |
| 58 | Ga0070687_100177140 | 3300005343 | Bacteria | 1274 |
| 59 | Ga0070687_101035558 | 3300005343 | Bacteria | 597 |
| 60 | Ga0070661_100038917 | 3300005344 | Bacteria | 3463 |
| 61 | Ga0070661_100123073 | 3300005344 | Bacteria | 1944 |
| 62 | Ga0070661_100201492 | 3300005344 | Bacteria | 1521 |
| 63 | Ga0070692_10096422 | 3300005345 | Bacteria | 1615 |
| 64 | Ga0070692_10441395 | 3300005345 | Bacteria | 831 |
| 65 | Ga0070692_10554337 | 3300005345 | Bacteria | 753 |
| 66 | Ga0070668_100007912 | 3300005347 | Bacteria | 7894 |
| 67 | Ga0070668_100123434 | 3300005347 | Bacteria | 2072 |
| 68 | Ga0070669_100010601 | 3300005353 | Bacteria | 6545 |
| 69 | Ga0070669_100198749 | 3300005353 | Bacteria | 1576 |
| 70 | Ga0070669_100384038 | 3300005353 | Bacteria | 1146 |
| 71 | Ga0070669_100848098 | 3300005353 | Unclassified | 778 |
| 72 | Ga0070675_100085017 | 3300005354 | Bacteria | 2642 |
| 73 | Ga0070675_100663032 | 3300005354 | Bacteria | 949 |
| 74 | Ga0070671_100001430 | 3300005355 | Bacteria | 17817 |
| 75 | Ga0070671_100009186 | 3300005355 | Bacteria | 7937 |
| 76 | Ga0070671_100073817 | 3300005355 | Bacteria | 2849 |
| 77 | Ga0070674_100002774 | 3300005356 | Bacteria | 9679 |
| 78 | Ga0070674_100039157 | 3300005356 | Bacteria | 3200 |
| 79 | Ga0070674_101119679 | 3300005356 | Bacteria | 696 |
| 80 | Ga0070673_100000351 | 3300005364 | Bacteria | 24222 |
| 81 | Ga0070673_100004787 | 3300005364 | Bacteria | 8598 |
| 82 | Ga0070673_100098213 | 3300005364 | Bacteria | 2406 |
| 83 | Ga0070673_100837112 | 3300005364 | Bacteria | 851 |
| 84 | Ga0070688_100000636 | 3300005365 | Bacteria | 17462 |
| 85 | Ga0070688_100007216 | 3300005365 | Bacteria | 5985 |
| 86 | Ga0070688_101175369 | 3300005365 | Bacteria | 616 |
| 87 | Ga0070659_100043241 | 3300005366 | Bacteria | 3523 |
| 88 | Ga0070659_100049436 | 3300005366 | Bacteria | 3306 |
| 89 | Ga0070659_100577846 | 3300005366 | Bacteria | 964 |
| 90 | Ga0070667_100013160 | 3300005367 | Bacteria | 6838 |
| 91 | Ga0070667_100039413 | 3300005367 | Bacteria | 3960 |
| 92 | Ga0070667_100394027 | 3300005367 | Bacteria | 1259 |
| 93 | Ga0070667_101171335 | 3300005367 | Bacteria | 719 |
| 94 | Ga0070703_10002228 | 3300005406 | Bacteria | 5634 |
| 95 | Ga0070703_10044342 | 3300005406 | Bacteria | 1398 |
| 96 | Ga0070709_10001206 | 3300005434 | Bacteria | 14200 |
| 97 | Ga0070709_10068063 | 3300005434 | Bacteria | 2288 |
| 98 | Ga0070709_10250470 | 3300005434 | Bacteria | 1276 |
| 99 | Ga0070714_100004005 | 3300005435 | Bacteria | 11079 |
| 100 | Ga0070714_100018072 | 3300005435 | Bacteria | 5719 |
| 101 | Ga0070714_100069015 | 3300005435 | Bacteria | 3051 |
| 102 | Ga0070714_100240283 | 3300005435 | Bacteria | 1671 |
| 103 | Ga0070713_100000423 | 3300005436 | Bacteria | 26996 |
| 104 | Ga0070713_100268406 | 3300005436 | Bacteria | 1562 |
| 105 | Ga0070710_10001578 | 3300005437 | Bacteria | 10754 |
| 106 | Ga0070710_10040870 | 3300005437 | Bacteria | 2557 |
| 107 | Ga0070701_10045191 | 3300005438 | Bacteria | 2259 |
| 108 | Ga0070711_100130902 | 3300005439 | Bacteria | 1868 |
| 109 | Ga0070711_100145182 | 3300005439 | Bacteria | 1783 |
| 110 | Ga0070705_100007839 | 3300005440 | Bacteria | 5273 |
| 111 | Ga0070705_100090751 | 3300005440 | Bacteria | 1903 |
| 112 | Ga0070700_100043624 | 3300005441 | Bacteria | 2759 |
| 113 | Ga0070700_100777762 | 3300005441 | Bacteria | 769 |
| 114 | Ga0070694_100000666 | 3300005444 | Bacteria | 18998 |
| 115 | Ga0070694_100499852 | 3300005444 | Bacteria | 967 |
| 116 | Ga0070708_100292667 | 3300005445 | Bacteria | 1533 |
| 117 | Ga0070663_100008450 | 3300005455 | Bacteria | 6335 |
| 118 | Ga0070663_100026749 | 3300005455 | Bacteria | 3910 |
| 119 | Ga0070663_100137705 | 3300005455 | Bacteria | 1860 |
| 120 | Ga0070678_100006139 | 3300005456 | Bacteria | 7017 |
| 121 | Ga0070678_100019629 | 3300005456 | Bacteria | 4414 |
| 122 | Ga0070662_100008526 | 3300005457 | Bacteria | 6687 |
| 123 | Ga0070662_100206098 | 3300005457 | Bacteria | 1562 |
| 124 | Ga0070662_100429756 | 3300005457 | Bacteria | 1094 |
| 125 | Ga0070662_100835833 | 3300005457 | Bacteria | 784 |
| 126 | Ga0070681_10001541 | 3300005458 | Bacteria | 20414 |
| 127 | Ga0070681_10046591 | 3300005458 | Bacteria | 4334 |
| 128 | Ga0070681_10057034 | 3300005458 | Bacteria | 3886 |
| 129 | Ga0070681_10096426 | 3300005458 | Bacteria | 2905 |
| 130 | Ga0070681_10351881 | 3300005458 | Bacteria | 1383 |
| 131 | Ga0070681_10633913 | 3300005458 | Bacteria | 984 |
| 132 | Ga0068867_100167242 | 3300005459 | Bacteria | 1739 |
| 133 | Ga0070685_10008742 | 3300005466 | Bacteria | 5213 |
| 134 | Ga0070685_10050286 | 3300005466 | Bacteria | 2407 |
| 135 | Ga0070698_100679973 | 3300005471 | Bacteria | 971 |
| 136 | Ga0074259_10781806 | 3300005507 | Bacteria | 886 |
| 137 | Ga0070679_100001345 | 3300005530 | Bacteria | 21702 |
| 138 | Ga0070679_100048353 | 3300005530 | Bacteria | 4238 |
| 139 | Ga0070679_100141844 | 3300005530 | Bacteria | 2381 |
| 140 | Ga0070679_100299601 | 3300005530 | Bacteria | 1558 |
| 141 | Ga0070679_100548721 | 3300005530 | Bacteria | 1099 |
| 142 | Ga0070684_100032724 | 3300005535 | Bacteria | 4434 |
| 143 | Ga0070684_100167000 | 3300005535 | Bacteria | 1998 |
| 144 | Ga0070684_100206406 | 3300005535 | Bacteria | 1790 |
| 145 | Ga0070697_100261566 | 3300005536 | Bacteria | 1482 |
| 146 | Ga0068853_100075401 | 3300005539 | Bacteria | 2943 |
| 147 | Ga0068853_100207259 | 3300005539 | Bacteria | 1786 |
| 148 | Ga0068853_100629183 | 3300005539 | Bacteria | 1020 |
| 149 | Ga0068853_102002678 | 3300005539 | Bacteria | 562 |
| 150 | Ga0070672_100001305 | 3300005543 | Bacteria | 15369 |
| 151 | Ga0070686_100000591 | 3300005544 | Bacteria | 21432 |
| 152 | Ga0070686_100050224 | 3300005544 | Bacteria | 2650 |
| 153 | Ga0070686_100212769 | 3300005544 | Bacteria | 1393 |
| 154 | Ga0070686_100454436 | 3300005544 | Bacteria | 985 |
| 155 | Ga0070686_100742351 | 3300005544 | Bacteria | 787 |
| 156 | Ga0070695_100096527 | 3300005545 | Bacteria | 1983 |
| 157 | Ga0070695_100535454 | 3300005545 | Bacteria | 911 |
| 158 | Ga0070696_100010728 | 3300005546 | Bacteria | 6137 |
| 159 | Ga0070696_100016768 | 3300005546 | Bacteria | 4941 |
| 160 | Ga0070696_100038234 | 3300005546 | Bacteria | 3312 |
| 161 | Ga0070696_100251405 | 3300005546 | Bacteria | 1337 |
| 162 | Ga0070696_100601358 | 3300005546 | Bacteria | 887 |
| 163 | Ga0070693_100023452 | 3300005547 | Bacteria | 3298 |
| 164 | Ga0070693_100045206 | 3300005547 | Bacteria | 2495 |
| 165 | Ga0070693_100615154 | 3300005547 | Bacteria | 786 |
| 166 | Ga0070665_100062458 | 3300005548 | Bacteria | 3735 |
| 167 | Ga0070704_100014344 | 3300005549 | Bacteria | 4948 |
| 168 | Ga0070704_100042161 | 3300005549 | Bacteria | 3155 |
| 169 | Ga0068855_100021052 | 3300005563 | Bacteria | 7819 |
| 170 | Ga0068855_100088149 | 3300005563 | Bacteria | 3585 |
| 171 | Ga0068855_100172797 | 3300005563 | Bacteria | 2446 |
| 172 | Ga0070664_100008474 | 3300005564 | Bacteria | 8313 |
| 173 | Ga0070664_100064979 | 3300005564 | Bacteria | 3112 |
| 174 | Ga0070664_100142275 | 3300005564 | Bacteria | 2113 |
| 175 | Ga0070664_100241482 | 3300005564 | Bacteria | 1622 |
| 176 | Ga0068857_100001568 | 3300005577 | Bacteria | 18308 |
| 177 | Ga0068857_100126454 | 3300005577 | Bacteria | 2303 |
| 178 | Ga0068857_100205500 | 3300005577 | Bacteria | 1796 |
| 179 | Ga0068857_100629530 | 3300005577 | Bacteria | 1015 |
| 180 | Ga0068854_100069724 | 3300005578 | Bacteria | 2568 |
| 181 | Ga0068854_100482664 | 3300005578 | Bacteria | 1041 |
| 182 | Ga0068856_100088582 | 3300005614 | Bacteria | 3077 |
| 183 | Ga0068856_100266215 | 3300005614 | Bacteria | 1730 |
| 184 | Ga0068856_100730214 | 3300005614 | Bacteria | 1011 |
| 185 | Ga0068856_100823218 | 3300005614 | Bacteria | 948 |
| 186 | Ga0070702_100001523 | 3300005615 | Bacteria | 9534 |
| 187 | Ga0070702_100036733 | 3300005615 | Bacteria | 2716 |
| 188 | Ga0068852_100292209 | 3300005616 | Bacteria | 1575 |
| 189 | Ga0068852_100349217 | 3300005616 | Bacteria | 1444 |
| 190 | Ga0068852_100378176 | 3300005616 | Bacteria | 1389 |
| 191 | Ga0068852_100423443 | 3300005616 | Bacteria | 1314 |
| 192 | Ga0068859_100004726 | 3300005617 | Bacteria | 13834 |
| 193 | Ga0068859_100068342 | 3300005617 | Bacteria | 3587 |
| 194 | Ga0068859_100069668 | 3300005617 | Bacteria | 3552 |
| 195 | Ga0068859_100093053 | 3300005617 | Bacteria | 3066 |
| 196 | Ga0068859_100206429 | 3300005617 | Bacteria | 2050 |
| 197 | Ga0068864_100072258 | 3300005618 | Bacteria | 3006 |
| 198 | Ga0068864_100841063 | 3300005618 | Bacteria | 904 |
| 199 | Ga0068866_10392245 | 3300005718 | Bacteria | 893 |
| 200 | Ga0068861_100338496 | 3300005719 | Bacteria | 1316 |
| 201 | Ga0068861_100374788 | 3300005719 | Bacteria | 1255 |
| 202 | Ga0068851_10282260 | 3300005834 | Bacteria | 950 |
| 203 | Ga0068870_10000107 | 3300005840 | Bacteria | 28449 |
| 204 | Ga0068870_10723322 | 3300005840 | Bacteria | 689 |
| 205 | Ga0068863_100252417 | 3300005841 | Bacteria | 1704 |
| 206 | Ga0068863_100542679 | 3300005841 | Bacteria | 1147 |
| 207 | Ga0068863_100759791 | 3300005841 | Bacteria | 965 |
| 208 | Ga0068858_100036809 | 3300005842 | Bacteria | 4537 |
| 209 | Ga0068858_100342234 | 3300005842 | Bacteria | 1431 |
| 210 | Ga0068858_100501436 | 3300005842 | Bacteria | 1173 |
| 211 | Ga0068858_100637002 | 3300005842 | Bacteria | 1035 |
| 212 | Ga0068860_100070594 | 3300005843 | Bacteria | 3321 |
| 213 | Ga0068860_100629226 | 3300005843 | Bacteria | 1080 |
| 214 | Ga0068862_100046532 | 3300005844 | Bacteria | 3701 |
| 215 | Ga0068862_100917966 | 3300005844 | Bacteria | 862 |
| 216 | Ga0081455_10000012 | 3300005937 | Bacteria | 201668 |
| 217 | Ga0081455_10209824 | 3300005937 | Bacteria | 1452 |
| 218 | Ga0081455_10263464 | 3300005937 | Bacteria | 1254 |
| 219 | Ga0081538_10047724 | 3300005981 | Bacteria | 2622 |
| 220 | Ga0081540_1087819 | 3300005983 | Bacteria | 1376 |
| 221 | Ga0081539_10034315 | 3300005985 | Bacteria | 3071 |
| 222 | Ga0075365_11338890 | 3300006038 | Unclassified | 503 |
| 223 | Ga0075363_100325266 | 3300006048 | Bacteria | 895 |
| 224 | Ga0075363_100583256 | 3300006048 | Unclassified | 669 |
| 225 | Ga0075432_10048392 | 3300006058 | Bacteria | 1496 |
| 226 | Ga0075432_10160795 | 3300006058 | Bacteria | 868 |
| 227 | Ga0070715_10011106 | 3300006163 | Bacteria | 3233 |
| 228 | Ga0070716_100001630 | 3300006173 | Bacteria | 10116 |
| 229 | Ga0070716_100056841 | 3300006173 | Bacteria | 2246 |
| 230 | Ga0070716_100297130 | 3300006173 | Bacteria | 1122 |
| 231 | Ga0070712_100030464 | 3300006175 | Bacteria | 3625 |
| 232 | Ga0070712_100072724 | 3300006175 | Bacteria | 2463 |
| 233 | Ga0070712_100110739 | 3300006175 | Bacteria | 2048 |
| 234 | Ga0075367_10164761 | 3300006178 | Bacteria | 1379 |
| 235 | Ga0075366_10664020 | 3300006195 | Bacteria | 647 |
| 236 | Ga0097621_100006955 | 3300006237 | Bacteria | 8054 |
| 237 | Ga0068871_100003093 | 3300006358 | Bacteria | 11417 |
| 238 | Ga0068871_100059420 | 3300006358 | Bacteria | 3115 |
| 239 | Ga0075428_100075386 | 3300006844 | Bacteria | 3684 |
| 240 | Ga0075430_100137691 | 3300006846 | Bacteria | 2033 |
| 241 | Ga0075431_100509572 | 3300006847 | Bacteria | 1193 |
| 242 | Ga0075431_100610157 | 3300006847 | Unclassified | 1074 |
| 243 | Ga0075434_100102527 | 3300006871 | Bacteria | 2869 |
| 244 | Ga0075434_100104971 | 3300006871 | Bacteria | 2835 |
| 245 | Ga0075434_100162917 | 3300006871 | Bacteria | 2250 |
| 246 | Ga0075434_100494155 | 3300006871 | Bacteria | 1244 |
| 247 | Ga0075434_101017745 | 3300006871 | Unclassified | 842 |
| 248 | Ga0075429_100476984 | 3300006880 | Bacteria | 1093 |
| 249 | Ga0075429_101298219 | 3300006880 | Bacteria | 635 |
| 250 | Ga0068865_100044238 | 3300006881 | Bacteria | 3047 |
| 251 | Ga0068865_100056639 | 3300006881 | Bacteria | 2732 |
| 252 | Ga0075436_100075687 | 3300006914 | Bacteria | 2330 |
| 253 | Ga0097620_100004726 | 3300006931 | Bacteria | 13834 |
| 254 | Ga0097620_100068342 | 3300006931 | Bacteria | 3587 |
| 255 | Ga0097620_100069664 | 3300006931 | Bacteria | 3552 |
| 256 | Ga0097620_100093045 | 3300006931 | Bacteria | 3066 |
| 257 | Ga0097620_100206441 | 3300006931 | Bacteria | 2050 |
| 258 | Ga0075435_100064065 | 3300007076 | Bacteria | 2986 |
| 259 | Ga0105251_10019357 | 3300009011 | Bacteria | 3599 |
| 260 | Ga0105251_10405144 | 3300009011 | Bacteria | 627 |
| 261 | Ga0105250_10086841 | 3300009092 | Bacteria | 1270 |
| 262 | Ga0105250_10257303 | 3300009092 | Bacteria | 747 |
| 263 | Ga0105240_10029646 | 3300009093 | Bacteria | 7123 |
| 264 | Ga0105240_10401726 | 3300009093 | Bacteria | 1543 |
| 265 | Ga0105240_10516840 | 3300009093 | Bacteria | 1326 |
| 266 | Ga0111539_10001217 | 3300009094 | Bacteria | 34255 |
| 267 | Ga0111539_10015411 | 3300009094 | Bacteria | 9511 |
| 268 | Ga0111539_10617522 | 3300009094 | Bacteria | 1262 |
| 269 | Ga0105245_10161057 | 3300009098 | Bacteria | 2129 |
| 270 | Ga0105245_10586372 | 3300009098 | Bacteria | 1140 |
| 271 | Ga0105245_12115198 | 3300009098 | Bacteria | 617 |
| 272 | Ga0105247_10001754 | 3300009101 | Bacteria | 15273 |
| 273 | Ga0105247_10019797 | 3300009101 | Bacteria | 4042 |
| 274 | Ga0105247_10028913 | 3300009101 | Bacteria | 3355 |
| 275 | Ga0105247_10430530 | 3300009101 | Bacteria | 947 |
| 276 | Ga0114129_10038658 | 3300009147 | Bacteria | 6729 |
| 277 | Ga0105243_10029408 | 3300009148 | Bacteria | 4225 |
| 278 | Ga0105243_10048043 | 3300009148 | Bacteria | 3363 |
| 279 | Ga0105243_11238678 | 3300009148 | Bacteria | 761 |
| 280 | Ga0105241_10000891 | 3300009174 | Bacteria | 22534 |
| 281 | Ga0105241_10011615 | 3300009174 | Bacteria | 6458 |
| 282 | Ga0105241_11171438 | 3300009174 | Bacteria | 727 |
| 283 | Ga0105242_10007190 | 3300009176 | Bacteria | 8587 |
| 284 | Ga0105242_10167123 | 3300009176 | Bacteria | 1931 |
| 285 | Ga0105248_10000638 | 3300009177 | Bacteria | 39824 |
| 286 | Ga0105248_10007450 | 3300009177 | Bacteria | 12008 |
| 287 | Ga0105248_10683596 | 3300009177 | Bacteria | 1158 |
| 288 | Ga0105248_10916262 | 3300009177 | Bacteria | 990 |
| 289 | Ga0105237_10347842 | 3300009545 | Bacteria | 1487 |
| 290 | Ga0105237_11729627 | 3300009545 | Bacteria | 633 |
| 291 | Ga0105238_10014196 | 3300009551 | Bacteria | 8057 |
| 292 | Ga0105238_10028944 | 3300009551 | Bacteria | 5642 |
| 293 | Ga0105249_10020932 | 3300009553 | Bacteria | 5850 |
| 294 | Ga0105249_10564442 | 3300009553 | Bacteria | 1190 |
| 295 | Ga0105249_10573051 | 3300009553 | Bacteria | 1181 |
| 296 | Ga0105249_10797724 | 3300009553 | Bacteria | 1008 |
| 297 | Ga0105249_10919413 | 3300009553 | Bacteria | 942 |
| 298 | Ga0105249_11812988 | 3300009553 | Bacteria | 683 |
| 299 | Ga0105239_10005135 | 3300010375 | Bacteria | 15458 |
| 300 | Ga0105239_10082950 | 3300010375 | Bacteria | 3530 |
| 301 | Ga0105239_10510512 | 3300010375 | Bacteria | 1367 |
| 302 | Ga0105246_10076578 | 3300011119 | Bacteria | 2371 |
| 303 | Ga0105246_10816343 | 3300011119 | Bacteria | 829 |
| 304 | Ga0157347_1009871 | 3300012502 | Bacteria | 994 |
| 305 | Ga0157313_1002708 | 3300012503 | Bacteria | 1085 |
| 306 | Ga0157326_1003964 | 3300012513 | Bacteria | 1555 |
| 307 | Ga0157373_10024655 | 3300013100 | Bacteria | 4357 |
| 308 | Ga0157373_10449663 | 3300013100 | Bacteria | 927 |
| 309 | Ga0157373_10487985 | 3300013100 | Bacteria | 889 |
| 310 | Ga0157371_10159389 | 3300013102 | Bacteria | 1611 |
| 311 | Ga0157371_10340723 | 3300013102 | Bacteria | 1090 |
| 312 | Ga0157370_10491474 | 3300013104 | Bacteria | 1127 |
| 313 | Ga0157369_11070952 | 3300013105 | Bacteria | 824 |
| 314 | Ga0157374_10138179 | 3300013296 | Bacteria | 2363 |
| 315 | Ga0157374_10207106 | 3300013296 | Bacteria | 1922 |
| 316 | Ga0157374_10509864 | 3300013296 | Bacteria | 1208 |
| 317 | Ga0157374_12792937 | 3300013296 | Bacteria | 516 |
| 318 | Ga0157378_10006939 | 3300013297 | Bacteria | 9883 |
| 319 | Ga0157378_10213432 | 3300013297 | Bacteria | 1831 |
| 320 | Ga0163162_10047751 | 3300013306 | Bacteria | 4289 |
| 321 | Ga0163162_10094840 | 3300013306 | Bacteria | 3070 |
| 322 | Ga0157372_10531262 | 3300013307 | Bacteria | 1371 |
| 323 | Ga0157372_11337572 | 3300013307 | Bacteria | 826 |
| 324 | Ga0157372_12404903 | 3300013307 | Bacteria | 605 |
| 325 | Ga0157375_10002695 | 3300013308 | Bacteria | 15380 |
| 326 | Ga0157375_10165195 | 3300013308 | Bacteria | 2358 |
| 327 | Ga0157375_10299559 | 3300013308 | Bacteria | 1771 |
| 328 | Ga0157375_10846755 | 3300013308 | Bacteria | 1061 |
| 329 | Ga0157375_11148205 | 3300013308 | Bacteria | 910 |
| 330 | Ga0163163_10023833 | 3300014325 | Bacteria | 5816 |
| 331 | Ga0163163_10046102 | 3300014325 | Bacteria | 4281 |
| 332 | Ga0163163_10109870 | 3300014325 | Bacteria | 2785 |
| 333 | Ga0163163_10221990 | 3300014325 | Bacteria | 1939 |
| 334 | Ga0163163_10431856 | 3300014325 | Bacteria | 1376 |
| 335 | Ga0157380_10004026 | 3300014326 | Bacteria | 10148 |
| 336 | Ga0157380_10387959 | 3300014326 | Bacteria | 1320 |
| 337 | Ga0157380_10719105 | 3300014326 | Bacteria | 1006 |
| 338 | Ga0157380_12024386 | 3300014326 | Bacteria | 638 |
| 339 | Ga0157380_12570285 | 3300014326 | Bacteria | 575 |
| 340 | Ga0157379_10103256 | 3300014968 | Bacteria | 2558 |
| 341 | Ga0157379_10240775 | 3300014968 | Bacteria | 1641 |
| 342 | Ga0157376_10720596 | 3300014969 | Bacteria | 1004 |
| 343 | Ga0157376_11034001 | 3300014969 | Bacteria | 845 |
| 344 | Ga0163161_10001790 | 3300017792 | Bacteria | 15682 |
| 345 | Ga0163161_10082933 | 3300017792 | Bacteria | 2363 |
| 346 | Ga0197907_10525614 | 3300020069 | Bacteria | 1125 |
| 347 | Ga0206356_10463979 | 3300020070 | Bacteria | 1694 |
| 348 | Ga0206356_10908987 | 3300020070 | Bacteria | 1464 |
| 349 | Ga0206352_10919806 | 3300020078 | Unclassified | 577 |
| 350 | Ga0206353_11507390 | 3300020082 | Bacteria | 1725 |
| 351 | Ga0154015_1421512 | 3300020610 | Bacteria | 596 |
| 352 | Ga0224712_10627127 | 3300022467 | Bacteria | 526 |
| 353 | Ga0207666_1001296 | 3300025271 | Bacteria | 2941 |
| 354 | Ga0207673_1000114 | 3300025290 | Bacteria | 7463 |
| 355 | Ga0207697_10000913 | 3300025315 | Bacteria | 16698 |
| 356 | Ga0207697_10026179 | 3300025315 | Bacteria | 2386 |
| 357 | Ga0207653_10041083 | 3300025885 | Bacteria | 1518 |
| 358 | Ga0207682_10000107 | 3300025893 | Bacteria | 37788 |
| 359 | Ga0207692_10001671 | 3300025898 | Bacteria | 8383 |
| 360 | Ga0207642_10748833 | 3300025899 | Unclassified | 618 |
| 361 | Ga0207710_10003883 | 3300025900 | Bacteria | 6609 |
| 362 | Ga0207710_10061124 | 3300025900 | Bacteria | 1709 |
| 363 | Ga0207688_10016191 | 3300025901 | Bacteria | 4042 |
| 364 | Ga0207688_10051981 | 3300025901 | Bacteria | 2295 |
| 365 | Ga0207688_10062206 | 3300025901 | Bacteria | 2104 |
| 366 | Ga0207688_10380834 | 3300025901 | Bacteria | 873 |
| 367 | Ga0207680_10004687 | 3300025903 | Bacteria | 6497 |
| 368 | Ga0207680_10166488 | 3300025903 | Bacteria | 1482 |
| 369 | Ga0207647_10010513 | 3300025904 | Bacteria | 6535 |
| 370 | Ga0207647_10017796 | 3300025904 | Bacteria | 4822 |
| 371 | Ga0207685_10001449 | 3300025905 | Bacteria | 4976 |
| 372 | Ga0207699_10002364 | 3300025906 | Bacteria | 8905 |
| 373 | Ga0207699_10056461 | 3300025906 | Bacteria | 2340 |
| 374 | Ga0207699_10086923 | 3300025906 | Bacteria | 1954 |
| 375 | Ga0207645_10000655 | 3300025907 | Bacteria | 28729 |
| 376 | Ga0207643_10092580 | 3300025908 | Bacteria | 1764 |
| 377 | Ga0207705_10009573 | 3300025909 | Bacteria | 7048 |
| 378 | Ga0207654_10004317 | 3300025911 | Bacteria | 7166 |
| 379 | Ga0207654_10009569 | 3300025911 | Bacteria | 4926 |
| 380 | Ga0207707_10007710 | 3300025912 | Bacteria | 9376 |
| 381 | Ga0207707_10024331 | 3300025912 | Bacteria | 5300 |
| 382 | Ga0207707_10260577 | 3300025912 | Bacteria | 1505 |
| 383 | Ga0207695_10437877 | 3300025913 | Bacteria | 1191 |
| 384 | Ga0207695_10690028 | 3300025913 | Bacteria | 902 |
| 385 | Ga0207671_10535604 | 3300025914 | Bacteria | 934 |
| 386 | Ga0207671_10998033 | 3300025914 | Bacteria | 660 |
| 387 | Ga0207693_10001389 | 3300025915 | Bacteria | 21464 |
| 388 | Ga0207693_10003329 | 3300025915 | Bacteria | 13753 |
| 389 | Ga0207693_10013980 | 3300025915 | Bacteria | 6464 |
| 390 | Ga0207660_10061167 | 3300025917 | Bacteria | 2710 |
| 391 | Ga0207660_10127706 | 3300025917 | Bacteria | 1932 |
| 392 | Ga0207660_10294823 | 3300025917 | Bacteria | 1290 |
| 393 | Ga0207660_10759623 | 3300025917 | Bacteria | 791 |
| 394 | Ga0207662_10000219 | 3300025918 | Bacteria | 26640 |
| 395 | Ga0207662_10048474 | 3300025918 | Bacteria | 2516 |
| 396 | Ga0207657_10003532 | 3300025919 | Bacteria | 16698 |
| 397 | Ga0207657_10012089 | 3300025919 | Bacteria | 8532 |
| 398 | Ga0207649_10120601 | 3300025920 | Bacteria | 1767 |
| 399 | Ga0207649_10142448 | 3300025920 | Bacteria | 1642 |
| 400 | Ga0207649_10885866 | 3300025920 | Bacteria | 699 |
| 401 | Ga0207652_10031841 | 3300025921 | Bacteria | 4429 |
| 402 | Ga0207652_10039661 | 3300025921 | Bacteria | 3997 |
| 403 | Ga0207652_10042562 | 3300025921 | Bacteria | 3866 |
| 404 | Ga0207652_10066697 | 3300025921 | Bacteria | 3119 |
| 405 | Ga0207681_10391696 | 3300025923 | Bacteria | 1120 |
| 406 | Ga0207694_10038022 | 3300025924 | Bacteria | 3700 |
| 407 | Ga0207694_10147335 | 3300025924 | Bacteria | 1895 |
| 408 | Ga0207694_10421731 | 3300025924 | Bacteria | 1111 |
| 409 | Ga0207650_10009061 | 3300025925 | Bacteria | 6802 |
| 410 | Ga0207650_10128693 | 3300025925 | Bacteria | 1979 |
| 411 | Ga0207650_11253838 | 3300025925 | Bacteria | 631 |
| 412 | Ga0207659_10060672 | 3300025926 | Bacteria | 2723 |
| 413 | Ga0207659_10183322 | 3300025926 | Bacteria | 1660 |
| 414 | Ga0207659_10263314 | 3300025926 | Bacteria | 1403 |
| 415 | Ga0207700_10523543 | 3300025928 | Bacteria | 1051 |
| 416 | Ga0207664_10080162 | 3300025929 | Bacteria | 2653 |
| 417 | Ga0207664_10103821 | 3300025929 | Bacteria | 2352 |
| 418 | Ga0207664_10107277 | 3300025929 | Bacteria | 2317 |
| 419 | Ga0207664_10193151 | 3300025929 | Bacteria | 1753 |
| 420 | Ga0207664_11000693 | 3300025929 | Bacteria | 749 |
| 421 | Ga0207644_10007296 | 3300025931 | Bacteria | 7195 |
| 422 | Ga0207644_10010415 | 3300025931 | Bacteria | 6126 |
| 423 | Ga0207644_10075013 | 3300025931 | Bacteria | 2484 |
| 424 | Ga0207690_10009361 | 3300025932 | Bacteria | 5818 |
| 425 | Ga0207690_10012020 | 3300025932 | Bacteria | 5177 |
| 426 | Ga0207706_10054580 | 3300025933 | Bacteria | 3526 |
| 427 | Ga0207706_10233409 | 3300025933 | Bacteria | 1609 |
| 428 | Ga0207686_10005571 | 3300025934 | Bacteria | 6749 |
| 429 | Ga0207686_10063062 | 3300025934 | Bacteria | 2355 |
| 430 | Ga0207709_10003899 | 3300025935 | Bacteria | 8713 |
| 431 | Ga0207709_10004724 | 3300025935 | Bacteria | 7824 |
| 432 | Ga0207709_10045569 | 3300025935 | Bacteria | 2657 |
| 433 | Ga0207709_10376686 | 3300025935 | Bacteria | 1079 |
| 434 | Ga0207670_10016730 | 3300025936 | Bacteria | 4415 |
| 435 | Ga0207670_10030395 | 3300025936 | Bacteria | 3451 |
| 436 | Ga0207670_10061276 | 3300025936 | Bacteria | 2567 |
| 437 | Ga0207670_10080900 | 3300025936 | Bacteria | 2272 |
| 438 | Ga0207669_10009055 | 3300025937 | Bacteria | 4716 |
| 439 | Ga0207669_10095007 | 3300025937 | Bacteria | 1953 |
| 440 | Ga0207704_10130064 | 3300025938 | Bacteria | 1742 |
| 441 | Ga0207665_10000662 | 3300025939 | Bacteria | 23233 |
| 442 | Ga0207665_10124378 | 3300025939 | Bacteria | 1825 |
| 443 | Ga0207665_11136284 | 3300025939 | Bacteria | 623 |
| 444 | Ga0207691_10000885 | 3300025940 | Bacteria | 29733 |
| 445 | Ga0207691_10138288 | 3300025940 | Bacteria | 2147 |
| 446 | Ga0207691_10838861 | 3300025940 | Bacteria | 771 |
| 447 | Ga0207711_10018008 | 3300025941 | Bacteria | 5871 |
| 448 | Ga0207711_10556309 | 3300025941 | Bacteria | 1070 |
| 449 | Ga0207711_10827766 | 3300025941 | Bacteria | 862 |
| 450 | Ga0207689_10000348 | 3300025942 | Bacteria | 43237 |
| 451 | Ga0207689_10089316 | 3300025942 | Bacteria | 2531 |
| 452 | Ga0207689_10531413 | 3300025942 | Bacteria | 987 |
| 453 | Ga0207661_10002293 | 3300025944 | Bacteria | 13172 |
| 454 | Ga0207661_10032802 | 3300025944 | Bacteria | 4027 |
| 455 | Ga0207661_10943997 | 3300025944 | Bacteria | 794 |
| 456 | Ga0207679_10041801 | 3300025945 | Bacteria | 3290 |
| 457 | Ga0207679_10044842 | 3300025945 | Bacteria | 3194 |
| 458 | Ga0207679_11214277 | 3300025945 | Bacteria | 692 |
| 459 | Ga0207667_10040369 | 3300025949 | Bacteria | 4969 |
| 460 | Ga0207667_10052119 | 3300025949 | Bacteria | 4312 |
| 461 | Ga0207667_10273612 | 3300025949 | Bacteria | 1726 |
| 462 | Ga0207667_10784498 | 3300025949 | Bacteria | 950 |
| 463 | Ga0207651_10053757 | 3300025960 | Bacteria | 2755 |
| 464 | Ga0207651_10952117 | 3300025960 | Bacteria | 766 |
| 465 | Ga0207712_10004014 | 3300025961 | Bacteria | 9292 |
| 466 | Ga0207712_10384456 | 3300025961 | Bacteria | 1176 |
| 467 | Ga0207712_10733033 | 3300025961 | Bacteria | 865 |
| 468 | Ga0207712_10902748 | 3300025961 | Bacteria | 781 |
| 469 | Ga0207668_10001277 | 3300025972 | Bacteria | 15017 |
| 470 | Ga0207668_10176389 | 3300025972 | Bacteria | 1681 |
| 471 | Ga0207640_10162280 | 3300025981 | Bacteria | 1655 |
| 472 | Ga0207640_10849767 | 3300025981 | Bacteria | 794 |
| 473 | Ga0207640_11650068 | 3300025981 | Unclassified | 578 |
| 474 | Ga0207658_10043628 | 3300025986 | Bacteria | 3261 |
| 475 | Ga0207658_10189798 | 3300025986 | Bacteria | 1707 |
| 476 | Ga0207658_10533896 | 3300025986 | Bacteria | 1048 |
| 477 | Ga0207677_10045838 | 3300026023 | Bacteria | 2922 |
| 478 | Ga0207677_10400172 | 3300026023 | Bacteria | 1164 |
| 479 | Ga0207703_10018706 | 3300026035 | Bacteria | 5411 |
| 480 | Ga0207703_10092663 | 3300026035 | Bacteria | 2543 |
| 481 | Ga0207703_10257683 | 3300026035 | Bacteria | 1575 |
| 482 | Ga0207703_10345530 | 3300026035 | Bacteria | 1368 |
| 483 | Ga0207703_10576085 | 3300026035 | Bacteria | 1063 |
| 484 | Ga0207639_10100632 | 3300026041 | Bacteria | 2335 |
| 485 | Ga0207639_10128412 | 3300026041 | Bacteria | 2095 |
| 486 | Ga0207678_10024974 | 3300026067 | Bacteria | 5219 |
| 487 | Ga0207678_10034392 | 3300026067 | Bacteria | 4414 |
| 488 | Ga0207678_10035096 | 3300026067 | Bacteria | 4367 |
| 489 | Ga0207678_11367442 | 3300026067 | Bacteria | 626 |
| 490 | Ga0207708_10194787 | 3300026075 | Bacteria | 1615 |
| 491 | Ga0207708_10296003 | 3300026075 | Bacteria | 1315 |
| 492 | Ga0207702_10134036 | 3300026078 | Bacteria | 2233 |
| 493 | Ga0207641_10013404 | 3300026088 | Bacteria | 6721 |
| 494 | Ga0207641_10124651 | 3300026088 | Bacteria | 2305 |
| 495 | Ga0207641_10865871 | 3300026088 | Bacteria | 896 |
| 496 | Ga0207641_11315153 | 3300026088 | Unclassified | 723 |
| 497 | Ga0207641_11671590 | 3300026088 | Bacteria | 639 |
| 498 | Ga0207648_10090007 | 3300026089 | Bacteria | 2681 |
| 499 | Ga0207648_10246217 | 3300026089 | Bacteria | 1593 |
| 500 | Ga0207648_10432290 | 3300026089 | Bacteria | 1197 |
| 501 | Ga0207676_10042485 | 3300026095 | Bacteria | 3497 |
| 502 | Ga0207676_10064325 | 3300026095 | Bacteria | 2916 |
| 503 | Ga0207676_10083304 | 3300026095 | Bacteria | 2604 |
| 504 | Ga0207674_10001762 | 3300026116 | Bacteria | 27674 |
| 505 | Ga0207674_10148315 | 3300026116 | Bacteria | 2303 |
| 506 | Ga0207674_10293334 | 3300026116 | Bacteria | 1575 |
| 507 | Ga0207675_100181619 | 3300026118 | Bacteria | 2015 |
| 508 | Ga0207675_100966369 | 3300026118 | Bacteria | 869 |
| 509 | Ga0207683_10000069 | 3300026121 | Bacteria | 78741 |
| 510 | Ga0207683_10001587 | 3300026121 | Bacteria | 20510 |
| 511 | Ga0207683_10161969 | 3300026121 | Bacteria | 2023 |
| 512 | Ga0207698_10211693 | 3300026142 | Bacteria | 1745 |
| 513 | Ga0207698_10212792 | 3300026142 | Bacteria | 1740 |
| 514 | Ga0207698_10515015 | 3300026142 | Bacteria | 1166 |
| 515 | Ga0207698_10820285 | 3300026142 | Bacteria | 934 |
| 516 | Ga0207698_11609613 | 3300026142 | Bacteria | 665 |
| 517 | Ga0210000_1068497 | 3300027462 | Unclassified | 578 |
| 518 | Ga0209968_1049546 | 3300027526 | Bacteria | 728 |
| 519 | Ga0210002_1002533 | 3300027617 | Bacteria | 2642 |
| 520 | Ga0209998_10000492 | 3300027717 | Bacteria | 10876 |
| 521 | Ga0209974_10013544 | 3300027876 | Bacteria | 2716 |
| 522 | Ga0209974_10016533 | 3300027876 | Bacteria | 2450 |
| 523 | Ga0207428_10000987 | 3300027907 | Bacteria | 31506 |
| 524 | Ga0207428_10041754 | 3300027907 | Bacteria | 3712 |
| 525 | Ga0207428_10146905 | 3300027907 | Bacteria | 1796 |
| 526 | Ga0268266_10016263 | 3300028379 | Bacteria | 6358 |
| 527 | Ga0268265_10058799 | 3300028380 | Bacteria | 2937 |
| 528 | Ga0268265_11180630 | 3300028380 | Bacteria | 762 |
| 529 | Ga0268264_10105628 | 3300028381 | Bacteria | 2457 |
| 530 | Ga0268264_10495460 | 3300028381 | Bacteria | 1191 |
| 531 | Ga0265338_10018308 | 3300028800 | Bacteria | 7503 |
| 532 | Ga0265338_10116264 | 3300028800 | Bacteria | 2143 |
| 533 | Ga0265338_10220772 | 3300028800 | Bacteria | 1416 |
| 534 | Ga0265330_10002724 | 3300031235 | Bacteria | 9531 |
| 535 | Ga0265332_10035583 | 3300031238 | Bacteria | 2162 |
| 536 | Ga0265332_10056639 | 3300031238 | Bacteria | 1680 |
| 537 | Ga0265332_10360111 | 3300031238 | Unclassified | 600 |
| 538 | Ga0265325_10034748 | 3300031241 | Bacteria | 2680 |
| 539 | Ga0265325_10052210 | 3300031241 | Bacteria | 2099 |
| 540 | Ga0265325_10135664 | 3300031241 | Bacteria | 1174 |
| 541 | Ga0265325_10216973 | 3300031241 | Bacteria | 877 |
| 542 | Ga0265340_10025044 | 3300031247 | Bacteria | 3025 |
| 543 | Ga0265340_10119635 | 3300031247 | Bacteria | 1212 |
| 544 | Ga0265340_10482528 | 3300031247 | Bacteria | 546 |
| 545 | Ga0265339_10013022 | 3300031249 | Bacteria | 5056 |
| 546 | Ga0265339_10097306 | 3300031249 | Bacteria | 1535 |
| 547 | Ga0265339_10318729 | 3300031249 | Bacteria | 738 |
| 548 | Ga0265331_10034942 | 3300031250 | Bacteria | 2476 |
| 549 | Ga0265316_10314627 | 3300031344 | Bacteria | 1138 |
| 550 | Ga0265316_10640424 | 3300031344 | Bacteria | 752 |
| 551 | Ga0307408_100160592 | 3300031548 | Bacteria | 1785 |
| 552 | Ga0307408_102241823 | 3300031548 | Bacteria | 528 |
| 553 | Ga0265313_10010158 | 3300031595 | Bacteria | 6007 |
| 554 | Ga0265313_10107772 | 3300031595 | Bacteria | 1228 |
| 555 | Ga0265313_10127542 | 3300031595 | Bacteria | 1105 |
| 556 | Ga0316579_10107784 | 3300031691 | Bacteria | 1336 |
| 557 | Ga0265314_10007553 | 3300031711 | Bacteria | 9420 |
| 558 | Ga0265342_10002003 | 3300031712 | Bacteria | 18142 |
| 559 | Ga0316578_10324386 | 3300031728 | Bacteria | 919 |
| 560 | Ga0307406_10638637 | 3300031901 | Bacteria | 882 |
| 561 | Ga0307409_102767534 | 3300031995 | Bacteria | 518 |
| 562 | Ga0307416_101958657 | 3300032002 | Bacteria | 689 |
| 563 | Ga0307415_101989201 | 3300032126 | Bacteria | 566 |
| 564 | Ga0373930_0005010 | 3300034816 | Bacteria | 2182 |
| 565 | Ga0373930_0008947 | 3300034816 | Bacteria | 1762 |
| 566 | Ga0373930_0018724 | 3300034816 | Bacteria | 1335 |
| 567 | Ga0373948_0002605 | 3300034817 | Bacteria | 2684 |
| 568 | Ga0373948_0051812 | 3300034817 | Bacteria | 884 |
| 569 | Ga0373950_0002519 | 3300034818 | Bacteria | 2526 |
| 570 | Ga0373958_0008133 | 3300034819 | Bacteria | 1691 |
| 571 | Ga0373959_0008341 | 3300034820 | Bacteria | 1761 |
| 572 | Ga0373959_0118661 | 3300034820 | Bacteria | 645 |
| 573 | Ga0373938_0000058 | 3300034957 | Bacteria | 14244 |
| 574 | Ga0373926_0000688 | 3300035083 | Bacteria | 9315 |
| 575 | Ga0373928_0000183 | 3300035084 | Bacteria | 12018 |
| 576 | Ga0373928_0005826 | 3300035084 | Bacteria | 2356 |
| 577 | Ga0373929_0000526 | 3300035085 | Bacteria | 7371 |
| 578 | Ga0373934_0267719 | 3300035086 | Unclassified | 707 |
| 579 | Ga0373940_0000164 | 3300035088 | Bacteria | 8813 |
| 580 | Ga0373940_0016371 | 3300035088 | Bacteria | 1836 |
| 581 | Ga0373940_0204597 | 3300035088 | Bacteria | 650 |
| 582 | Ga0373944_0006754 | 3300035089 | Bacteria | 3054 |
| 583 | Ga0373949_0002161 | 3300035090 | Bacteria | 5152 |
| 584 | Ga0373949_0006499 | 3300035090 | Bacteria | 2570 |
| 585 | Ga0373951_0000370 | 3300035091 | Bacteria | 13559 |
| 586 | Ga0373951_0007650 | 3300035091 | Bacteria | 2453 |
| 587 | Ga0373951_0013394 | 3300035091 | Bacteria | 1844 |
| 588 | Ga0373952_0000467 | 3300035092 | Bacteria | 7046 |
| 589 | Ga0373952_0063454 | 3300035092 | Bacteria | 909 |
| 590 | Ga0373923_0000524 | 3300035111 | Bacteria | 9311 |
| 591 | Ga0373932_0000811 | 3300035112 | Bacteria | 9244 |
| 592 | Ga0373932_0005150 | 3300035112 | Bacteria | 3072 |
| 593 | Ga0373936_0000524 | 3300035113 | Bacteria | 13102 |
| 594 | Ga0373939_0002469 | 3300035114 | Bacteria | 4361 |
| 595 | Ga0373941_0000450 | 3300035115 | Bacteria | 8192 |
| 596 | Ga0373945_0001431 | 3300035116 | Bacteria | 7266 |
| 597 | Ga0373953_0225502 | 3300035117 | Unclassified | 812 |
| 598 | Ga0373954_0003182 | 3300035118 | Bacteria | 6940 |
| 599 | Ga0373956_0134067 | 3300035119 | Unclassified | 1161 |
| 600 | Ga0373960_0001125 | 3300035121 | Bacteria | 5777 |
| 601 | Ga0373960_0001389 | 3300035121 | Bacteria | 5352 |
| 602 | Ga0373943_0013004 | 3300035170 | Bacteria | 3754 |
| 603 | Ga0373946_0002069 | 3300035171 | Bacteria | 7042 |
| 604 | Ga0373955_0003523 | 3300035172 | Bacteria | 6886 |
| 605 | Ga0373942_0000555 | 3300035207 | Bacteria | 10498 |
| 606 | Ga0373961_0000817 | 3300035241 | Bacteria | 10586 |
| 607 | Ga0373962_0000563 | 3300035242 | Bacteria | 8378 |
| 608 | Ga0373962_0000865 | 3300035242 | Bacteria | 6903 |
| 609 | Ga0373924_0017036 | 3300035410 | Bacteria | 2782 |
| 610 | Ga0373931_0013723 | 3300035691 | Bacteria | 3950 |
| 611 | Ga0373931_0015869 | 3300035691 | Bacteria | 3699 |
| 612 | Ga0373931_0022095 | 3300035691 | Bacteria | 3198 |
| 613 | Ga0373935_0019128 | 3300035692 | Bacteria | 4176 |
| 614 | Ga0373927_0011605 | 3300035695 | Bacteria | 5867 |
| 615 | Ga0373927_0022146 | 3300035695 | Bacteria | 4164 |
| 616 | Ga0373927_0143975 | 3300035695 | Bacteria | 1560 |
| 617 | Ga0373933_0263497 | 3300035724 | Unclassified | 1111 |
| 618 | Ga0373947_0033285 | 3300035725 | Bacteria | 3041 |
| 619 | Ga0373947_0080266 | 3300035725 | Unclassified | 2018 |
| 620 | Ga0373947_0157689 | 3300035725 | Bacteria | 1466 |
| 621 | Ga0373947_1204959 | 3300035725 | Bacteria | 516 |
| 622 | Ga0373937_0026181 | 3300036401 | Bacteria | 5270 |
| 623 | Ga0373937_0324758 | 3300036401 | Bacteria | 1456 |
| 624 | Ga0373937_1341742 | 3300036401 | Bacteria | 663 |
| 625 | Ga0373925_0005122 | 3300037068 | Bacteria | 9818 |
| 626 | Ga0373925_0025378 | 3300037068 | Bacteria | 4329 |
| 627 | Ga0373925_0234195 | 3300037068 | Unclassified | 1469 |
| 628 | Ga0242420_012832 | 3300038996 | Bacteria | 1422 |
| 629 | Ga0436361_0576226 | 3300039447 | Bacteria | 2180 |
| 630 | Ga0436362_0119038 | 3300039453 | Bacteria | 2265 |
| 631 | Ga0451839_1639025 | 3300041496 | Unclassified | 665 |
| 632 | Ga0439448_0158406 | 3300042005 | Bacteria | 787 |
| 633 | Ga0439459_0031236 | 3300042438 | Bacteria | 1085 |
| 634 | Ga0439464_0036987 | 3300042439 | Bacteria | 1383 |
| 635 | Ga0451577_0012196 | 3300042876 | Bacteria | 8082 |
| 636 | Ga0451576_0054208 | 3300045051 | Bacteria | 4199 |
| 637 | Ga0495617_169873 | 3300046452 | Bacteria | 689 |
| 638 | Ga0495592_0044780 | 3300046454 | Bacteria | 3304 |
| 639 | Ga0495603_0016333 | 3300046455 | Bacteria | 4490 |
| 640 | Ga0495603_0071374 | 3300046455 | Bacteria | 2041 |
| 641 | Ga0495641_0007860 | 3300046461 | Bacteria | 6594 |
| 642 | Ga0495653_0002576 | 3300046463 | Bacteria | 14444 |
| 643 | Ga0495580_0074209 | 3300046472 | Bacteria | 2374 |
| 644 | Ga0495580_0279191 | 3300046472 | Bacteria | 1140 |
| 645 | Ga0495582_0001169 | 3300046473 | Bacteria | 14776 |
| 646 | Ga0495582_0075451 | 3300046473 | Bacteria | 1867 |
| 647 | Ga0495605_0266587 | 3300046474 | Unclassified | 730 |
| 648 | Ga0495639_0054454 | 3300046475 | Bacteria | 1824 |
| 649 | Ga0495639_0067405 | 3300046475 | Bacteria | 1648 |
| 650 | Ga0495639_0436556 | 3300046475 | Bacteria | 664 |
| 651 | Ga0495662_0008406 | 3300046476 | Bacteria | 5076 |
| 652 | Ga0495662_0148487 | 3300046476 | Bacteria | 1154 |
| 653 | Ga0495664_0009618 | 3300046477 | Bacteria | 5411 |
| 654 | Ga0495584_0023810 | 3300046491 | Bacteria | 3104 |
| 655 | Ga0495585_0001628 | 3300046492 | Bacteria | 17232 |
| 656 | Ga0495594_0008935 | 3300046499 | Bacteria | 5167 |
| 657 | Ga0495607_0017460 | 3300046501 | Bacteria | 4606 |
| 658 | Ga0495608_0017314 | 3300046511 | Bacteria | 4986 |
| 659 | Ga0495618_0005710 | 3300046514 | Bacteria | 7563 |
| 660 | Ga0495628_0022497 | 3300046516 | Bacteria | 5178 |
| 661 | Ga0495630_0051023 | 3300046517 | Bacteria | 3095 |
| 662 | Ga0495630_0097476 | 3300046517 | Unclassified | 2224 |
| 663 | Ga0495637_0331149 | 3300046520 | Unclassified | 536 |
| 664 | Ga0495644_0005413 | 3300046523 | Bacteria | 4987 |
| 665 | Ga0495663_0155530 | 3300046525 | Unclassified | 782 |
| 666 | Ga0495663_0326863 | 3300046525 | Bacteria | 556 |
| 667 | Ga0495666_0002279 | 3300046526 | Bacteria | 9550 |
| 668 | Ga0495652_0048315 | 3300046529 | Bacteria | 3646 |
| 669 | Ga0495665_0005343 | 3300046531 | Bacteria | 6922 |
| 670 | Ga0495640_0317433 | 3300046533 | Unclassified | 965 |
| 671 | Ga0495587_0032694 | 3300046536 | Bacteria | 3143 |
| 672 | Ga0495598_0032005 | 3300046537 | Bacteria | 1483 |
| 673 | Ga0495609_0278873 | 3300046538 | Unclassified | 684 |
| 674 | Ga0495645_0226297 | 3300046543 | Unclassified | 1255 |
| 675 | Ga0495622_0005467 | 3300046557 | Bacteria | 5893 |
| 676 | Ga0495633_0001638 | 3300046558 | Bacteria | 16887 |
| 677 | Ga0495667_0002504 | 3300046559 | Bacteria | 12271 |
| 678 | Ga0495656_0000844 | 3300046615 | Bacteria | 9889 |
| 679 | Ga0495611_0015637 | 3300046648 | Bacteria | 3244 |
| 680 | Ga0495635_0007089 | 3300046663 | Bacteria | 7836 |
| 681 | Ga0495659_0000812 | 3300046664 | Bacteria | 11134 |
| 682 | Ga0495588_0000780 | 3300046674 | Bacteria | 14439 |
| 683 | Ga0495588_0274106 | 3300046674 | Unclassified | 889 |
| 684 | Ga0495599_0010706 | 3300046678 | Bacteria | 5617 |
| 685 | Ga0495647_0004832 | 3300046681 | Bacteria | 4402 |
| 686 | Ga0495658_0002231 | 3300046683 | Bacteria | 9794 |
| 687 | Ga0495658_0194311 | 3300046683 | Unclassified | 1263 |
| 688 | Ga0495658_0303100 | 3300046683 | Bacteria | 1011 |
| 689 | Ga0495613_0004955 | 3300046689 | Bacteria | 9998 |
| 690 | Ga0495613_0253132 | 3300046689 | Unclassified | 1229 |
| 691 | Ga0495624_0006812 | 3300046690 | Bacteria | 8067 |
| 692 | Ga0495670_0001934 | 3300046691 | Bacteria | 10210 |
| 693 | Ga0495600_0033824 | 3300046809 | Bacteria | 3318 |
| 694 | Ga0495581_0005546 | 3300047315 | Bacteria | 7310 |
| 695 | Ga0495604_0015259 | 3300047317 | Bacteria | 6133 |
| 696 | Ga0495674_0119959 | 3300047319 | Bacteria | 2222 |
| 697 | Ga0495676_0063761 | 3300047321 | Bacteria | 2870 |
| 698 | Ga0495676_0114885 | 3300047321 | Bacteria | 1969 |
| 699 | Ga0495680_0026301 | 3300047322 | Bacteria | 4800 |
| 700 | Ga0495675_0025080 | 3300047444 | Bacteria | 3803 |
| 701 | Ga0495679_076272 | 3300047446 | Unclassified | 958 |
| 702 | Ga0495685_052209 | 3300047447 | Bacteria | 1385 |
| 703 | Ga0495684_0005442 | 3300047471 | Bacteria | 9907 |
| 704 | Ga0495593_0010044 | 3300047673 | Bacteria | 5482 |
| 705 | Ga0495614_0006166 | 3300048089 | Bacteria | 5387 |
| 706 | Ga0495615_0014445 | 3300048090 | Bacteria | 1669 |
| 707 | Ga0496100_0012687 | 3300048903 | Bacteria | 4839 |
| 708 | Ga0496100_0052321 | 3300048903 | Bacteria | 2654 |
| 709 | Ga0496100_0395016 | 3300048903 | Bacteria | 1052 |
| 710 | Ga0496100_1122334 | 3300048903 | Unclassified | 620 |
| 711 | Ga0496101_0873105 | 3300048904 | Bacteria | 708 |
| 712 | Ga0496101_0946955 | 3300048904 | Bacteria | 677 |
| 713 | Ga0496102_0033003 | 3300048905 | Bacteria | 4651 |
| 714 | Ga0496102_0113055 | 3300048905 | Bacteria | 2533 |
| 715 | Ga0496102_0389225 | 3300048905 | Bacteria | 1311 |
| 716 | Ga0496103_0050447 | 3300048906 | Bacteria | 2574 |
| 717 | Ga0496103_0145462 | 3300048906 | Bacteria | 1517 |
| 718 | Ga0496103_0301813 | 3300048906 | Bacteria | 1030 |
| 719 | Ga0496104_0064827 | 3300048907 | Bacteria | 3465 |
| 720 | Ga0496104_0195722 | 3300048907 | Bacteria | 1933 |
| 721 | Ga0496104_0294781 | 3300048907 | Bacteria | 1534 |
| 722 | Ga0496104_0406679 | 3300048907 | Bacteria | 1273 |
| 723 | Ga0496105_0111266 | 3300048908 | Bacteria | 2260 |
| 724 | Ga0496105_0120380 | 3300048908 | Bacteria | 2165 |
| 725 | Ga0496105_0317621 | 3300048908 | Bacteria | 1249 |
| 726 | Ga0496105_0466156 | 3300048908 | Bacteria | 995 |
| 727 | Ga0496106_0041267 | 3300048909 | Bacteria | 3457 |
| 728 | Ga0496106_0057963 | 3300048909 | Bacteria | 2930 |
| 729 | Ga0496106_0123244 | 3300048909 | Bacteria | 2028 |
| 730 | Ga0496106_0152321 | 3300048909 | Bacteria | 1824 |
| 731 | Ga0496107_0045547 | 3300048910 | Bacteria | 3155 |
| 732 | Ga0496107_0082706 | 3300048910 | Bacteria | 2341 |
| 733 | Ga0496107_0089779 | 3300048910 | Bacteria | 2244 |
| 734 | Ga0496108_0034538 | 3300048911 | Bacteria | 4202 |
| 735 | Ga0496108_0050233 | 3300048911 | Bacteria | 3490 |
| 736 | Ga0496108_0065764 | 3300048911 | Bacteria | 3056 |
| 737 | Ga0496108_0074924 | 3300048911 | Bacteria | 2858 |
| 738 | Ga0496108_0242923 | 3300048911 | Bacteria | 1566 |
| 739 | Ga0496109_0002090 | 3300048912 | Bacteria | 16590 |
| 740 | Ga0496109_0002254 | 3300048912 | Bacteria | 16021 |
| 741 | Ga0496109_0102967 | 3300048912 | Bacteria | 2649 |
| 742 | Ga0496109_0117084 | 3300048912 | Bacteria | 2480 |
| 743 | Ga0496109_0475035 | 3300048912 | Bacteria | 1180 |
| 744 | Ga0496109_0642980 | 3300048912 | Bacteria | 998 |
| 745 | Ga0496109_0918091 | 3300048912 | Bacteria | 813 |
| 746 | Ga0496110_0115364 | 3300048913 | Bacteria | 2417 |
| 747 | Ga0496110_1805656 | 3300048913 | Unclassified | 522 |
| 748 | Ga0496111_0025885 | 3300048914 | Bacteria | 4139 |
| 749 | Ga0496111_0029383 | 3300048914 | Bacteria | 3904 |
| 750 | Ga0496111_0224739 | 3300048914 | Bacteria | 1395 |
| 751 | Ga0496111_0465298 | 3300048914 | Bacteria | 932 |
| 752 | Ga0496111_0643964 | 3300048914 | Bacteria | 774 |
| 753 | Ga0496112_0056447 | 3300048915 | Bacteria | 3864 |
| 754 | Ga0496112_0066287 | 3300048915 | Bacteria | 3562 |
| 755 | Ga0496112_0072914 | 3300048915 | Bacteria | 3394 |
| 756 | Ga0496113_0014345 | 3300048916 | Bacteria | 5404 |
| 757 | Ga0496113_0266593 | 3300048916 | Bacteria | 1368 |
| 758 | Ga0496113_0361553 | 3300048916 | Bacteria | 1164 |
| 759 | Ga0496113_0368712 | 3300048916 | Bacteria | 1152 |
| 760 | Ga0496114_0016534 | 3300048917 | Bacteria | 5946 |
| 761 | Ga0496115_0021801 | 3300048918 | Bacteria | 4952 |
| 762 | Ga0496115_0042365 | 3300048918 | Bacteria | 3626 |
| 763 | Ga0496115_0263393 | 3300048918 | Bacteria | 1417 |
| 764 | Ga0496126_0550261 | 3300048929 | Bacteria | 916 |
| 765 | Ga0501031_0351166 | 3300049568 | Bacteria | 955 |
| 766 | Ga0501032_0126349 | 3300049569 | Bacteria | 1689 |
| 767 | Ga0501032_0360168 | 3300049569 | Bacteria | 936 |
| 768 | Ga0501033_0067965 | 3300049570 | Bacteria | 2621 |
| 769 | Ga0501033_0208255 | 3300049570 | Bacteria | 1395 |
| 770 | Ga0501033_0637071 | 3300049570 | Bacteria | 729 |
| 771 | Ga0501034_0153702 | 3300049571 | Bacteria | 2276 |
| 772 | Ga0501034_0409780 | 3300049571 | Bacteria | 1277 |
| 773 | Ga0501036_0297324 | 3300049572 | Bacteria | 1350 |
| 774 | Ga0501036_0766291 | 3300049572 | Bacteria | 796 |
| 775 | Ga0501037_0029345 | 3300049573 | Bacteria | 4064 |
| 776 | Ga0501037_0071082 | 3300049573 | Bacteria | 2532 |
| 777 | Ga0501038_0077162 | 3300049574 | Bacteria | 2813 |
| 778 | Ga0501038_0113764 | 3300049574 | Bacteria | 2239 |
| 779 | Ga0501038_0324893 | 3300049574 | Unclassified | 1203 |
| 780 | Ga0501039_0090454 | 3300049575 | Bacteria | 2385 |
| 781 | Ga0501039_0694907 | 3300049575 | Bacteria | 795 |
| 782 | Ga0501046_0189260 | 3300049580 | Bacteria | 1536 |
| 783 | Ga0501046_0456108 | 3300049580 | Bacteria | 919 |
| 784 | Ga0501047_0069693 | 3300049581 | Bacteria | 3386 |
| 785 | Ga0501047_0465796 | 3300049581 | Bacteria | 1092 |
| 786 | Ga0501047_0552002 | 3300049581 | Bacteria | 976 |
| 787 | Ga0501067_0156732 | 3300049583 | Bacteria | 1269 |
| 788 | Ga0501068_0160356 | 3300049584 | Unclassified | 1418 |
| 789 | Ga0501070_0084445 | 3300049586 | Bacteria | 2629 |
| 790 | Ga0501070_0351222 | 3300049586 | Bacteria | 1197 |
| 791 | Ga0501070_1025133 | 3300049586 | Bacteria | 639 |
| 792 | Ga0501072_0323739 | 3300049588 | Unclassified | 1225 |
| 793 | Ga0501073_0046085 | 3300049589 | Bacteria | 3068 |
| 794 | Ga0501073_0089637 | 3300049589 | Bacteria | 2138 |
| 795 | Ga0501074_0083203 | 3300049590 | Bacteria | 2294 |
| 796 | Ga0501074_0101568 | 3300049590 | Bacteria | 2059 |
| 797 | Ga0501076_0057558 | 3300049592 | Bacteria | 3086 |
| 798 | Ga0501076_1109858 | 3300049592 | Bacteria | 651 |
| 799 | Ga0501079_0221647 | 3300049741 | Bacteria | 1478 |
| 800 | Ga0501079_0300372 | 3300049741 | Bacteria | 1256 |
| 801 | Ga0501079_0336165 | 3300049741 | Bacteria | 1183 |
| 802 | Ga0501080_0058679 | 3300049742 | Bacteria | 3582 |
| 803 | Ga0501080_0102707 | 3300049742 | Bacteria | 2652 |
| 804 | Ga0501080_0584641 | 3300049742 | Bacteria | 992 |
| 805 | Ga0501083_0078655 | 3300049744 | Bacteria | 2187 |
| 806 | Ga0501083_0079439 | 3300049744 | Bacteria | 2175 |
| 807 | Ga0501035_0443804 | 3300049822 | Bacteria | 1074 |
| 808 | Ga0501044_0089132 | 3300049823 | Bacteria | 3114 |
| 809 | Ga0501044_0093101 | 3300049823 | Bacteria | 3039 |
| 810 | Ga0501044_0191241 | 3300049823 | Bacteria | 2009 |
| 811 | Ga0501045_0922181 | 3300049824 | Bacteria | 641 |
| 812 | nmdc:mga03n38_208105_c1 | 3300050490 | Bacteria | 1015 |
| 813 | nmdc:mga0yw44_1092226_c1 | 3300050492 | Unclassified | 539 |
| 814 | nmdc:mga0k408_602040_c1 | 3300050493 | Bacteria | 648 |
| 815 | nmdc:mga06z11_383952_c1 | 3300050494 | Bacteria | 844 |
| 816 | nmdc:mga05p37_133968_c1 | 3300050507 | Bacteria | 3040 |
| 817 | nmdc:mga0qj67_84092_c1 | 3300050509 | Bacteria | 2551 |
| 818 | nmdc:mga06r32_181227_c1 | 3300050510 | Bacteria | 2092 |
| 819 | nmdc:mga06r32_318718_c1 | 3300050510 | Bacteria | 1540 |
| 820 | nmdc:mga08y16_10396_c1 | 3300050511 | Bacteria | 9764 |
| 821 | nmdc:mga08y16_113532_c1 | 3300050511 | Bacteria | 2820 |
| 822 | nmdc:mga08y16_395940_c1 | 3300050511 | Bacteria | 1414 |
| 823 | nmdc:mga08y16_60189_c1 | 3300050511 | Bacteria | 3967 |
| 824 | nmdc:mga0n895_118965_c1 | 3300050512 | Bacteria | 2663 |
| 825 | nmdc:mga0n895_191724_c1 | 3300050512 | Bacteria | 2075 |
| 826 | nmdc:mga0n895_45193_c1 | 3300050512 | Bacteria | 4297 |
| 827 | nmdc:mga0n895_459471_c1 | 3300050512 | Bacteria | 1285 |
| 828 | nmdc:mga0n895_588412_c1 | 3300050512 | Bacteria | 1116 |
| 829 | nmdc:mga0rr50_170766_c1 | 3300050513 | Bacteria | 1772 |
| 830 | nmdc:mga0rr50_41470_c1 | 3300050513 | Bacteria | 3355 |
| 831 | nmdc:mga08x19_36813_c1 | 3300050514 | Bacteria | 3101 |
| 832 | nmdc:mga08x19_44829_c1 | 3300050514 | Bacteria | 2824 |
| 833 | Ga0495601_0007242 | 3300053077 | Bacteria | 6507 |
| 834 | Ga0495612_0001030 | 3300053078 | Bacteria | 11436 |
| 835 | Ga0495595_0004950 | 3300053084 | Bacteria | 5370 |
| 836 | Ga0495619_0070742 | 3300053085 | Bacteria | 2333 |
| 837 | Ga0500644_0002792 | 3300053088 | Bacteria | 4344 |
| 838 | Ga0500651_0135371 | 3300053093 | Bacteria | 1488 |
| 839 | Ga0500566_0267021 | 3300053094 | Unclassified | 823 |
| 840 | Ga0500650_0203447 | 3300053098 | Bacteria | 901 |
| 841 | Ga0500652_006245 | 3300053131 | Bacteria | 3823 |
| 842 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 843 | Ga0500645_000050 | 3300053730 | Bacteria | 99596 |
| 844 | Ga0501084_0141228 | 3300054114 | Bacteria | 2028 |
| 845 | Ga0501084_0260907 | 3300054114 | Bacteria | 1463 |
| 846 | Ga0501084_1399634 | 3300054114 | Unclassified | 586 |
| 847 | Ga0501084_1746792 | 3300054114 | Bacteria | 520 |
| 848 | Ga0590071_085057 | 3300059421 | Bacteria | 789 |
| 849 | Ga0501082_0436110 | 3300060353 | Bacteria | 1144 |
| 850 | Ga0530510_0484222 | 3300061734 | Bacteria | 937 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035121 | Ga0373960_0001125 | Ga0373960_0001125_19_432 | 137 |
| 2 | 3300046455 | Ga0495603_0071374 | Ga0495603_0071374_19_432 | 137 |
| 3 | 3300050511 | nmdc:mga08y16_395940_c1 | nmdc:mga08y16_395940_c1_28_441 | 137 |
| 4 | 3300046473 | Ga0495582_0075451 | Ga0495582_0075451_17_433 | 138 |
| 5 | 3300046475 | Ga0495639_0067405 | Ga0495639_0067405_17_433 | 138 |
| 6 | 3300046476 | Ga0495662_0148487 | Ga0495662_0148487_25_441 | 138 |
| 7 | 3300053094 | Ga0500566_0267021 | Ga0500566_0267021_15_431 | 138 |
| 8 | iso_pu_bacteria | 2513237087 | 2513591476 | 144 |
| 9 | 3300013104 | Ga0157370_10491474 | Ga0157370_104914741 | 145 |
| 10 | 3300061734 | Ga0530510_0484222 | Ga0530510_0484222_224_661 | 145 |
| 11 | 3300031241 | Ga0265325_10052210 | Ga0265325_100522102 | 147 |
| 12 | 3300031247 | Ga0265340_10482528 | Ga0265340_104825281 | 147 |
| 13 | 3300031249 | Ga0265339_10013022 | Ga0265339_100130222 | 147 |
| 14 | 3300031344 | Ga0265316_10640424 | Ga0265316_106404242 | 147 |
| 15 | 3300035695 | Ga0373927_0022146 | Ga0373927_0022146_267_710 | 147 |
| 16 | 3300035725 | Ga0373947_0080266 | Ga0373947_0080266_141_584 | 147 |
| 17 | 3300037068 | Ga0373925_0025378 | Ga0373925_0025378_635_1078 | 147 |
| 18 | 3300046472 | Ga0495580_0279191 | Ga0495580_0279191_13_456 | 147 |
| 19 | 3300046475 | Ga0495639_0436556 | Ga0495639_0436556_41_484 | 147 |
| 20 | 3300046517 | Ga0495630_0097476 | Ga0495630_0097476_800_1243 | 147 |
| 21 | 3300046683 | Ga0495658_0194311 | Ga0495658_0194311_484_927 | 147 |
| 22 | 3300046689 | Ga0495613_0253132 | Ga0495613_0253132_264_707 | 147 |
| 23 | 3300005290 | Ga0065712_10362046 | Ga0065712_103620461 | 148 |
| 24 | 3300005328 | Ga0070676_10523261 | Ga0070676_105232611 | 148 |
| 25 | 3300005335 | Ga0070666_10914347 | Ga0070666_109143471 | 148 |
| 26 | 3300005343 | Ga0070687_100177140 | Ga0070687_1001771402 | 148 |
| 27 | 3300005343 | Ga0070687_101035558 | Ga0070687_1010355581 | 148 |
| 28 | 3300005353 | Ga0070669_100848098 | Ga0070669_1008480982 | 148 |
| 29 | 3300005355 | Ga0070671_100073817 | Ga0070671_1000738171 | 148 |
| 30 | 3300005364 | Ga0070673_100098213 | Ga0070673_1000982131 | 148 |
| 31 | 3300005364 | Ga0070673_100837112 | Ga0070673_1008371121 | 148 |
| 32 | 3300005367 | Ga0070667_101171335 | Ga0070667_1011713352 | 148 |
| 33 | 3300005436 | Ga0070713_100268406 | Ga0070713_1002684061 | 148 |
| 34 | 3300005466 | Ga0070685_10050286 | Ga0070685_100502863 | 148 |
| 35 | 3300005544 | Ga0070686_100454436 | Ga0070686_1004544361 | 148 |
| 36 | 3300005544 | Ga0070686_100742351 | Ga0070686_1007423511 | 148 |
| 37 | 3300005577 | Ga0068857_100126454 | Ga0068857_1001264543 | 148 |
| 38 | 3300005617 | Ga0068859_100093053 | Ga0068859_1000930533 | 148 |
| 39 | 3300005841 | Ga0068863_100252417 | Ga0068863_1002524172 | 148 |
| 40 | 3300005843 | Ga0068860_100629226 | Ga0068860_1006292262 | 148 |
| 41 | 3300005844 | Ga0068862_100917966 | Ga0068862_1009179662 | 148 |
| 42 | 3300005937 | Ga0081455_10209824 | Ga0081455_102098242 | 148 |
| 43 | 3300005981 | Ga0081538_10047724 | Ga0081538_100477242 | 148 |
| 44 | 3300005985 | Ga0081539_10034315 | Ga0081539_100343152 | 148 |
| 45 | 3300006048 | Ga0075363_100583256 | Ga0075363_1005832561 | 148 |
| 46 | 3300006058 | Ga0075432_10160795 | Ga0075432_101607952 | 148 |
| 47 | 3300006178 | Ga0075367_10164761 | Ga0075367_101647612 | 148 |
| 48 | 3300006195 | Ga0075366_10664020 | Ga0075366_106640202 | 148 |
| 49 | 3300006844 | Ga0075428_100075386 | Ga0075428_1000753866 | 148 |
| 50 | 3300006846 | Ga0075430_100137691 | Ga0075430_1001376912 | 148 |
| 51 | 3300006847 | Ga0075431_100509572 | Ga0075431_1005095722 | 148 |
| 52 | 3300006847 | Ga0075431_100610157 | Ga0075431_1006101572 | 148 |
| 53 | 3300006871 | Ga0075434_100162917 | Ga0075434_1001629174 | 148 |
| 54 | 3300006880 | Ga0075429_100476984 | Ga0075429_1004769841 | 148 |
| 55 | 3300006880 | Ga0075429_101298219 | Ga0075429_1012982192 | 148 |
| 56 | 3300006931 | Ga0097620_100093045 | Ga0097620_1000930453 | 148 |
| 57 | 3300009094 | Ga0111539_10015411 | Ga0111539_100154112 | 148 |
| 58 | 3300009098 | Ga0105245_12115198 | Ga0105245_121151981 | 148 |
| 59 | 3300009148 | Ga0105243_11238678 | Ga0105243_112386782 | 148 |
| 60 | 3300009177 | Ga0105248_10916262 | Ga0105248_109162622 | 148 |
| 61 | 3300009553 | Ga0105249_10919413 | Ga0105249_109194131 | 148 |
| 62 | 3300013296 | Ga0157374_12792937 | Ga0157374_127929371 | 148 |
| 63 | 3300013308 | Ga0157375_10846755 | Ga0157375_108467551 | 148 |
| 64 | 3300014325 | Ga0163163_10109870 | Ga0163163_101098702 | 148 |
| 65 | 3300014326 | Ga0157380_12570285 | Ga0157380_125702851 | 148 |
| 66 | 3300025901 | Ga0207688_10051981 | Ga0207688_100519812 | 148 |
| 67 | 3300025908 | Ga0207643_10092580 | Ga0207643_100925801 | 148 |
| 68 | 3300025924 | Ga0207694_10421731 | Ga0207694_104217312 | 148 |
| 69 | 3300025925 | Ga0207650_10128693 | Ga0207650_101286932 | 148 |
| 70 | 3300025925 | Ga0207650_11253838 | Ga0207650_112538381 | 148 |
| 71 | 3300025928 | Ga0207700_10523543 | Ga0207700_105235432 | 148 |
| 72 | 3300025931 | Ga0207644_10075013 | Ga0207644_100750133 | 148 |
| 73 | 3300025935 | Ga0207709_10376686 | Ga0207709_103766862 | 148 |
| 74 | 3300025939 | Ga0207665_11136284 | Ga0207665_111362841 | 148 |
| 75 | 3300025940 | Ga0207691_10138288 | Ga0207691_101382883 | 148 |
| 76 | 3300025941 | Ga0207711_10556309 | Ga0207711_105563092 | 148 |
| 77 | 3300025942 | Ga0207689_10531413 | Ga0207689_105314132 | 148 |
| 78 | 3300025961 | Ga0207712_10733033 | Ga0207712_107330332 | 148 |
| 79 | 3300026035 | Ga0207703_10345530 | Ga0207703_103455302 | 148 |
| 80 | 3300026088 | Ga0207641_10124651 | Ga0207641_101246512 | 148 |
| 81 | 3300026088 | Ga0207641_11671590 | Ga0207641_116715902 | 148 |
| 82 | 3300026089 | Ga0207648_10432290 | Ga0207648_104322902 | 148 |
| 83 | 3300026095 | Ga0207676_10042485 | Ga0207676_100424854 | 148 |
| 84 | 3300026118 | Ga0207675_100966369 | Ga0207675_1009663692 | 148 |
| 85 | 3300027907 | Ga0207428_10041754 | Ga0207428_100417542 | 148 |
| 86 | 3300028380 | Ga0268265_11180630 | Ga0268265_111806301 | 148 |
| 87 | 3300028381 | Ga0268264_10495460 | Ga0268264_104954602 | 148 |
| 88 | 3300031548 | Ga0307408_100160592 | Ga0307408_1001605921 | 148 |
| 89 | 3300031548 | Ga0307408_102241823 | Ga0307408_1022418231 | 148 |
| 90 | 3300031595 | Ga0265313_10107772 | Ga0265313_101077722 | 148 |
| 91 | 3300031901 | Ga0307406_10638637 | Ga0307406_106386372 | 148 |
| 92 | 3300031995 | Ga0307409_102767534 | Ga0307409_1027675341 | 148 |
| 93 | 3300032002 | Ga0307416_101958657 | Ga0307416_1019586572 | 148 |
| 94 | 3300032126 | Ga0307415_101989201 | Ga0307415_1019892011 | 148 |
| 95 | 3300035725 | Ga0373947_1204959 | Ga0373947_1204959_58_504 | 148 |
| 96 | 3300036401 | Ga0373937_1341742 | Ga0373937_1341742_59_505 | 148 |
| 97 | 3300039453 | Ga0436362_0119038 | Ga0436362_0119038_1115_1561 | 148 |
| 98 | 3300042438 | Ga0439459_0031236 | Ga0439459_0031236_83_529 | 148 |
| 99 | 3300046525 | Ga0495663_0326863 | Ga0495663_0326863_61_507 | 148 |
| 100 | 3300046683 | Ga0495658_0303100 | Ga0495658_0303100_349_822 | 148 |
| 101 | 3300047447 | Ga0495685_052209 | Ga0495685_052209_11_457 | 148 |
| 102 | 3300048090 | Ga0495615_0014445 | Ga0495615_0014445_147_593 | 148 |
| 103 | 3300048903 | Ga0496100_0052321 | Ga0496100_0052321_762_1208 | 148 |
| 104 | 3300048903 | Ga0496100_0395016 | Ga0496100_0395016_103_549 | 148 |
| 105 | 3300048905 | Ga0496102_0033003 | Ga0496102_0033003_242_688 | 148 |
| 106 | 3300048906 | Ga0496103_0301813 | Ga0496103_0301813_35_481 | 148 |
| 107 | 3300048907 | Ga0496104_0064827 | Ga0496104_0064827_547_993 | 148 |
| 108 | 3300048907 | Ga0496104_0406679 | Ga0496104_0406679_296_742 | 148 |
| 109 | 3300048908 | Ga0496105_0120380 | Ga0496105_0120380_1514_1960 | 148 |
| 110 | 3300048909 | Ga0496106_0057963 | Ga0496106_0057963_793_1239 | 148 |
| 111 | 3300048911 | Ga0496108_0034538 | Ga0496108_0034538_2104_2550 | 148 |
| 112 | 3300048912 | Ga0496109_0642980 | Ga0496109_0642980_35_481 | 148 |
| 113 | 3300048912 | Ga0496109_0918091 | Ga0496109_0918091_62_508 | 148 |
| 114 | 3300048913 | Ga0496110_0115364 | Ga0496110_0115364_1688_2134 | 148 |
| 115 | 3300048914 | Ga0496111_0643964 | Ga0496111_0643964_195_641 | 148 |
| 116 | 3300048915 | Ga0496112_0056447 | Ga0496112_0056447_142_588 | 148 |
| 117 | 3300048915 | Ga0496112_0072914 | Ga0496112_0072914_2042_2488 | 148 |
| 118 | 3300048916 | Ga0496113_0266593 | Ga0496113_0266593_849_1295 | 148 |
| 119 | 3300049568 | Ga0501031_0351166 | Ga0501031_0351166_314_844 | 148 |
| 120 | 3300049569 | Ga0501032_0126349 | Ga0501032_0126349_994_1524 | 148 |
| 121 | 3300049570 | Ga0501033_0067965 | Ga0501033_0067965_871_1401 | 148 |
| 122 | 3300049571 | Ga0501034_0409780 | Ga0501034_0409780_731_1261 | 148 |
| 123 | 3300049572 | Ga0501036_0297324 | Ga0501036_0297324_760_1290 | 148 |
| 124 | 3300049572 | Ga0501036_0766291 | Ga0501036_0766291_269_715 | 148 |
| 125 | 3300049573 | Ga0501037_0071082 | Ga0501037_0071082_213_743 | 148 |
| 126 | 3300049574 | Ga0501038_0077162 | Ga0501038_0077162_881_1411 | 148 |
| 127 | 3300049575 | Ga0501039_0090454 | Ga0501039_0090454_1177_1707 | 148 |
| 128 | 3300049580 | Ga0501046_0189260 | Ga0501046_0189260_943_1473 | 148 |
| 129 | 3300049589 | Ga0501073_0089637 | Ga0501073_0089637_941_1414 | 148 |
| 130 | 3300049742 | Ga0501080_0102707 | Ga0501080_0102707_186_659 | 148 |
| 131 | 3300049742 | Ga0501080_0584641 | Ga0501080_0584641_57_587 | 148 |
| 132 | 3300049744 | Ga0501083_0078655 | Ga0501083_0078655_1080_1610 | 148 |
| 133 | 3300049822 | Ga0501035_0443804 | Ga0501035_0443804_73_603 | 148 |
| 134 | 3300049823 | Ga0501044_0191241 | Ga0501044_0191241_278_808 | 148 |
| 135 | 3300049824 | Ga0501045_0922181 | Ga0501045_0922181_183_629 | 148 |
| 136 | 3300050493 | nmdc:mga0k408_602040_c1 | nmdc:mga0k408_602040_c1_33_479 | 148 |
| 137 | 3300050494 | nmdc:mga06z11_383952_c1 | nmdc:mga06z11_383952_c1_375_824 | 148 |
| 138 | 3300050509 | nmdc:mga0qj67_84092_c1 | nmdc:mga0qj67_84092_c1_558_1004 | 148 |
| 139 | 3300050510 | nmdc:mga06r32_181227_c1 | nmdc:mga06r32_181227_c1_639_1085 | 148 |
| 140 | 3300050510 | nmdc:mga06r32_318718_c1 | nmdc:mga06r32_318718_c1_881_1327 | 148 |
| 141 | 3300050511 | nmdc:mga08y16_113532_c1 | nmdc:mga08y16_113532_c1_495_941 | 148 |
| 142 | 3300050512 | nmdc:mga0n895_588412_c1 | nmdc:mga0n895_588412_c1_319_765 | 148 |
| 143 | 3300054114 | Ga0501084_1399634 | Ga0501084_1399634_69_515 | 148 |
| 144 | 3300054114 | Ga0501084_1746792 | Ga0501084_1746792_16_462 | 148 |
| 145 | 3300059421 | Ga0590071_085057 | Ga0590071_085057_114_560 | 148 |
| 146 | 3300060353 | Ga0501082_0436110 | Ga0501082_0436110_349_879 | 148 |
| 147 | 2162886007 | SwRhRL2b_contig_1716414 | SwRhRL2b_0331.00000920 | 149 |
| 148 | 2209111006 | 2214739662 | 2213746898 | 149 |
| 149 | 3300000042 | ARSoilYngRDRAFT_c00052 | ARSoilYngRDRAFT_0005215 | 149 |
| 150 | 3300000043 | ARcpr5yngRDRAFT_c000147 | ARcpr5yngRDRAFT_0001472 | 149 |
| 151 | 3300000044 | ARSoilOldRDRAFT_c000002 | ARSoilOldRDRAFT_0000024 | 149 |
| 152 | 3300000045 | ARCol0oldRDRAFT_c00693 | ARCol0oldRDRAFT_006932 | 149 |
| 153 | 3300000652 | ARCol0yngRDRAFT_1000005 | ARCol0yngRDRAFT_100000515 | 149 |
| 154 | 3300001989 | JGI24739J22299_10173016 | JGI24739J22299_101730161 | 149 |
| 155 | 3300001990 | JGI24737J22298_10000816 | JGI24737J22298_100008162 | 149 |
| 156 | 3300001990 | JGI24737J22298_10009462 | JGI24737J22298_100094622 | 149 |
| 157 | 3300002075 | JGI24738J21930_10000057 | JGI24738J21930_100000577 | 149 |
| 158 | 3300002076 | JGI24749J21850_1002009 | JGI24749J21850_10020093 | 149 |
| 159 | 3300002076 | JGI24749J21850_1007925 | JGI24749J21850_10079251 | 149 |
| 160 | 3300002077 | JGI24744J21845_10000508 | JGI24744J21845_100005083 | 149 |
| 161 | 3300002155 | JGI24033J26618_1000475 | JGI24033J26618_10004752 | 149 |
| 162 | 3300002239 | JGI24034J26672_10108639 | JGI24034J26672_101086391 | 149 |
| 163 | 3300005276 | Ga0065717_1004452 | Ga0065717_10044521 | 149 |
| 164 | 3300005277 | Ga0065716_1002247 | Ga0065716_10022472 | 149 |
| 165 | 3300005289 | Ga0065704_10006448 | Ga0065704_100064483 | 149 |
| 166 | 3300005290 | Ga0065712_10004316 | Ga0065712_100043163 | 149 |
| 167 | 3300005290 | Ga0065712_10005073 | Ga0065712_100050732 | 149 |
| 168 | 3300005293 | Ga0065715_10002538 | Ga0065715_1000253813 | 149 |
| 169 | 3300005295 | Ga0065707_10035590 | Ga0065707_100355902 | 149 |
| 170 | 3300005328 | Ga0070676_10003844 | Ga0070676_100038443 | 149 |
| 171 | 3300005329 | Ga0070683_100115014 | Ga0070683_1001150142 | 149 |
| 172 | 3300005329 | Ga0070683_100231273 | Ga0070683_1002312732 | 149 |
| 173 | 3300005329 | Ga0070683_102181136 | Ga0070683_1021811361 | 149 |
| 174 | 3300005330 | Ga0070690_100000189 | Ga0070690_1000001898 | 149 |
| 175 | 3300005330 | Ga0070690_100001958 | Ga0070690_1000019588 | 149 |
| 176 | 3300005330 | Ga0070690_100019725 | Ga0070690_1000197253 | 149 |
| 177 | 3300005331 | Ga0070670_100007955 | Ga0070670_1000079554 | 149 |
| 178 | 3300005331 | Ga0070670_101035706 | Ga0070670_1010357061 | 149 |
| 179 | 3300005333 | Ga0070677_10000347 | Ga0070677_100003474 | 149 |
| 180 | 3300005334 | Ga0068869_100151596 | Ga0068869_1001515962 | 149 |
| 181 | 3300005335 | Ga0070666_10001280 | Ga0070666_1000128011 | 149 |
| 182 | 3300005335 | Ga0070666_10016467 | Ga0070666_100164673 | 149 |
| 183 | 3300005336 | Ga0070680_100003903 | Ga0070680_1000039034 | 149 |
| 184 | 3300005336 | Ga0070680_100011404 | Ga0070680_1000114046 | 149 |
| 185 | 3300005336 | Ga0070680_100013996 | Ga0070680_1000139964 | 149 |
| 186 | 3300005336 | Ga0070680_100255672 | Ga0070680_1002556722 | 149 |
| 187 | 3300005336 | Ga0070680_100999539 | Ga0070680_1009995391 | 149 |
| 188 | 3300005337 | Ga0070682_100006959 | Ga0070682_1000069593 | 149 |
| 189 | 3300005337 | Ga0070682_100027997 | Ga0070682_1000279974 | 149 |
| 190 | 3300005337 | Ga0070682_100076704 | Ga0070682_1000767042 | 149 |
| 191 | 3300005337 | Ga0070682_100398681 | Ga0070682_1003986811 | 149 |
| 192 | 3300005338 | Ga0068868_100002148 | Ga0068868_1000021488 | 149 |
| 193 | 3300005338 | Ga0068868_100016286 | Ga0068868_1000162863 | 149 |
| 194 | 3300005339 | Ga0070660_100001222 | Ga0070660_10000122210 | 149 |
| 195 | 3300005339 | Ga0070660_100039588 | Ga0070660_1000395882 | 149 |
| 196 | 3300005339 | Ga0070660_100094640 | Ga0070660_1000946402 | 149 |
| 197 | 3300005339 | Ga0070660_100136966 | Ga0070660_1001369662 | 149 |
| 198 | 3300005340 | Ga0070689_100000770 | Ga0070689_10000077010 | 149 |
| 199 | 3300005340 | Ga0070689_100151653 | Ga0070689_1001516532 | 149 |
| 200 | 3300005341 | Ga0070691_10088289 | Ga0070691_100882891 | 149 |
| 201 | 3300005344 | Ga0070661_100038917 | Ga0070661_1000389173 | 149 |
| 202 | 3300005344 | Ga0070661_100123073 | Ga0070661_1001230732 | 149 |
| 203 | 3300005344 | Ga0070661_100201492 | Ga0070661_1002014922 | 149 |
| 204 | 3300005345 | Ga0070692_10096422 | Ga0070692_100964222 | 149 |
| 205 | 3300005345 | Ga0070692_10441395 | Ga0070692_104413951 | 149 |
| 206 | 3300005345 | Ga0070692_10554337 | Ga0070692_105543371 | 149 |
| 207 | 3300005347 | Ga0070668_100007912 | Ga0070668_1000079123 | 149 |
| 208 | 3300005347 | Ga0070668_100123434 | Ga0070668_1001234342 | 149 |
| 209 | 3300005353 | Ga0070669_100010601 | Ga0070669_1000106011 | 149 |
| 210 | 3300005353 | Ga0070669_100198749 | Ga0070669_1001987492 | 149 |
| 211 | 3300005353 | Ga0070669_100384038 | Ga0070669_1003840382 | 149 |
| 212 | 3300005354 | Ga0070675_100085017 | Ga0070675_1000850172 | 149 |
| 213 | 3300005354 | Ga0070675_100663032 | Ga0070675_1006630322 | 149 |
| 214 | 3300005355 | Ga0070671_100001430 | Ga0070671_1000014307 | 149 |
| 215 | 3300005355 | Ga0070671_100009186 | Ga0070671_1000091866 | 149 |
| 216 | 3300005356 | Ga0070674_100002774 | Ga0070674_1000027744 | 149 |
| 217 | 3300005356 | Ga0070674_100039157 | Ga0070674_1000391572 | 149 |
| 218 | 3300005356 | Ga0070674_101119679 | Ga0070674_1011196791 | 149 |
| 219 | 3300005364 | Ga0070673_100000351 | Ga0070673_10000035115 | 149 |
| 220 | 3300005364 | Ga0070673_100004787 | Ga0070673_1000047872 | 149 |
| 221 | 3300005365 | Ga0070688_100000636 | Ga0070688_1000006364 | 149 |
| 222 | 3300005365 | Ga0070688_100007216 | Ga0070688_1000072161 | 149 |
| 223 | 3300005365 | Ga0070688_101175369 | Ga0070688_1011753691 | 149 |
| 224 | 3300005366 | Ga0070659_100043241 | Ga0070659_1000432413 | 149 |
| 225 | 3300005366 | Ga0070659_100049436 | Ga0070659_1000494362 | 149 |
| 226 | 3300005366 | Ga0070659_100577846 | Ga0070659_1005778462 | 149 |
| 227 | 3300005367 | Ga0070667_100013160 | Ga0070667_1000131603 | 149 |
| 228 | 3300005367 | Ga0070667_100039413 | Ga0070667_1000394132 | 149 |
| 229 | 3300005367 | Ga0070667_100394027 | Ga0070667_1003940272 | 149 |
| 230 | 3300005406 | Ga0070703_10002228 | Ga0070703_100022282 | 149 |
| 231 | 3300005406 | Ga0070703_10044342 | Ga0070703_100443422 | 149 |
| 232 | 3300005434 | Ga0070709_10001206 | Ga0070709_100012068 | 149 |
| 233 | 3300005434 | Ga0070709_10068063 | Ga0070709_100680632 | 149 |
| 234 | 3300005434 | Ga0070709_10250470 | Ga0070709_102504702 | 149 |
| 235 | 3300005435 | Ga0070714_100004005 | Ga0070714_1000040057 | 149 |
| 236 | 3300005435 | Ga0070714_100018072 | Ga0070714_1000180723 | 149 |
| 237 | 3300005435 | Ga0070714_100069015 | Ga0070714_1000690152 | 149 |
| 238 | 3300005435 | Ga0070714_100240283 | Ga0070714_1002402832 | 149 |
| 239 | 3300005436 | Ga0070713_100000423 | Ga0070713_1000004233 | 149 |
| 240 | 3300005437 | Ga0070710_10001578 | Ga0070710_100015783 | 149 |
| 241 | 3300005437 | Ga0070710_10040870 | Ga0070710_100408702 | 149 |
| 242 | 3300005438 | Ga0070701_10045191 | Ga0070701_100451912 | 149 |
| 243 | 3300005439 | Ga0070711_100130902 | Ga0070711_1001309022 | 149 |
| 244 | 3300005439 | Ga0070711_100145182 | Ga0070711_1001451822 | 149 |
| 245 | 3300005440 | Ga0070705_100007839 | Ga0070705_1000078393 | 149 |
| 246 | 3300005440 | Ga0070705_100090751 | Ga0070705_1000907512 | 149 |
| 247 | 3300005441 | Ga0070700_100043624 | Ga0070700_1000436243 | 149 |
| 248 | 3300005441 | Ga0070700_100777762 | Ga0070700_1007777622 | 149 |
| 249 | 3300005444 | Ga0070694_100000666 | Ga0070694_1000006665 | 149 |
| 250 | 3300005444 | Ga0070694_100499852 | Ga0070694_1004998521 | 149 |
| 251 | 3300005445 | Ga0070708_100292667 | Ga0070708_1002926672 | 149 |
| 252 | 3300005455 | Ga0070663_100008450 | Ga0070663_1000084503 | 149 |
| 253 | 3300005455 | Ga0070663_100026749 | Ga0070663_1000267492 | 149 |
| 254 | 3300005455 | Ga0070663_100137705 | Ga0070663_1001377052 | 149 |
| 255 | 3300005456 | Ga0070678_100006139 | Ga0070678_1000061392 | 149 |
| 256 | 3300005456 | Ga0070678_100019629 | Ga0070678_1000196295 | 149 |
| 257 | 3300005457 | Ga0070662_100008526 | Ga0070662_1000085263 | 149 |
| 258 | 3300005457 | Ga0070662_100206098 | Ga0070662_1002060981 | 149 |
| 259 | 3300005457 | Ga0070662_100429756 | Ga0070662_1004297562 | 149 |
| 260 | 3300005457 | Ga0070662_100835833 | Ga0070662_1008358331 | 149 |
| 261 | 3300005458 | Ga0070681_10001541 | Ga0070681_100015418 | 149 |
| 262 | 3300005458 | Ga0070681_10046591 | Ga0070681_100465913 | 149 |
| 263 | 3300005458 | Ga0070681_10057034 | Ga0070681_100570343 | 149 |
| 264 | 3300005458 | Ga0070681_10096426 | Ga0070681_100964262 | 149 |
| 265 | 3300005458 | Ga0070681_10351881 | Ga0070681_103518812 | 149 |
| 266 | 3300005458 | Ga0070681_10633913 | Ga0070681_106339131 | 149 |
| 267 | 3300005459 | Ga0068867_100167242 | Ga0068867_1001672422 | 149 |
| 268 | 3300005466 | Ga0070685_10008742 | Ga0070685_100087423 | 149 |
| 269 | 3300005471 | Ga0070698_100679973 | Ga0070698_1006799732 | 149 |
| 270 | 3300005507 | Ga0074259_10781806 | Ga0074259_107818062 | 149 |
| 271 | 3300005530 | Ga0070679_100001345 | Ga0070679_1000013458 | 149 |
| 272 | 3300005530 | Ga0070679_100048353 | Ga0070679_1000483533 | 149 |
| 273 | 3300005530 | Ga0070679_100141844 | Ga0070679_1001418443 | 149 |
| 274 | 3300005530 | Ga0070679_100299601 | Ga0070679_1002996012 | 149 |
| 275 | 3300005530 | Ga0070679_100548721 | Ga0070679_1005487211 | 149 |
| 276 | 3300005535 | Ga0070684_100032724 | Ga0070684_1000327243 | 149 |
| 277 | 3300005535 | Ga0070684_100167000 | Ga0070684_1001670002 | 149 |
| 278 | 3300005535 | Ga0070684_100206406 | Ga0070684_1002064062 | 149 |
| 279 | 3300005536 | Ga0070697_100261566 | Ga0070697_1002615662 | 149 |
| 280 | 3300005539 | Ga0068853_100075401 | Ga0068853_1000754012 | 149 |
| 281 | 3300005539 | Ga0068853_100207259 | Ga0068853_1002072592 | 149 |
| 282 | 3300005539 | Ga0068853_100629183 | Ga0068853_1006291832 | 149 |
| 283 | 3300005539 | Ga0068853_102002678 | Ga0068853_1020026781 | 149 |
| 284 | 3300005543 | Ga0070672_100001305 | Ga0070672_1000013053 | 149 |
| 285 | 3300005544 | Ga0070686_100000591 | Ga0070686_1000005918 | 149 |
| 286 | 3300005544 | Ga0070686_100050224 | Ga0070686_1000502242 | 149 |
| 287 | 3300005544 | Ga0070686_100212769 | Ga0070686_1002127691 | 149 |
| 288 | 3300005545 | Ga0070695_100096527 | Ga0070695_1000965272 | 149 |
| 289 | 3300005545 | Ga0070695_100535454 | Ga0070695_1005354542 | 149 |
| 290 | 3300005546 | Ga0070696_100010728 | Ga0070696_1000107283 | 149 |
| 291 | 3300005546 | Ga0070696_100016768 | Ga0070696_1000167684 | 149 |
| 292 | 3300005546 | Ga0070696_100038234 | Ga0070696_1000382343 | 149 |
| 293 | 3300005546 | Ga0070696_100251405 | Ga0070696_1002514052 | 149 |
| 294 | 3300005546 | Ga0070696_100601358 | Ga0070696_1006013581 | 149 |
| 295 | 3300005547 | Ga0070693_100023452 | Ga0070693_1000234523 | 149 |
| 296 | 3300005547 | Ga0070693_100045206 | Ga0070693_1000452062 | 149 |
| 297 | 3300005547 | Ga0070693_100615154 | Ga0070693_1006151541 | 149 |
| 298 | 3300005548 | Ga0070665_100062458 | Ga0070665_1000624582 | 149 |
| 299 | 3300005549 | Ga0070704_100014344 | Ga0070704_1000143442 | 149 |
| 300 | 3300005549 | Ga0070704_100042161 | Ga0070704_1000421613 | 149 |
| 301 | 3300005563 | Ga0068855_100021052 | Ga0068855_1000210523 | 149 |
| 302 | 3300005563 | Ga0068855_100088149 | Ga0068855_1000881492 | 149 |
| 303 | 3300005563 | Ga0068855_100172797 | Ga0068855_1001727972 | 149 |
| 304 | 3300005564 | Ga0070664_100008474 | Ga0070664_1000084747 | 149 |
| 305 | 3300005564 | Ga0070664_100064979 | Ga0070664_1000649792 | 149 |
| 306 | 3300005564 | Ga0070664_100142275 | Ga0070664_1001422752 | 149 |
| 307 | 3300005564 | Ga0070664_100241482 | Ga0070664_1002414822 | 149 |
| 308 | 3300005577 | Ga0068857_100001568 | Ga0068857_10000156815 | 149 |
| 309 | 3300005577 | Ga0068857_100205500 | Ga0068857_1002055002 | 149 |
| 310 | 3300005577 | Ga0068857_100629530 | Ga0068857_1006295302 | 149 |
| 311 | 3300005578 | Ga0068854_100069724 | Ga0068854_1000697242 | 149 |
| 312 | 3300005578 | Ga0068854_100482664 | Ga0068854_1004826642 | 149 |
| 313 | 3300005614 | Ga0068856_100088582 | Ga0068856_1000885822 | 149 |
| 314 | 3300005614 | Ga0068856_100266215 | Ga0068856_1002662152 | 149 |
| 315 | 3300005614 | Ga0068856_100730214 | Ga0068856_1007302141 | 149 |
| 316 | 3300005614 | Ga0068856_100823218 | Ga0068856_1008232181 | 149 |
| 317 | 3300005615 | Ga0070702_100001523 | Ga0070702_1000015237 | 149 |
| 318 | 3300005615 | Ga0070702_100036733 | Ga0070702_1000367331 | 149 |
| 319 | 3300005616 | Ga0068852_100292209 | Ga0068852_1002922091 | 149 |
| 320 | 3300005616 | Ga0068852_100349217 | Ga0068852_1003492172 | 149 |
| 321 | 3300005616 | Ga0068852_100378176 | Ga0068852_1003781762 | 149 |
| 322 | 3300005616 | Ga0068852_100423443 | Ga0068852_1004234432 | 149 |
| 323 | 3300005617 | Ga0068859_100004726 | Ga0068859_10000472610 | 149 |
| 324 | 3300005617 | Ga0068859_100068342 | Ga0068859_1000683423 | 149 |
| 325 | 3300005617 | Ga0068859_100069668 | Ga0068859_1000696682 | 149 |
| 326 | 3300005617 | Ga0068859_100206429 | Ga0068859_1002064293 | 149 |
| 327 | 3300005618 | Ga0068864_100072258 | Ga0068864_1000722581 | 149 |
| 328 | 3300005618 | Ga0068864_100841063 | Ga0068864_1008410632 | 149 |
| 329 | 3300005718 | Ga0068866_10392245 | Ga0068866_103922451 | 149 |
| 330 | 3300005719 | Ga0068861_100338496 | Ga0068861_1003384962 | 149 |
| 331 | 3300005719 | Ga0068861_100374788 | Ga0068861_1003747882 | 149 |
| 332 | 3300005834 | Ga0068851_10282260 | Ga0068851_102822602 | 149 |
| 333 | 3300005840 | Ga0068870_10000107 | Ga0068870_1000010715 | 149 |
| 334 | 3300005840 | Ga0068870_10723322 | Ga0068870_107233222 | 149 |
| 335 | 3300005841 | Ga0068863_100542679 | Ga0068863_1005426792 | 149 |
| 336 | 3300005841 | Ga0068863_100759791 | Ga0068863_1007597911 | 149 |
| 337 | 3300005842 | Ga0068858_100036809 | Ga0068858_1000368092 | 149 |
| 338 | 3300005842 | Ga0068858_100342234 | Ga0068858_1003422342 | 149 |
| 339 | 3300005842 | Ga0068858_100501436 | Ga0068858_1005014362 | 149 |
| 340 | 3300005842 | Ga0068858_100637002 | Ga0068858_1006370021 | 149 |
| 341 | 3300005843 | Ga0068860_100070594 | Ga0068860_1000705942 | 149 |
| 342 | 3300005844 | Ga0068862_100046532 | Ga0068862_1000465323 | 149 |
| 343 | 3300005937 | Ga0081455_10000012 | Ga0081455_1000001228 | 149 |
| 344 | 3300005937 | Ga0081455_10263464 | Ga0081455_102634642 | 149 |
| 345 | 3300005983 | Ga0081540_1087819 | Ga0081540_10878191 | 149 |
| 346 | 3300006038 | Ga0075365_11338890 | Ga0075365_113388901 | 149 |
| 347 | 3300006048 | Ga0075363_100325266 | Ga0075363_1003252662 | 149 |
| 348 | 3300006058 | Ga0075432_10048392 | Ga0075432_100483922 | 149 |
| 349 | 3300006163 | Ga0070715_10011106 | Ga0070715_100111063 | 149 |
| 350 | 3300006173 | Ga0070716_100001630 | Ga0070716_1000016308 | 149 |
| 351 | 3300006173 | Ga0070716_100056841 | Ga0070716_1000568411 | 149 |
| 352 | 3300006173 | Ga0070716_100297130 | Ga0070716_1002971302 | 149 |
| 353 | 3300006175 | Ga0070712_100030464 | Ga0070712_1000304642 | 149 |
| 354 | 3300006175 | Ga0070712_100072724 | Ga0070712_1000727243 | 149 |
| 355 | 3300006175 | Ga0070712_100110739 | Ga0070712_1001107392 | 149 |
| 356 | 3300006237 | Ga0097621_100006955 | Ga0097621_1000069553 | 149 |
| 357 | 3300006358 | Ga0068871_100003093 | Ga0068871_1000030934 | 149 |
| 358 | 3300006358 | Ga0068871_100059420 | Ga0068871_1000594203 | 149 |
| 359 | 3300006871 | Ga0075434_100102527 | Ga0075434_1001025272 | 149 |
| 360 | 3300006871 | Ga0075434_100104971 | Ga0075434_1001049712 | 149 |
| 361 | 3300006871 | Ga0075434_100494155 | Ga0075434_1004941551 | 149 |
| 362 | 3300006871 | Ga0075434_101017745 | Ga0075434_1010177452 | 149 |
| 363 | 3300006881 | Ga0068865_100044238 | Ga0068865_1000442381 | 149 |
| 364 | 3300006881 | Ga0068865_100056639 | Ga0068865_1000566392 | 149 |
| 365 | 3300006914 | Ga0075436_100075687 | Ga0075436_1000756872 | 149 |
| 366 | 3300006931 | Ga0097620_100004726 | Ga0097620_10000472610 | 149 |
| 367 | 3300006931 | Ga0097620_100068342 | Ga0097620_1000683423 | 149 |
| 368 | 3300006931 | Ga0097620_100069664 | Ga0097620_1000696642 | 149 |
| 369 | 3300006931 | Ga0097620_100206441 | Ga0097620_1002064413 | 149 |
| 370 | 3300007076 | Ga0075435_100064065 | Ga0075435_1000640652 | 149 |
| 371 | 3300009011 | Ga0105251_10019357 | Ga0105251_100193572 | 149 |
| 372 | 3300009011 | Ga0105251_10405144 | Ga0105251_104051441 | 149 |
| 373 | 3300009092 | Ga0105250_10086841 | Ga0105250_100868412 | 149 |
| 374 | 3300009092 | Ga0105250_10257303 | Ga0105250_102573032 | 149 |
| 375 | 3300009093 | Ga0105240_10029646 | Ga0105240_100296462 | 149 |
| 376 | 3300009093 | Ga0105240_10401726 | Ga0105240_104017262 | 149 |
| 377 | 3300009093 | Ga0105240_10516840 | Ga0105240_105168402 | 149 |
| 378 | 3300009094 | Ga0111539_10001217 | Ga0111539_1000121721 | 149 |
| 379 | 3300009094 | Ga0111539_10617522 | Ga0111539_106175222 | 149 |
| 380 | 3300009098 | Ga0105245_10161057 | Ga0105245_101610572 | 149 |
| 381 | 3300009098 | Ga0105245_10586372 | Ga0105245_105863722 | 149 |
| 382 | 3300009101 | Ga0105247_10001754 | Ga0105247_100017542 | 149 |
| 383 | 3300009101 | Ga0105247_10019797 | Ga0105247_100197973 | 149 |
| 384 | 3300009101 | Ga0105247_10028913 | Ga0105247_100289132 | 149 |
| 385 | 3300009101 | Ga0105247_10430530 | Ga0105247_104305302 | 149 |
| 386 | 3300009147 | Ga0114129_10038658 | Ga0114129_100386582 | 149 |
| 387 | 3300009148 | Ga0105243_10029408 | Ga0105243_100294083 | 149 |
| 388 | 3300009148 | Ga0105243_10048043 | Ga0105243_100480432 | 149 |
| 389 | 3300009174 | Ga0105241_10000891 | Ga0105241_100008918 | 149 |
| 390 | 3300009174 | Ga0105241_10011615 | Ga0105241_100116155 | 149 |
| 391 | 3300009174 | Ga0105241_11171438 | Ga0105241_111714381 | 149 |
| 392 | 3300009176 | Ga0105242_10007190 | Ga0105242_100071903 | 149 |
| 393 | 3300009176 | Ga0105242_10167123 | Ga0105242_101671232 | 149 |
| 394 | 3300009177 | Ga0105248_10000638 | Ga0105248_1000063823 | 149 |
| 395 | 3300009177 | Ga0105248_10007450 | Ga0105248_1000745010 | 149 |
| 396 | 3300009177 | Ga0105248_10683596 | Ga0105248_106835961 | 149 |
| 397 | 3300009545 | Ga0105237_10347842 | Ga0105237_103478422 | 149 |
| 398 | 3300009545 | Ga0105237_11729627 | Ga0105237_117296271 | 149 |
| 399 | 3300009551 | Ga0105238_10014196 | Ga0105238_100141962 | 149 |
| 400 | 3300009551 | Ga0105238_10028944 | Ga0105238_100289442 | 149 |
| 401 | 3300009553 | Ga0105249_10020932 | Ga0105249_100209323 | 149 |
| 402 | 3300009553 | Ga0105249_10564442 | Ga0105249_105644421 | 149 |
| 403 | 3300009553 | Ga0105249_10573051 | Ga0105249_105730512 | 149 |
| 404 | 3300009553 | Ga0105249_10797724 | Ga0105249_107977241 | 149 |
| 405 | 3300009553 | Ga0105249_11812988 | Ga0105249_118129881 | 149 |
| 406 | 3300010375 | Ga0105239_10005135 | Ga0105239_100051357 | 149 |
| 407 | 3300010375 | Ga0105239_10082950 | Ga0105239_100829502 | 149 |
| 408 | 3300010375 | Ga0105239_10510512 | Ga0105239_105105121 | 149 |
| 409 | 3300011119 | Ga0105246_10076578 | Ga0105246_100765782 | 149 |
| 410 | 3300011119 | Ga0105246_10816343 | Ga0105246_108163431 | 149 |
| 411 | 3300012502 | Ga0157347_1009871 | Ga0157347_10098712 | 149 |
| 412 | 3300012503 | Ga0157313_1002708 | Ga0157313_10027082 | 149 |
| 413 | 3300012513 | Ga0157326_1003964 | Ga0157326_10039642 | 149 |
| 414 | 3300013100 | Ga0157373_10024655 | Ga0157373_100246553 | 149 |
| 415 | 3300013100 | Ga0157373_10449663 | Ga0157373_104496631 | 149 |
| 416 | 3300013100 | Ga0157373_10487985 | Ga0157373_104879852 | 149 |
| 417 | 3300013102 | Ga0157371_10159389 | Ga0157371_101593892 | 149 |
| 418 | 3300013102 | Ga0157371_10340723 | Ga0157371_103407232 | 149 |
| 419 | 3300013105 | Ga0157369_11070952 | Ga0157369_110709522 | 149 |
| 420 | 3300013296 | Ga0157374_10138179 | Ga0157374_101381792 | 149 |
| 421 | 3300013296 | Ga0157374_10207106 | Ga0157374_102071062 | 149 |
| 422 | 3300013296 | Ga0157374_10509864 | Ga0157374_105098641 | 149 |
| 423 | 3300013297 | Ga0157378_10006939 | Ga0157378_100069394 | 149 |
| 424 | 3300013297 | Ga0157378_10213432 | Ga0157378_102134322 | 149 |
| 425 | 3300013306 | Ga0163162_10047751 | Ga0163162_100477514 | 149 |
| 426 | 3300013306 | Ga0163162_10094840 | Ga0163162_100948403 | 149 |
| 427 | 3300013307 | Ga0157372_10531262 | Ga0157372_105312622 | 149 |
| 428 | 3300013307 | Ga0157372_11337572 | Ga0157372_113375722 | 149 |
| 429 | 3300013307 | Ga0157372_12404903 | Ga0157372_124049031 | 149 |
| 430 | 3300013308 | Ga0157375_10002695 | Ga0157375_100026957 | 149 |
| 431 | 3300013308 | Ga0157375_10165195 | Ga0157375_101651952 | 149 |
| 432 | 3300013308 | Ga0157375_10299559 | Ga0157375_102995592 | 149 |
| 433 | 3300013308 | Ga0157375_11148205 | Ga0157375_111482052 | 149 |
| 434 | 3300014325 | Ga0163163_10023833 | Ga0163163_100238335 | 149 |
| 435 | 3300014325 | Ga0163163_10046102 | Ga0163163_100461022 | 149 |
| 436 | 3300014325 | Ga0163163_10221990 | Ga0163163_102219902 | 149 |
| 437 | 3300014325 | Ga0163163_10431856 | Ga0163163_104318562 | 149 |
| 438 | 3300014326 | Ga0157380_10004026 | Ga0157380_100040267 | 149 |
| 439 | 3300014326 | Ga0157380_10387959 | Ga0157380_103879592 | 149 |
| 440 | 3300014326 | Ga0157380_10719105 | Ga0157380_107191052 | 149 |
| 441 | 3300014326 | Ga0157380_12024386 | Ga0157380_120243861 | 149 |
| 442 | 3300014968 | Ga0157379_10103256 | Ga0157379_101032562 | 149 |
| 443 | 3300014968 | Ga0157379_10240775 | Ga0157379_102407751 | 149 |
| 444 | 3300014969 | Ga0157376_10720596 | Ga0157376_107205962 | 149 |
| 445 | 3300014969 | Ga0157376_11034001 | Ga0157376_110340012 | 149 |
| 446 | 3300017792 | Ga0163161_10001790 | Ga0163161_100017902 | 149 |
| 447 | 3300017792 | Ga0163161_10082933 | Ga0163161_100829332 | 149 |
| 448 | 3300020069 | Ga0197907_10525614 | Ga0197907_105256142 | 149 |
| 449 | 3300020070 | Ga0206356_10463979 | Ga0206356_104639792 | 149 |
| 450 | 3300020070 | Ga0206356_10908987 | Ga0206356_109089872 | 149 |
| 451 | 3300020078 | Ga0206352_10919806 | Ga0206352_109198061 | 149 |
| 452 | 3300020082 | Ga0206353_11507390 | Ga0206353_115073902 | 149 |
| 453 | 3300020610 | Ga0154015_1421512 | Ga0154015_14215121 | 149 |
| 454 | 3300022467 | Ga0224712_10627127 | Ga0224712_106271271 | 149 |
| 455 | 3300025271 | Ga0207666_1001296 | Ga0207666_10012962 | 149 |
| 456 | 3300025290 | Ga0207673_1000114 | Ga0207673_10001144 | 149 |
| 457 | 3300025315 | Ga0207697_10000913 | Ga0207697_1000091313 | 149 |
| 458 | 3300025315 | Ga0207697_10026179 | Ga0207697_100261792 | 149 |
| 459 | 3300025885 | Ga0207653_10041083 | Ga0207653_100410832 | 149 |
| 460 | 3300025893 | Ga0207682_10000107 | Ga0207682_1000010724 | 149 |
| 461 | 3300025898 | Ga0207692_10001671 | Ga0207692_100016713 | 149 |
| 462 | 3300025899 | Ga0207642_10748833 | Ga0207642_107488331 | 149 |
| 463 | 3300025900 | Ga0207710_10003883 | Ga0207710_100038835 | 149 |
| 464 | 3300025900 | Ga0207710_10061124 | Ga0207710_100611242 | 149 |
| 465 | 3300025901 | Ga0207688_10016191 | Ga0207688_100161912 | 149 |
| 466 | 3300025901 | Ga0207688_10062206 | Ga0207688_100622062 | 149 |
| 467 | 3300025901 | Ga0207688_10380834 | Ga0207688_103808342 | 149 |
| 468 | 3300025903 | Ga0207680_10004687 | Ga0207680_100046877 | 149 |
| 469 | 3300025903 | Ga0207680_10166488 | Ga0207680_101664882 | 149 |
| 470 | 3300025904 | Ga0207647_10010513 | Ga0207647_100105133 | 149 |
| 471 | 3300025904 | Ga0207647_10017796 | Ga0207647_100177963 | 149 |
| 472 | 3300025905 | Ga0207685_10001449 | Ga0207685_100014491 | 149 |
| 473 | 3300025906 | Ga0207699_10002364 | Ga0207699_100023643 | 149 |
| 474 | 3300025906 | Ga0207699_10056461 | Ga0207699_100564613 | 149 |
| 475 | 3300025906 | Ga0207699_10086923 | Ga0207699_100869232 | 149 |
| 476 | 3300025907 | Ga0207645_10000655 | Ga0207645_1000065523 | 149 |
| 477 | 3300025909 | Ga0207705_10009573 | Ga0207705_100095735 | 149 |
| 478 | 3300025911 | Ga0207654_10004317 | Ga0207654_100043173 | 149 |
| 479 | 3300025911 | Ga0207654_10009569 | Ga0207654_100095693 | 149 |
| 480 | 3300025912 | Ga0207707_10007710 | Ga0207707_100077102 | 149 |
| 481 | 3300025912 | Ga0207707_10024331 | Ga0207707_100243314 | 149 |
| 482 | 3300025912 | Ga0207707_10260577 | Ga0207707_102605772 | 149 |
| 483 | 3300025913 | Ga0207695_10437877 | Ga0207695_104378772 | 149 |
| 484 | 3300025913 | Ga0207695_10690028 | Ga0207695_106900282 | 149 |
| 485 | 3300025914 | Ga0207671_10535604 | Ga0207671_105356041 | 149 |
| 486 | 3300025914 | Ga0207671_10998033 | Ga0207671_109980331 | 149 |
| 487 | 3300025915 | Ga0207693_10001389 | Ga0207693_100013893 | 149 |
| 488 | 3300025915 | Ga0207693_10003329 | Ga0207693_100033298 | 149 |
| 489 | 3300025915 | Ga0207693_10013980 | Ga0207693_100139803 | 149 |
| 490 | 3300025917 | Ga0207660_10061167 | Ga0207660_100611672 | 149 |
| 491 | 3300025917 | Ga0207660_10127706 | Ga0207660_101277062 | 149 |
| 492 | 3300025917 | Ga0207660_10294823 | Ga0207660_102948232 | 149 |
| 493 | 3300025917 | Ga0207660_10759623 | Ga0207660_107596231 | 149 |
| 494 | 3300025918 | Ga0207662_10000219 | Ga0207662_1000021923 | 149 |
| 495 | 3300025918 | Ga0207662_10048474 | Ga0207662_100484742 | 149 |
| 496 | 3300025919 | Ga0207657_10003532 | Ga0207657_100035322 | 149 |
| 497 | 3300025919 | Ga0207657_10012089 | Ga0207657_100120896 | 149 |
| 498 | 3300025920 | Ga0207649_10120601 | Ga0207649_101206012 | 149 |
| 499 | 3300025920 | Ga0207649_10142448 | Ga0207649_101424482 | 149 |
| 500 | 3300025920 | Ga0207649_10885866 | Ga0207649_108858661 | 149 |
| 501 | 3300025921 | Ga0207652_10031841 | Ga0207652_100318413 | 149 |
| 502 | 3300025921 | Ga0207652_10039661 | Ga0207652_100396612 | 149 |
| 503 | 3300025921 | Ga0207652_10042562 | Ga0207652_100425622 | 149 |
| 504 | 3300025921 | Ga0207652_10066697 | Ga0207652_100666973 | 149 |
| 505 | 3300025923 | Ga0207681_10391696 | Ga0207681_103916961 | 149 |
| 506 | 3300025924 | Ga0207694_10038022 | Ga0207694_100380224 | 149 |
| 507 | 3300025924 | Ga0207694_10147335 | Ga0207694_101473352 | 149 |
| 508 | 3300025925 | Ga0207650_10009061 | Ga0207650_100090613 | 149 |
| 509 | 3300025926 | Ga0207659_10060672 | Ga0207659_100606724 | 149 |
| 510 | 3300025926 | Ga0207659_10183322 | Ga0207659_101833222 | 149 |
| 511 | 3300025926 | Ga0207659_10263314 | Ga0207659_102633142 | 149 |
| 512 | 3300025929 | Ga0207664_10080162 | Ga0207664_100801622 | 149 |
| 513 | 3300025929 | Ga0207664_10103821 | Ga0207664_101038212 | 149 |
| 514 | 3300025929 | Ga0207664_10107277 | Ga0207664_101072773 | 149 |
| 515 | 3300025929 | Ga0207664_10193151 | Ga0207664_101931512 | 149 |
| 516 | 3300025929 | Ga0207664_11000693 | Ga0207664_110006931 | 149 |
| 517 | 3300025931 | Ga0207644_10007296 | Ga0207644_100072962 | 149 |
| 518 | 3300025931 | Ga0207644_10010415 | Ga0207644_100104154 | 149 |
| 519 | 3300025932 | Ga0207690_10009361 | Ga0207690_100093614 | 149 |
| 520 | 3300025932 | Ga0207690_10012020 | Ga0207690_100120204 | 149 |
| 521 | 3300025933 | Ga0207706_10054580 | Ga0207706_100545803 | 149 |
| 522 | 3300025933 | Ga0207706_10233409 | Ga0207706_102334091 | 149 |
| 523 | 3300025934 | Ga0207686_10005571 | Ga0207686_100055712 | 149 |
| 524 | 3300025934 | Ga0207686_10063062 | Ga0207686_100630621 | 149 |
| 525 | 3300025935 | Ga0207709_10003899 | Ga0207709_100038997 | 149 |
| 526 | 3300025935 | Ga0207709_10004724 | Ga0207709_100047243 | 149 |
| 527 | 3300025935 | Ga0207709_10045569 | Ga0207709_100455692 | 149 |
| 528 | 3300025936 | Ga0207670_10016730 | Ga0207670_100167303 | 149 |
| 529 | 3300025936 | Ga0207670_10030395 | Ga0207670_100303953 | 149 |
| 530 | 3300025936 | Ga0207670_10061276 | Ga0207670_100612762 | 149 |
| 531 | 3300025936 | Ga0207670_10080900 | Ga0207670_100809002 | 149 |
| 532 | 3300025937 | Ga0207669_10009055 | Ga0207669_100090553 | 149 |
| 533 | 3300025937 | Ga0207669_10095007 | Ga0207669_100950072 | 149 |
| 534 | 3300025938 | Ga0207704_10130064 | Ga0207704_101300642 | 149 |
| 535 | 3300025939 | Ga0207665_10000662 | Ga0207665_1000066210 | 149 |
| 536 | 3300025939 | Ga0207665_10124378 | Ga0207665_101243782 | 149 |
| 537 | 3300025940 | Ga0207691_10000885 | Ga0207691_1000088513 | 149 |
| 538 | 3300025940 | Ga0207691_10838861 | Ga0207691_108388612 | 149 |
| 539 | 3300025941 | Ga0207711_10018008 | Ga0207711_100180085 | 149 |
| 540 | 3300025941 | Ga0207711_10827766 | Ga0207711_108277662 | 149 |
| 541 | 3300025942 | Ga0207689_10000348 | Ga0207689_1000034813 | 149 |
| 542 | 3300025942 | Ga0207689_10089316 | Ga0207689_100893162 | 149 |
| 543 | 3300025944 | Ga0207661_10002293 | Ga0207661_100022934 | 149 |
| 544 | 3300025944 | Ga0207661_10032802 | Ga0207661_100328023 | 149 |
| 545 | 3300025944 | Ga0207661_10943997 | Ga0207661_109439972 | 149 |
| 546 | 3300025945 | Ga0207679_10041801 | Ga0207679_100418013 | 149 |
| 547 | 3300025945 | Ga0207679_10044842 | Ga0207679_100448422 | 149 |
| 548 | 3300025945 | Ga0207679_11214277 | Ga0207679_112142772 | 149 |
| 549 | 3300025949 | Ga0207667_10040369 | Ga0207667_100403692 | 149 |
| 550 | 3300025949 | Ga0207667_10052119 | Ga0207667_100521192 | 149 |
| 551 | 3300025949 | Ga0207667_10273612 | Ga0207667_102736121 | 149 |
| 552 | 3300025949 | Ga0207667_10784498 | Ga0207667_107844981 | 149 |
| 553 | 3300025960 | Ga0207651_10053757 | Ga0207651_100537572 | 149 |
| 554 | 3300025960 | Ga0207651_10952117 | Ga0207651_109521172 | 149 |
| 555 | 3300025961 | Ga0207712_10004014 | Ga0207712_100040143 | 149 |
| 556 | 3300025961 | Ga0207712_10384456 | Ga0207712_103844562 | 149 |
| 557 | 3300025961 | Ga0207712_10902748 | Ga0207712_109027482 | 149 |
| 558 | 3300025972 | Ga0207668_10001277 | Ga0207668_100012773 | 149 |
| 559 | 3300025972 | Ga0207668_10176389 | Ga0207668_101763892 | 149 |
| 560 | 3300025981 | Ga0207640_10162280 | Ga0207640_101622802 | 149 |
| 561 | 3300025981 | Ga0207640_10849767 | Ga0207640_108497672 | 149 |
| 562 | 3300025981 | Ga0207640_11650068 | Ga0207640_116500681 | 149 |
| 563 | 3300025986 | Ga0207658_10043628 | Ga0207658_100436282 | 149 |
| 564 | 3300025986 | Ga0207658_10189798 | Ga0207658_101897981 | 149 |
| 565 | 3300025986 | Ga0207658_10533896 | Ga0207658_105338962 | 149 |
| 566 | 3300026023 | Ga0207677_10045838 | Ga0207677_100458382 | 149 |
| 567 | 3300026023 | Ga0207677_10400172 | Ga0207677_104001722 | 149 |
| 568 | 3300026035 | Ga0207703_10018706 | Ga0207703_100187065 | 149 |
| 569 | 3300026035 | Ga0207703_10092663 | Ga0207703_100926632 | 149 |
| 570 | 3300026035 | Ga0207703_10257683 | Ga0207703_102576832 | 149 |
| 571 | 3300026035 | Ga0207703_10576085 | Ga0207703_105760851 | 149 |
| 572 | 3300026041 | Ga0207639_10100632 | Ga0207639_101006321 | 149 |
| 573 | 3300026041 | Ga0207639_10128412 | Ga0207639_101284122 | 149 |
| 574 | 3300026067 | Ga0207678_10024974 | Ga0207678_100249744 | 149 |
| 575 | 3300026067 | Ga0207678_10034392 | Ga0207678_100343923 | 149 |
| 576 | 3300026067 | Ga0207678_10035096 | Ga0207678_100350963 | 149 |
| 577 | 3300026067 | Ga0207678_11367442 | Ga0207678_113674421 | 149 |
| 578 | 3300026075 | Ga0207708_10194787 | Ga0207708_101947872 | 149 |
| 579 | 3300026075 | Ga0207708_10296003 | Ga0207708_102960032 | 149 |
| 580 | 3300026078 | Ga0207702_10134036 | Ga0207702_101340361 | 149 |
| 581 | 3300026088 | Ga0207641_10013404 | Ga0207641_100134043 | 149 |
| 582 | 3300026088 | Ga0207641_10865871 | Ga0207641_108658711 | 149 |
| 583 | 3300026088 | Ga0207641_11315153 | Ga0207641_113151531 | 149 |
| 584 | 3300026089 | Ga0207648_10090007 | Ga0207648_100900071 | 149 |
| 585 | 3300026089 | Ga0207648_10246217 | Ga0207648_102462172 | 149 |
| 586 | 3300026095 | Ga0207676_10064325 | Ga0207676_100643251 | 149 |
| 587 | 3300026095 | Ga0207676_10083304 | Ga0207676_100833042 | 149 |
| 588 | 3300026116 | Ga0207674_10001762 | Ga0207674_1000176221 | 149 |
| 589 | 3300026116 | Ga0207674_10148315 | Ga0207674_101483152 | 149 |
| 590 | 3300026116 | Ga0207674_10293334 | Ga0207674_102933342 | 149 |
| 591 | 3300026118 | Ga0207675_100181619 | Ga0207675_1001816192 | 149 |
| 592 | 3300026121 | Ga0207683_10000069 | Ga0207683_1000006924 | 149 |
| 593 | 3300026121 | Ga0207683_10001587 | Ga0207683_1000158714 | 149 |
| 594 | 3300026121 | Ga0207683_10161969 | Ga0207683_101619692 | 149 |
| 595 | 3300026142 | Ga0207698_10211693 | Ga0207698_102116932 | 149 |
| 596 | 3300026142 | Ga0207698_10212792 | Ga0207698_102127922 | 149 |
| 597 | 3300026142 | Ga0207698_10515015 | Ga0207698_105150152 | 149 |
| 598 | 3300026142 | Ga0207698_10820285 | Ga0207698_108202851 | 149 |
| 599 | 3300026142 | Ga0207698_11609613 | Ga0207698_116096131 | 149 |
| 600 | 3300027462 | Ga0210000_1068497 | Ga0210000_10684971 | 149 |
| 601 | 3300027526 | Ga0209968_1049546 | Ga0209968_10495461 | 149 |
| 602 | 3300027617 | Ga0210002_1002533 | Ga0210002_10025331 | 149 |
| 603 | 3300027717 | Ga0209998_10000492 | Ga0209998_100004925 | 149 |
| 604 | 3300027876 | Ga0209974_10013544 | Ga0209974_100135442 | 149 |
| 605 | 3300027876 | Ga0209974_10016533 | Ga0209974_100165332 | 149 |
| 606 | 3300027907 | Ga0207428_10000987 | Ga0207428_1000098724 | 149 |
| 607 | 3300027907 | Ga0207428_10146905 | Ga0207428_101469051 | 149 |
| 608 | 3300028379 | Ga0268266_10016263 | Ga0268266_100162631 | 149 |
| 609 | 3300028380 | Ga0268265_10058799 | Ga0268265_100587993 | 149 |
| 610 | 3300028381 | Ga0268264_10105628 | Ga0268264_101056282 | 149 |
| 611 | 3300028800 | Ga0265338_10018308 | Ga0265338_100183085 | 149 |
| 612 | 3300028800 | Ga0265338_10116264 | Ga0265338_101162643 | 149 |
| 613 | 3300028800 | Ga0265338_10220772 | Ga0265338_102207722 | 149 |
| 614 | 3300031235 | Ga0265330_10002724 | Ga0265330_100027242 | 149 |
| 615 | 3300031238 | Ga0265332_10035583 | Ga0265332_100355832 | 149 |
| 616 | 3300031238 | Ga0265332_10056639 | Ga0265332_100566392 | 149 |
| 617 | 3300031238 | Ga0265332_10360111 | Ga0265332_103601111 | 149 |
| 618 | 3300031241 | Ga0265325_10034748 | Ga0265325_100347482 | 149 |
| 619 | 3300031241 | Ga0265325_10135664 | Ga0265325_101356642 | 149 |
| 620 | 3300031241 | Ga0265325_10216973 | Ga0265325_102169732 | 149 |
| 621 | 3300031247 | Ga0265340_10025044 | Ga0265340_100250442 | 149 |
| 622 | 3300031247 | Ga0265340_10119635 | Ga0265340_101196352 | 149 |
| 623 | 3300031249 | Ga0265339_10097306 | Ga0265339_100973062 | 149 |
| 624 | 3300031249 | Ga0265339_10318729 | Ga0265339_103187292 | 149 |
| 625 | 3300031250 | Ga0265331_10034942 | Ga0265331_100349423 | 149 |
| 626 | 3300031344 | Ga0265316_10314627 | Ga0265316_103146271 | 149 |
| 627 | 3300031595 | Ga0265313_10010158 | Ga0265313_100101585 | 149 |
| 628 | 3300031595 | Ga0265313_10127542 | Ga0265313_101275422 | 149 |
| 629 | 3300031691 | Ga0316579_10107784 | Ga0316579_101077841 | 149 |
| 630 | 3300031711 | Ga0265314_10007553 | Ga0265314_1000755310 | 149 |
| 631 | 3300031712 | Ga0265342_10002003 | Ga0265342_1000200312 | 149 |
| 632 | 3300031728 | Ga0316578_10324386 | Ga0316578_103243861 | 149 |
| 633 | 3300034816 | Ga0373930_0005010 | Ga0373930_0005010_77_526 | 149 |
| 634 | 3300034816 | Ga0373930_0008947 | Ga0373930_0008947_93_542 | 149 |
| 635 | 3300034816 | Ga0373930_0018724 | Ga0373930_0018724_736_1185 | 149 |
| 636 | 3300034817 | Ga0373948_0002605 | Ga0373948_0002605_1411_1860 | 149 |
| 637 | 3300034817 | Ga0373948_0051812 | Ga0373948_0051812_363_812 | 149 |
| 638 | 3300034818 | Ga0373950_0002519 | Ga0373950_0002519_1746_2195 | 149 |
| 639 | 3300034819 | Ga0373958_0008133 | Ga0373958_0008133_148_597 | 149 |
| 640 | 3300034820 | Ga0373959_0008341 | Ga0373959_0008341_282_731 | 149 |
| 641 | 3300034820 | Ga0373959_0118661 | Ga0373959_0118661_149_598 | 149 |
| 642 | 3300034957 | Ga0373938_0000058 | Ga0373938_0000058_8345_8794 | 149 |
| 643 | 3300035083 | Ga0373926_0000688 | Ga0373926_0000688_2738_3187 | 149 |
| 644 | 3300035084 | Ga0373928_0000183 | Ga0373928_0000183_5377_5826 | 149 |
| 645 | 3300035084 | Ga0373928_0005826 | Ga0373928_0005826_421_870 | 149 |
| 646 | 3300035085 | Ga0373929_0000526 | Ga0373929_0000526_5618_6067 | 149 |
| 647 | 3300035086 | Ga0373934_0267719 | Ga0373934_0267719_147_596 | 149 |
| 648 | 3300035088 | Ga0373940_0000164 | Ga0373940_0000164_971_1420 | 149 |
| 649 | 3300035088 | Ga0373940_0016371 | Ga0373940_0016371_983_1432 | 149 |
| 650 | 3300035088 | Ga0373940_0204597 | Ga0373940_0204597_160_609 | 149 |
| 651 | 3300035089 | Ga0373944_0006754 | Ga0373944_0006754_795_1244 | 149 |
| 652 | 3300035090 | Ga0373949_0002161 | Ga0373949_0002161_1764_2213 | 149 |
| 653 | 3300035090 | Ga0373949_0006499 | Ga0373949_0006499_742_1191 | 149 |
| 654 | 3300035091 | Ga0373951_0000370 | Ga0373951_0000370_1095_1544 | 149 |
| 655 | 3300035091 | Ga0373951_0007650 | Ga0373951_0007650_1026_1475 | 149 |
| 656 | 3300035091 | Ga0373951_0013394 | Ga0373951_0013394_268_717 | 149 |
| 657 | 3300035092 | Ga0373952_0000467 | Ga0373952_0000467_806_1255 | 149 |
| 658 | 3300035092 | Ga0373952_0063454 | Ga0373952_0063454_10_459 | 149 |
| 659 | 3300035111 | Ga0373923_0000524 | Ga0373923_0000524_7018_7467 | 149 |
| 660 | 3300035112 | Ga0373932_0000811 | Ga0373932_0000811_2069_2518 | 149 |
| 661 | 3300035112 | Ga0373932_0005150 | Ga0373932_0005150_1234_1683 | 149 |
| 662 | 3300035113 | Ga0373936_0000524 | Ga0373936_0000524_11672_12121 | 149 |
| 663 | 3300035114 | Ga0373939_0002469 | Ga0373939_0002469_3059_3508 | 149 |
| 664 | 3300035115 | Ga0373941_0000450 | Ga0373941_0000450_1018_1467 | 149 |
| 665 | 3300035116 | Ga0373945_0001431 | Ga0373945_0001431_2330_2779 | 149 |
| 666 | 3300035117 | Ga0373953_0225502 | Ga0373953_0225502_93_542 | 149 |
| 667 | 3300035118 | Ga0373954_0003182 | Ga0373954_0003182_1668_2117 | 149 |
| 668 | 3300035119 | Ga0373956_0134067 | Ga0373956_0134067_80_529 | 149 |
| 669 | 3300035121 | Ga0373960_0001389 | Ga0373960_0001389_1825_2274 | 149 |
| 670 | 3300035170 | Ga0373943_0013004 | Ga0373943_0013004_482_931 | 149 |
| 671 | 3300035171 | Ga0373946_0002069 | Ga0373946_0002069_2846_3295 | 149 |
| 672 | 3300035172 | Ga0373955_0003523 | Ga0373955_0003523_6282_6731 | 149 |
| 673 | 3300035207 | Ga0373942_0000555 | Ga0373942_0000555_6484_6933 | 149 |
| 674 | 3300035241 | Ga0373961_0000817 | Ga0373961_0000817_2927_3376 | 149 |
| 675 | 3300035242 | Ga0373962_0000563 | Ga0373962_0000563_4818_5267 | 149 |
| 676 | 3300035242 | Ga0373962_0000865 | Ga0373962_0000865_4628_5077 | 149 |
| 677 | 3300035410 | Ga0373924_0017036 | Ga0373924_0017036_141_590 | 149 |
| 678 | 3300035691 | Ga0373931_0013723 | Ga0373931_0013723_1886_2335 | 149 |
| 679 | 3300035691 | Ga0373931_0015869 | Ga0373931_0015869_34_483 | 149 |
| 680 | 3300035691 | Ga0373931_0022095 | Ga0373931_0022095_2726_3175 | 149 |
| 681 | 3300035692 | Ga0373935_0019128 | Ga0373935_0019128_700_1149 | 149 |
| 682 | 3300035695 | Ga0373927_0011605 | Ga0373927_0011605_982_1431 | 149 |
| 683 | 3300035695 | Ga0373927_0143975 | Ga0373927_0143975_1079_1528 | 149 |
| 684 | 3300035724 | Ga0373933_0263497 | Ga0373933_0263497_83_532 | 149 |
| 685 | 3300035725 | Ga0373947_0033285 | Ga0373947_0033285_2111_2560 | 149 |
| 686 | 3300035725 | Ga0373947_0157689 | Ga0373947_0157689_646_1095 | 149 |
| 687 | 3300036401 | Ga0373937_0026181 | Ga0373937_0026181_2614_3063 | 149 |
| 688 | 3300036401 | Ga0373937_0324758 | Ga0373937_0324758_957_1409 | 149 |
| 689 | 3300037068 | Ga0373925_0005122 | Ga0373925_0005122_6594_7043 | 149 |
| 690 | 3300037068 | Ga0373925_0234195 | Ga0373925_0234195_800_1249 | 149 |
| 691 | 3300038996 | Ga0242420_012832 | Ga0242420_012832_699_1148 | 149 |
| 692 | 3300039447 | Ga0436361_0576226 | Ga0436361_0576226_1494_1943 | 149 |
| 693 | 3300041496 | Ga0451839_1639025 | Ga0451839_1639025_198_647 | 149 |
| 694 | 3300042005 | Ga0439448_0158406 | Ga0439448_0158406_293_742 | 149 |
| 695 | 3300042439 | Ga0439464_0036987 | Ga0439464_0036987_642_1091 | 149 |
| 696 | 3300042876 | Ga0451577_0012196 | Ga0451577_0012196_288_737 | 149 |
| 697 | 3300045051 | Ga0451576_0054208 | Ga0451576_0054208_3729_4178 | 149 |
| 698 | 3300046452 | Ga0495617_169873 | Ga0495617_169873_51_500 | 149 |
| 699 | 3300046454 | Ga0495592_0044780 | Ga0495592_0044780_862_1311 | 149 |
| 700 | 3300046455 | Ga0495603_0016333 | Ga0495603_0016333_923_1372 | 149 |
| 701 | 3300046461 | Ga0495641_0007860 | Ga0495641_0007860_267_716 | 149 |
| 702 | 3300046463 | Ga0495653_0002576 | Ga0495653_0002576_11229_11678 | 149 |
| 703 | 3300046472 | Ga0495580_0074209 | Ga0495580_0074209_1861_2310 | 149 |
| 704 | 3300046473 | Ga0495582_0001169 | Ga0495582_0001169_7524_7973 | 149 |
| 705 | 3300046474 | Ga0495605_0266587 | Ga0495605_0266587_237_686 | 149 |
| 706 | 3300046475 | Ga0495639_0054454 | Ga0495639_0054454_482_931 | 149 |
| 707 | 3300046476 | Ga0495662_0008406 | Ga0495662_0008406_3203_3652 | 149 |
| 708 | 3300046477 | Ga0495664_0009618 | Ga0495664_0009618_2110_2559 | 149 |
| 709 | 3300046491 | Ga0495584_0023810 | Ga0495584_0023810_131_580 | 149 |
| 710 | 3300046492 | Ga0495585_0001628 | Ga0495585_0001628_14795_15244 | 149 |
| 711 | 3300046499 | Ga0495594_0008935 | Ga0495594_0008935_4526_4975 | 149 |
| 712 | 3300046501 | Ga0495607_0017460 | Ga0495607_0017460_2080_2529 | 149 |
| 713 | 3300046511 | Ga0495608_0017314 | Ga0495608_0017314_3817_4266 | 149 |
| 714 | 3300046514 | Ga0495618_0005710 | Ga0495618_0005710_203_652 | 149 |
| 715 | 3300046516 | Ga0495628_0022497 | Ga0495628_0022497_2015_2464 | 149 |
| 716 | 3300046517 | Ga0495630_0051023 | Ga0495630_0051023_32_481 | 149 |
| 717 | 3300046520 | Ga0495637_0331149 | Ga0495637_0331149_48_497 | 149 |
| 718 | 3300046523 | Ga0495644_0005413 | Ga0495644_0005413_1808_2257 | 149 |
| 719 | 3300046525 | Ga0495663_0155530 | Ga0495663_0155530_237_686 | 149 |
| 720 | 3300046526 | Ga0495666_0002279 | Ga0495666_0002279_2318_2767 | 149 |
| 721 | 3300046529 | Ga0495652_0048315 | Ga0495652_0048315_2931_3380 | 149 |
| 722 | 3300046531 | Ga0495665_0005343 | Ga0495665_0005343_2658_3107 | 149 |
| 723 | 3300046533 | Ga0495640_0317433 | Ga0495640_0317433_35_484 | 149 |
| 724 | 3300046536 | Ga0495587_0032694 | Ga0495587_0032694_715_1164 | 149 |
| 725 | 3300046537 | Ga0495598_0032005 | Ga0495598_0032005_941_1390 | 149 |
| 726 | 3300046538 | Ga0495609_0278873 | Ga0495609_0278873_148_597 | 149 |
| 727 | 3300046543 | Ga0495645_0226297 | Ga0495645_0226297_748_1197 | 149 |
| 728 | 3300046557 | Ga0495622_0005467 | Ga0495622_0005467_2640_3089 | 149 |
| 729 | 3300046558 | Ga0495633_0001638 | Ga0495633_0001638_14568_15017 | 149 |
| 730 | 3300046559 | Ga0495667_0002504 | Ga0495667_0002504_1684_2133 | 149 |
| 731 | 3300046615 | Ga0495656_0000844 | Ga0495656_0000844_1975_2424 | 149 |
| 732 | 3300046648 | Ga0495611_0015637 | Ga0495611_0015637_795_1244 | 149 |
| 733 | 3300046663 | Ga0495635_0007089 | Ga0495635_0007089_699_1148 | 149 |
| 734 | 3300046664 | Ga0495659_0000812 | Ga0495659_0000812_1963_2412 | 149 |
| 735 | 3300046674 | Ga0495588_0000780 | Ga0495588_0000780_2318_2767 | 149 |
| 736 | 3300046674 | Ga0495588_0274106 | Ga0495588_0274106_392_841 | 149 |
| 737 | 3300046678 | Ga0495599_0010706 | Ga0495599_0010706_2432_2881 | 149 |
| 738 | 3300046681 | Ga0495647_0004832 | Ga0495647_0004832_1425_1874 | 149 |
| 739 | 3300046683 | Ga0495658_0002231 | Ga0495658_0002231_2455_2904 | 149 |
| 740 | 3300046689 | Ga0495613_0004955 | Ga0495613_0004955_491_940 | 149 |
| 741 | 3300046690 | Ga0495624_0006812 | Ga0495624_0006812_2145_2594 | 149 |
| 742 | 3300046691 | Ga0495670_0001934 | Ga0495670_0001934_2498_2947 | 149 |
| 743 | 3300046809 | Ga0495600_0033824 | Ga0495600_0033824_2680_3129 | 149 |
| 744 | 3300047315 | Ga0495581_0005546 | Ga0495581_0005546_1832_2281 | 149 |
| 745 | 3300047317 | Ga0495604_0015259 | Ga0495604_0015259_2116_2565 | 149 |
| 746 | 3300047319 | Ga0495674_0119959 | Ga0495674_0119959_482_931 | 149 |
| 747 | 3300047321 | Ga0495676_0063761 | Ga0495676_0063761_572_1021 | 149 |
| 748 | 3300047321 | Ga0495676_0114885 | Ga0495676_0114885_121_570 | 149 |
| 749 | 3300047322 | Ga0495680_0026301 | Ga0495680_0026301_1865_2314 | 149 |
| 750 | 3300047444 | Ga0495675_0025080 | Ga0495675_0025080_2666_3115 | 149 |
| 751 | 3300047446 | Ga0495679_076272 | Ga0495679_076272_89_538 | 149 |
| 752 | 3300047471 | Ga0495684_0005442 | Ga0495684_0005442_8977_9426 | 149 |
| 753 | 3300047673 | Ga0495593_0010044 | Ga0495593_0010044_2547_2996 | 149 |
| 754 | 3300048089 | Ga0495614_0006166 | Ga0495614_0006166_2389_2838 | 149 |
| 755 | 3300048903 | Ga0496100_0012687 | Ga0496100_0012687_1675_2124 | 149 |
| 756 | 3300048903 | Ga0496100_1122334 | Ga0496100_1122334_141_590 | 149 |
| 757 | 3300048904 | Ga0496101_0873105 | Ga0496101_0873105_146_595 | 149 |
| 758 | 3300048904 | Ga0496101_0946955 | Ga0496101_0946955_72_521 | 149 |
| 759 | 3300048905 | Ga0496102_0113055 | Ga0496102_0113055_104_553 | 149 |
| 760 | 3300048905 | Ga0496102_0389225 | Ga0496102_0389225_706_1155 | 149 |
| 761 | 3300048906 | Ga0496103_0050447 | Ga0496103_0050447_1969_2418 | 149 |
| 762 | 3300048906 | Ga0496103_0145462 | Ga0496103_0145462_909_1358 | 149 |
| 763 | 3300048907 | Ga0496104_0195722 | Ga0496104_0195722_672_1121 | 149 |
| 764 | 3300048907 | Ga0496104_0294781 | Ga0496104_0294781_157_606 | 149 |
| 765 | 3300048908 | Ga0496105_0111266 | Ga0496105_0111266_1139_1588 | 149 |
| 766 | 3300048908 | Ga0496105_0317621 | Ga0496105_0317621_183_632 | 149 |
| 767 | 3300048908 | Ga0496105_0466156 | Ga0496105_0466156_390_839 | 149 |
| 768 | 3300048909 | Ga0496106_0041267 | Ga0496106_0041267_2313_2762 | 149 |
| 769 | 3300048909 | Ga0496106_0123244 | Ga0496106_0123244_1404_1853 | 149 |
| 770 | 3300048909 | Ga0496106_0152321 | Ga0496106_0152321_1317_1766 | 149 |
| 771 | 3300048910 | Ga0496107_0045547 | Ga0496107_0045547_371_820 | 149 |
| 772 | 3300048910 | Ga0496107_0082706 | Ga0496107_0082706_260_709 | 149 |
| 773 | 3300048910 | Ga0496107_0089779 | Ga0496107_0089779_1150_1599 | 149 |
| 774 | 3300048911 | Ga0496108_0050233 | Ga0496108_0050233_1936_2385 | 149 |
| 775 | 3300048911 | Ga0496108_0065764 | Ga0496108_0065764_1469_1918 | 149 |
| 776 | 3300048911 | Ga0496108_0074924 | Ga0496108_0074924_285_734 | 149 |
| 777 | 3300048911 | Ga0496108_0242923 | Ga0496108_0242923_744_1193 | 149 |
| 778 | 3300048912 | Ga0496109_0002090 | Ga0496109_0002090_12117_12566 | 149 |
| 779 | 3300048912 | Ga0496109_0002254 | Ga0496109_0002254_8187_8636 | 149 |
| 780 | 3300048912 | Ga0496109_0102967 | Ga0496109_0102967_1137_1586 | 149 |
| 781 | 3300048912 | Ga0496109_0117084 | Ga0496109_0117084_1019_1468 | 149 |
| 782 | 3300048912 | Ga0496109_0475035 | Ga0496109_0475035_219_668 | 149 |
| 783 | 3300048913 | Ga0496110_1805656 | Ga0496110_1805656_37_486 | 149 |
| 784 | 3300048914 | Ga0496111_0025885 | Ga0496111_0025885_1083_1532 | 149 |
| 785 | 3300048914 | Ga0496111_0029383 | Ga0496111_0029383_1466_1915 | 149 |
| 786 | 3300048914 | Ga0496111_0224739 | Ga0496111_0224739_179_628 | 149 |
| 787 | 3300048914 | Ga0496111_0465298 | Ga0496111_0465298_161_610 | 149 |
| 788 | 3300048915 | Ga0496112_0066287 | Ga0496112_0066287_2707_3156 | 149 |
| 789 | 3300048916 | Ga0496113_0014345 | Ga0496113_0014345_3793_4242 | 149 |
| 790 | 3300048916 | Ga0496113_0361553 | Ga0496113_0361553_673_1122 | 149 |
| 791 | 3300048916 | Ga0496113_0368712 | Ga0496113_0368712_692_1141 | 149 |
| 792 | 3300048917 | Ga0496114_0016534 | Ga0496114_0016534_4627_5076 | 149 |
| 793 | 3300048918 | Ga0496115_0021801 | Ga0496115_0021801_1376_1825 | 149 |
| 794 | 3300048918 | Ga0496115_0042365 | Ga0496115_0042365_240_689 | 149 |
| 795 | 3300048918 | Ga0496115_0263393 | Ga0496115_0263393_206_655 | 149 |
| 796 | 3300048929 | Ga0496126_0550261 | Ga0496126_0550261_68_517 | 149 |
| 797 | 3300049569 | Ga0501032_0360168 | Ga0501032_0360168_162_677 | 149 |
| 798 | 3300049570 | Ga0501033_0208255 | Ga0501033_0208255_543_992 | 149 |
| 799 | 3300049570 | Ga0501033_0637071 | Ga0501033_0637071_260_709 | 149 |
| 800 | 3300049571 | Ga0501034_0153702 | Ga0501034_0153702_1151_1600 | 149 |
| 801 | 3300049573 | Ga0501037_0029345 | Ga0501037_0029345_3272_3787 | 149 |
| 802 | 3300049574 | Ga0501038_0113764 | Ga0501038_0113764_724_1173 | 149 |
| 803 | 3300049574 | Ga0501038_0324893 | Ga0501038_0324893_357_809 | 149 |
| 804 | 3300049575 | Ga0501039_0694907 | Ga0501039_0694907_186_638 | 149 |
| 805 | 3300049580 | Ga0501046_0456108 | Ga0501046_0456108_179_628 | 149 |
| 806 | 3300049581 | Ga0501047_0069693 | Ga0501047_0069693_2494_2943 | 149 |
| 807 | 3300049581 | Ga0501047_0465796 | Ga0501047_0465796_153_602 | 149 |
| 808 | 3300049581 | Ga0501047_0552002 | Ga0501047_0552002_112_561 | 149 |
| 809 | 3300049583 | Ga0501067_0156732 | Ga0501067_0156732_323_838 | 149 |
| 810 | 3300049584 | Ga0501068_0160356 | Ga0501068_0160356_396_848 | 149 |
| 811 | 3300049586 | Ga0501070_0084445 | Ga0501070_0084445_2137_2586 | 149 |
| 812 | 3300049586 | Ga0501070_0351222 | Ga0501070_0351222_665_1114 | 149 |
| 813 | 3300049586 | Ga0501070_1025133 | Ga0501070_1025133_136_585 | 149 |
| 814 | 3300049588 | Ga0501072_0323739 | Ga0501072_0323739_361_813 | 149 |
| 815 | 3300049589 | Ga0501073_0046085 | Ga0501073_0046085_1145_1594 | 149 |
| 816 | 3300049590 | Ga0501074_0083203 | Ga0501074_0083203_196_645 | 149 |
| 817 | 3300049590 | Ga0501074_0101568 | Ga0501074_0101568_750_1199 | 149 |
| 818 | 3300049592 | Ga0501076_0057558 | Ga0501076_0057558_389_838 | 149 |
| 819 | 3300049592 | Ga0501076_1109858 | Ga0501076_1109858_145_597 | 149 |
| 820 | 3300049741 | Ga0501079_0221647 | Ga0501079_0221647_325_840 | 149 |
| 821 | 3300049741 | Ga0501079_0300372 | Ga0501079_0300372_449_898 | 149 |
| 822 | 3300049741 | Ga0501079_0336165 | Ga0501079_0336165_273_722 | 149 |
| 823 | 3300049742 | Ga0501080_0058679 | Ga0501080_0058679_934_1383 | 149 |
| 824 | 3300049744 | Ga0501083_0079439 | Ga0501083_0079439_1152_1601 | 149 |
| 825 | 3300049823 | Ga0501044_0089132 | Ga0501044_0089132_58_507 | 149 |
| 826 | 3300049823 | Ga0501044_0093101 | Ga0501044_0093101_1915_2364 | 149 |
| 827 | 3300050490 | nmdc:mga03n38_208105_c1 | nmdc:mga03n38_208105_c1_211_660 | 149 |
| 828 | 3300050492 | nmdc:mga0yw44_1092226_c1 | nmdc:mga0yw44_1092226_c1_55_504 | 149 |
| 829 | 3300050507 | nmdc:mga05p37_133968_c1 | nmdc:mga05p37_133968_c1_470_919 | 149 |
| 830 | 3300050511 | nmdc:mga08y16_10396_c1 | nmdc:mga08y16_10396_c1_9298_9747 | 149 |
| 831 | 3300050511 | nmdc:mga08y16_60189_c1 | nmdc:mga08y16_60189_c1_46_495 | 149 |
| 832 | 3300050512 | nmdc:mga0n895_118965_c1 | nmdc:mga0n895_118965_c1_2184_2633 | 149 |
| 833 | 3300050512 | nmdc:mga0n895_191724_c1 | nmdc:mga0n895_191724_c1_1061_1510 | 149 |
| 834 | 3300050512 | nmdc:mga0n895_45193_c1 | nmdc:mga0n895_45193_c1_1523_1972 | 149 |
| 835 | 3300050512 | nmdc:mga0n895_459471_c1 | nmdc:mga0n895_459471_c1_585_1034 | 149 |
| 836 | 3300050513 | nmdc:mga0rr50_170766_c1 | nmdc:mga0rr50_170766_c1_1075_1524 | 149 |
| 837 | 3300050513 | nmdc:mga0rr50_41470_c1 | nmdc:mga0rr50_41470_c1_1423_1872 | 149 |
| 838 | 3300050514 | nmdc:mga08x19_36813_c1 | nmdc:mga08x19_36813_c1_1527_1976 | 149 |
| 839 | 3300050514 | nmdc:mga08x19_44829_c1 | nmdc:mga08x19_44829_c1_644_1093 | 149 |
| 840 | 3300053077 | Ga0495601_0007242 | Ga0495601_0007242_3572_4021 | 149 |
| 841 | 3300053078 | Ga0495612_0001030 | Ga0495612_0001030_2118_2567 | 149 |
| 842 | 3300053084 | Ga0495595_0004950 | Ga0495595_0004950_720_1169 | 149 |
| 843 | 3300053085 | Ga0495619_0070742 | Ga0495619_0070742_1850_2299 | 149 |
| 844 | 3300053088 | Ga0500644_0002792 | Ga0500644_0002792_3204_3653 | 149 |
| 845 | 3300053093 | Ga0500651_0135371 | Ga0500651_0135371_131_580 | 149 |
| 846 | 3300053098 | Ga0500650_0203447 | Ga0500650_0203447_251_700 | 149 |
| 847 | 3300053131 | Ga0500652_006245 | Ga0500652_006245_2874_3323 | 149 |
| 848 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_1761834_1762283 | 149 |
| 849 | 3300053730 | Ga0500645_000050 | Ga0500645_000050_79927_80376 | 149 |
| 850 | 3300054114 | Ga0501084_0141228 | Ga0501084_0141228_606_1055 | 149 |
| 851 | 3300054114 | Ga0501084_0260907 | Ga0501084_0260907_697_1146 | 149 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5l20-assembly1.cif.gz_A | crystal structure of a clostripain (bt_0727) from bacteroides thetaiotaomicron atcc 29148 in complex with peptide inhibitor btn-vltk-aomk | 0.7447 | 11 | 41 |
| 2ex4-assembly1.cif.gz_B | crystal structure of human methyltransferase ad-003 in complex with s-adenosyl-l-homocysteine | 0.7353 | 97 | 137 |
| 5dmq-assembly1.cif.gz_B | crystal structure of mouse erf1 in complex with reverse transcriptase (rt) of moloney murine leukemia virus | 0.7336 | 11 | 148 |
| 6kdq-assembly1.cif.gz_A | crystal structure of human nrmt1 in complex with alpha-n-monomethylated human cenp-a peptide | 0.7324 | 97 | 137 |
| 6wh8-assembly1.cif.gz_B | the structure of ntmt1 in complex with compound bm-30 | 0.7316 | 97 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q19954_249_645_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.7643 | 11 | 41 | 1.25.40.10 |
| af_Q8SX44_133_405_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.708 | 18 | 41 | 2.130.10.10 |
| af_Q57638_132_252_3.30.420.60 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;eRF1 domain 2 | 0.7045 | 11 | 145 | 3.30.420.60 |
| af_Q08226_252_415_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.697 | 13 | 41 | 2.130.10.10 |
| af_Q4DP40_365_536_3.40.50.11350 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.6948 | 83 | 128 | 3.40.50.11350 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A435LS04-F1-model_v4 | deleted | 0.9428 | 61 | 149 |
|
| AF-A0A435LS04-F1-model_v4 | deleted | 0.9325 | 61 | 149 |
|
| AF-A0A371WHU5-F1-model_v4 | Host attachment protein | 0.9241 | 2 | 147 |
|
| AF-A0A840HNC6-F1-model_v4 | Protein required for attachment to host cells | 0.924 | 65 | 146 |
|
| AF-A0A521VXU4-F1-model_v4 | Host attachment protein | 0.9205 | 1 | 149 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar