F483480

General Info

Members Datasets Scaffolds Average Seq Length
851 418 850 149

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0360168|Ga0501032_0360168_162_677
Length 171
Sequence LIQSKDPPPARAEVAAGEGETSMSGLSIRDGEWVVVCDGAKALVLQNNGDAKFPNLKTIEVFEQKDLATHEQGSDAPGRAVNSVGNMRSSVEQTDWHDQAERQFLAQLVRHLEAAVTAGKTKSLVMIAPPRALGMLRPAYSNGLRGAIRAELDKDLVKVPVHEIERRLSSH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
17 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
134 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
135 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
231 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
232 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
233 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
234 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
235 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
240 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
241 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
242 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
243 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
249 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
250 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
251 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
252 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
253 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
254 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
255 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
256 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
257 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
258 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
259 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
260 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
261 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
262 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
263 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
265 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
267 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
268 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
269 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
270 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
271 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
272 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
277 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
278 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
279 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
281 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
283 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
284 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
285 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
287 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
288 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
289 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
290 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
291 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
292 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
293 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
294 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
300 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
301 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
302 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
303 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
306 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
307 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
308 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
309 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
310 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
311 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
312 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
313 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
314 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
315 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
316 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
317 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
318 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
321 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
330 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
335 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
336 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
337 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
338 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
339 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
340 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
346 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
347 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
348 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
349 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
350 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
351 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
352 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
364 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
386 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
387 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
388 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
389 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
390 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
393 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
394 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
395 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
398 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
399 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
400 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
401 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
402 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
403 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
404 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
405 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
406 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
407 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
408 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
409 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
410 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
411 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
412 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
413 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
414 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
415 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
416 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
417 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
418 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.82
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0.12
Rhizoplane 6.7
Rhizosphere 91.07
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1716414 2162886007 Bacteria 971
2 2214739662 2209111006 Bacteria 3880
3 ARSoilYngRDRAFT_c00052 3300000042 Bacteria 18640
4 ARcpr5yngRDRAFT_c000147 3300000043 Bacteria 11218
5 ARSoilOldRDRAFT_c000002 3300000044 Bacteria 66650
6 ARCol0oldRDRAFT_c00693 3300000045 Bacteria 2922
7 ARCol0yngRDRAFT_1000005 3300000652 Bacteria 47205
8 JGI24739J22299_10173016 3300001989 Unclassified 636
9 JGI24737J22298_10000816 3300001990 Bacteria 11065
10 JGI24737J22298_10009462 3300001990 Bacteria 3238
11 JGI24738J21930_10000057 3300002075 Bacteria 23075
12 JGI24749J21850_1002009 3300002076 Bacteria 2874
13 JGI24749J21850_1007925 3300002076 Bacteria 1478
14 JGI24744J21845_10000508 3300002077 Bacteria 6926
15 JGI24033J26618_1000475 3300002155 Bacteria 3941
16 JGI24034J26672_10108639 3300002239 Unclassified 528
17 Ga0065717_1004452 3300005276 Bacteria 1035
18 Ga0065716_1002247 3300005277 Bacteria 2038
19 Ga0065704_10006448 3300005289 Bacteria 4479
20 Ga0065712_10004316 3300005290 Bacteria 3995
21 Ga0065712_10005073 3300005290 Bacteria 6697
22 Ga0065712_10362046 3300005290 Bacteria 774
23 Ga0065715_10002538 3300005293 Bacteria 13621
24 Ga0065707_10035590 3300005295 Bacteria 1479
25 Ga0070676_10003844 3300005328 Bacteria 7882
26 Ga0070676_10523261 3300005328 Bacteria 845
27 Ga0070683_100115014 3300005329 Bacteria 2539
28 Ga0070683_100231273 3300005329 Bacteria 1757
29 Ga0070683_102181136 3300005329 Unclassified 532
30 Ga0070690_100000189 3300005330 Bacteria 31730
31 Ga0070690_100001958 3300005330 Bacteria 10955
32 Ga0070690_100019725 3300005330 Bacteria 4098
33 Ga0070670_100007955 3300005331 Bacteria 9019
34 Ga0070670_101035706 3300005331 Bacteria 747
35 Ga0070677_10000347 3300005333 Bacteria 16155
36 Ga0068869_100151596 3300005334 Bacteria 1798
37 Ga0070666_10001280 3300005335 Bacteria 15216
38 Ga0070666_10016467 3300005335 Bacteria 4729
39 Ga0070666_10914347 3300005335 Bacteria 649
40 Ga0070680_100003903 3300005336 Bacteria 11153
41 Ga0070680_100011404 3300005336 Bacteria 6874
42 Ga0070680_100013996 3300005336 Bacteria 6262
43 Ga0070680_100255672 3300005336 Bacteria 1482
44 Ga0070680_100999539 3300005336 Bacteria 722
45 Ga0070682_100006959 3300005337 Bacteria 6359
46 Ga0070682_100027997 3300005337 Bacteria 3386
47 Ga0070682_100076704 3300005337 Bacteria 2152
48 Ga0070682_100398681 3300005337 Bacteria 1040
49 Ga0068868_100002148 3300005338 Bacteria 13618
50 Ga0068868_100016286 3300005338 Bacteria 5517
51 Ga0070660_100001222 3300005339 Bacteria 17467
52 Ga0070660_100039588 3300005339 Bacteria 3584
53 Ga0070660_100094640 3300005339 Bacteria 2360
54 Ga0070660_100136966 3300005339 Bacteria 1962
55 Ga0070689_100000770 3300005340 Bacteria 19626
56 Ga0070689_100151653 3300005340 Bacteria 1869
57 Ga0070691_10088289 3300005341 Bacteria 1526
58 Ga0070687_100177140 3300005343 Bacteria 1274
59 Ga0070687_101035558 3300005343 Bacteria 597
60 Ga0070661_100038917 3300005344 Bacteria 3463
61 Ga0070661_100123073 3300005344 Bacteria 1944
62 Ga0070661_100201492 3300005344 Bacteria 1521
63 Ga0070692_10096422 3300005345 Bacteria 1615
64 Ga0070692_10441395 3300005345 Bacteria 831
65 Ga0070692_10554337 3300005345 Bacteria 753
66 Ga0070668_100007912 3300005347 Bacteria 7894
67 Ga0070668_100123434 3300005347 Bacteria 2072
68 Ga0070669_100010601 3300005353 Bacteria 6545
69 Ga0070669_100198749 3300005353 Bacteria 1576
70 Ga0070669_100384038 3300005353 Bacteria 1146
71 Ga0070669_100848098 3300005353 Unclassified 778
72 Ga0070675_100085017 3300005354 Bacteria 2642
73 Ga0070675_100663032 3300005354 Bacteria 949
74 Ga0070671_100001430 3300005355 Bacteria 17817
75 Ga0070671_100009186 3300005355 Bacteria 7937
76 Ga0070671_100073817 3300005355 Bacteria 2849
77 Ga0070674_100002774 3300005356 Bacteria 9679
78 Ga0070674_100039157 3300005356 Bacteria 3200
79 Ga0070674_101119679 3300005356 Bacteria 696
80 Ga0070673_100000351 3300005364 Bacteria 24222
81 Ga0070673_100004787 3300005364 Bacteria 8598
82 Ga0070673_100098213 3300005364 Bacteria 2406
83 Ga0070673_100837112 3300005364 Bacteria 851
84 Ga0070688_100000636 3300005365 Bacteria 17462
85 Ga0070688_100007216 3300005365 Bacteria 5985
86 Ga0070688_101175369 3300005365 Bacteria 616
87 Ga0070659_100043241 3300005366 Bacteria 3523
88 Ga0070659_100049436 3300005366 Bacteria 3306
89 Ga0070659_100577846 3300005366 Bacteria 964
90 Ga0070667_100013160 3300005367 Bacteria 6838
91 Ga0070667_100039413 3300005367 Bacteria 3960
92 Ga0070667_100394027 3300005367 Bacteria 1259
93 Ga0070667_101171335 3300005367 Bacteria 719
94 Ga0070703_10002228 3300005406 Bacteria 5634
95 Ga0070703_10044342 3300005406 Bacteria 1398
96 Ga0070709_10001206 3300005434 Bacteria 14200
97 Ga0070709_10068063 3300005434 Bacteria 2288
98 Ga0070709_10250470 3300005434 Bacteria 1276
99 Ga0070714_100004005 3300005435 Bacteria 11079
100 Ga0070714_100018072 3300005435 Bacteria 5719
101 Ga0070714_100069015 3300005435 Bacteria 3051
102 Ga0070714_100240283 3300005435 Bacteria 1671
103 Ga0070713_100000423 3300005436 Bacteria 26996
104 Ga0070713_100268406 3300005436 Bacteria 1562
105 Ga0070710_10001578 3300005437 Bacteria 10754
106 Ga0070710_10040870 3300005437 Bacteria 2557
107 Ga0070701_10045191 3300005438 Bacteria 2259
108 Ga0070711_100130902 3300005439 Bacteria 1868
109 Ga0070711_100145182 3300005439 Bacteria 1783
110 Ga0070705_100007839 3300005440 Bacteria 5273
111 Ga0070705_100090751 3300005440 Bacteria 1903
112 Ga0070700_100043624 3300005441 Bacteria 2759
113 Ga0070700_100777762 3300005441 Bacteria 769
114 Ga0070694_100000666 3300005444 Bacteria 18998
115 Ga0070694_100499852 3300005444 Bacteria 967
116 Ga0070708_100292667 3300005445 Bacteria 1533
117 Ga0070663_100008450 3300005455 Bacteria 6335
118 Ga0070663_100026749 3300005455 Bacteria 3910
119 Ga0070663_100137705 3300005455 Bacteria 1860
120 Ga0070678_100006139 3300005456 Bacteria 7017
121 Ga0070678_100019629 3300005456 Bacteria 4414
122 Ga0070662_100008526 3300005457 Bacteria 6687
123 Ga0070662_100206098 3300005457 Bacteria 1562
124 Ga0070662_100429756 3300005457 Bacteria 1094
125 Ga0070662_100835833 3300005457 Bacteria 784
126 Ga0070681_10001541 3300005458 Bacteria 20414
127 Ga0070681_10046591 3300005458 Bacteria 4334
128 Ga0070681_10057034 3300005458 Bacteria 3886
129 Ga0070681_10096426 3300005458 Bacteria 2905
130 Ga0070681_10351881 3300005458 Bacteria 1383
131 Ga0070681_10633913 3300005458 Bacteria 984
132 Ga0068867_100167242 3300005459 Bacteria 1739
133 Ga0070685_10008742 3300005466 Bacteria 5213
134 Ga0070685_10050286 3300005466 Bacteria 2407
135 Ga0070698_100679973 3300005471 Bacteria 971
136 Ga0074259_10781806 3300005507 Bacteria 886
137 Ga0070679_100001345 3300005530 Bacteria 21702
138 Ga0070679_100048353 3300005530 Bacteria 4238
139 Ga0070679_100141844 3300005530 Bacteria 2381
140 Ga0070679_100299601 3300005530 Bacteria 1558
141 Ga0070679_100548721 3300005530 Bacteria 1099
142 Ga0070684_100032724 3300005535 Bacteria 4434
143 Ga0070684_100167000 3300005535 Bacteria 1998
144 Ga0070684_100206406 3300005535 Bacteria 1790
145 Ga0070697_100261566 3300005536 Bacteria 1482
146 Ga0068853_100075401 3300005539 Bacteria 2943
147 Ga0068853_100207259 3300005539 Bacteria 1786
148 Ga0068853_100629183 3300005539 Bacteria 1020
149 Ga0068853_102002678 3300005539 Bacteria 562
150 Ga0070672_100001305 3300005543 Bacteria 15369
151 Ga0070686_100000591 3300005544 Bacteria 21432
152 Ga0070686_100050224 3300005544 Bacteria 2650
153 Ga0070686_100212769 3300005544 Bacteria 1393
154 Ga0070686_100454436 3300005544 Bacteria 985
155 Ga0070686_100742351 3300005544 Bacteria 787
156 Ga0070695_100096527 3300005545 Bacteria 1983
157 Ga0070695_100535454 3300005545 Bacteria 911
158 Ga0070696_100010728 3300005546 Bacteria 6137
159 Ga0070696_100016768 3300005546 Bacteria 4941
160 Ga0070696_100038234 3300005546 Bacteria 3312
161 Ga0070696_100251405 3300005546 Bacteria 1337
162 Ga0070696_100601358 3300005546 Bacteria 887
163 Ga0070693_100023452 3300005547 Bacteria 3298
164 Ga0070693_100045206 3300005547 Bacteria 2495
165 Ga0070693_100615154 3300005547 Bacteria 786
166 Ga0070665_100062458 3300005548 Bacteria 3735
167 Ga0070704_100014344 3300005549 Bacteria 4948
168 Ga0070704_100042161 3300005549 Bacteria 3155
169 Ga0068855_100021052 3300005563 Bacteria 7819
170 Ga0068855_100088149 3300005563 Bacteria 3585
171 Ga0068855_100172797 3300005563 Bacteria 2446
172 Ga0070664_100008474 3300005564 Bacteria 8313
173 Ga0070664_100064979 3300005564 Bacteria 3112
174 Ga0070664_100142275 3300005564 Bacteria 2113
175 Ga0070664_100241482 3300005564 Bacteria 1622
176 Ga0068857_100001568 3300005577 Bacteria 18308
177 Ga0068857_100126454 3300005577 Bacteria 2303
178 Ga0068857_100205500 3300005577 Bacteria 1796
179 Ga0068857_100629530 3300005577 Bacteria 1015
180 Ga0068854_100069724 3300005578 Bacteria 2568
181 Ga0068854_100482664 3300005578 Bacteria 1041
182 Ga0068856_100088582 3300005614 Bacteria 3077
183 Ga0068856_100266215 3300005614 Bacteria 1730
184 Ga0068856_100730214 3300005614 Bacteria 1011
185 Ga0068856_100823218 3300005614 Bacteria 948
186 Ga0070702_100001523 3300005615 Bacteria 9534
187 Ga0070702_100036733 3300005615 Bacteria 2716
188 Ga0068852_100292209 3300005616 Bacteria 1575
189 Ga0068852_100349217 3300005616 Bacteria 1444
190 Ga0068852_100378176 3300005616 Bacteria 1389
191 Ga0068852_100423443 3300005616 Bacteria 1314
192 Ga0068859_100004726 3300005617 Bacteria 13834
193 Ga0068859_100068342 3300005617 Bacteria 3587
194 Ga0068859_100069668 3300005617 Bacteria 3552
195 Ga0068859_100093053 3300005617 Bacteria 3066
196 Ga0068859_100206429 3300005617 Bacteria 2050
197 Ga0068864_100072258 3300005618 Bacteria 3006
198 Ga0068864_100841063 3300005618 Bacteria 904
199 Ga0068866_10392245 3300005718 Bacteria 893
200 Ga0068861_100338496 3300005719 Bacteria 1316
201 Ga0068861_100374788 3300005719 Bacteria 1255
202 Ga0068851_10282260 3300005834 Bacteria 950
203 Ga0068870_10000107 3300005840 Bacteria 28449
204 Ga0068870_10723322 3300005840 Bacteria 689
205 Ga0068863_100252417 3300005841 Bacteria 1704
206 Ga0068863_100542679 3300005841 Bacteria 1147
207 Ga0068863_100759791 3300005841 Bacteria 965
208 Ga0068858_100036809 3300005842 Bacteria 4537
209 Ga0068858_100342234 3300005842 Bacteria 1431
210 Ga0068858_100501436 3300005842 Bacteria 1173
211 Ga0068858_100637002 3300005842 Bacteria 1035
212 Ga0068860_100070594 3300005843 Bacteria 3321
213 Ga0068860_100629226 3300005843 Bacteria 1080
214 Ga0068862_100046532 3300005844 Bacteria 3701
215 Ga0068862_100917966 3300005844 Bacteria 862
216 Ga0081455_10000012 3300005937 Bacteria 201668
217 Ga0081455_10209824 3300005937 Bacteria 1452
218 Ga0081455_10263464 3300005937 Bacteria 1254
219 Ga0081538_10047724 3300005981 Bacteria 2622
220 Ga0081540_1087819 3300005983 Bacteria 1376
221 Ga0081539_10034315 3300005985 Bacteria 3071
222 Ga0075365_11338890 3300006038 Unclassified 503
223 Ga0075363_100325266 3300006048 Bacteria 895
224 Ga0075363_100583256 3300006048 Unclassified 669
225 Ga0075432_10048392 3300006058 Bacteria 1496
226 Ga0075432_10160795 3300006058 Bacteria 868
227 Ga0070715_10011106 3300006163 Bacteria 3233
228 Ga0070716_100001630 3300006173 Bacteria 10116
229 Ga0070716_100056841 3300006173 Bacteria 2246
230 Ga0070716_100297130 3300006173 Bacteria 1122
231 Ga0070712_100030464 3300006175 Bacteria 3625
232 Ga0070712_100072724 3300006175 Bacteria 2463
233 Ga0070712_100110739 3300006175 Bacteria 2048
234 Ga0075367_10164761 3300006178 Bacteria 1379
235 Ga0075366_10664020 3300006195 Bacteria 647
236 Ga0097621_100006955 3300006237 Bacteria 8054
237 Ga0068871_100003093 3300006358 Bacteria 11417
238 Ga0068871_100059420 3300006358 Bacteria 3115
239 Ga0075428_100075386 3300006844 Bacteria 3684
240 Ga0075430_100137691 3300006846 Bacteria 2033
241 Ga0075431_100509572 3300006847 Bacteria 1193
242 Ga0075431_100610157 3300006847 Unclassified 1074
243 Ga0075434_100102527 3300006871 Bacteria 2869
244 Ga0075434_100104971 3300006871 Bacteria 2835
245 Ga0075434_100162917 3300006871 Bacteria 2250
246 Ga0075434_100494155 3300006871 Bacteria 1244
247 Ga0075434_101017745 3300006871 Unclassified 842
248 Ga0075429_100476984 3300006880 Bacteria 1093
249 Ga0075429_101298219 3300006880 Bacteria 635
250 Ga0068865_100044238 3300006881 Bacteria 3047
251 Ga0068865_100056639 3300006881 Bacteria 2732
252 Ga0075436_100075687 3300006914 Bacteria 2330
253 Ga0097620_100004726 3300006931 Bacteria 13834
254 Ga0097620_100068342 3300006931 Bacteria 3587
255 Ga0097620_100069664 3300006931 Bacteria 3552
256 Ga0097620_100093045 3300006931 Bacteria 3066
257 Ga0097620_100206441 3300006931 Bacteria 2050
258 Ga0075435_100064065 3300007076 Bacteria 2986
259 Ga0105251_10019357 3300009011 Bacteria 3599
260 Ga0105251_10405144 3300009011 Bacteria 627
261 Ga0105250_10086841 3300009092 Bacteria 1270
262 Ga0105250_10257303 3300009092 Bacteria 747
263 Ga0105240_10029646 3300009093 Bacteria 7123
264 Ga0105240_10401726 3300009093 Bacteria 1543
265 Ga0105240_10516840 3300009093 Bacteria 1326
266 Ga0111539_10001217 3300009094 Bacteria 34255
267 Ga0111539_10015411 3300009094 Bacteria 9511
268 Ga0111539_10617522 3300009094 Bacteria 1262
269 Ga0105245_10161057 3300009098 Bacteria 2129
270 Ga0105245_10586372 3300009098 Bacteria 1140
271 Ga0105245_12115198 3300009098 Bacteria 617
272 Ga0105247_10001754 3300009101 Bacteria 15273
273 Ga0105247_10019797 3300009101 Bacteria 4042
274 Ga0105247_10028913 3300009101 Bacteria 3355
275 Ga0105247_10430530 3300009101 Bacteria 947
276 Ga0114129_10038658 3300009147 Bacteria 6729
277 Ga0105243_10029408 3300009148 Bacteria 4225
278 Ga0105243_10048043 3300009148 Bacteria 3363
279 Ga0105243_11238678 3300009148 Bacteria 761
280 Ga0105241_10000891 3300009174 Bacteria 22534
281 Ga0105241_10011615 3300009174 Bacteria 6458
282 Ga0105241_11171438 3300009174 Bacteria 727
283 Ga0105242_10007190 3300009176 Bacteria 8587
284 Ga0105242_10167123 3300009176 Bacteria 1931
285 Ga0105248_10000638 3300009177 Bacteria 39824
286 Ga0105248_10007450 3300009177 Bacteria 12008
287 Ga0105248_10683596 3300009177 Bacteria 1158
288 Ga0105248_10916262 3300009177 Bacteria 990
289 Ga0105237_10347842 3300009545 Bacteria 1487
290 Ga0105237_11729627 3300009545 Bacteria 633
291 Ga0105238_10014196 3300009551 Bacteria 8057
292 Ga0105238_10028944 3300009551 Bacteria 5642
293 Ga0105249_10020932 3300009553 Bacteria 5850
294 Ga0105249_10564442 3300009553 Bacteria 1190
295 Ga0105249_10573051 3300009553 Bacteria 1181
296 Ga0105249_10797724 3300009553 Bacteria 1008
297 Ga0105249_10919413 3300009553 Bacteria 942
298 Ga0105249_11812988 3300009553 Bacteria 683
299 Ga0105239_10005135 3300010375 Bacteria 15458
300 Ga0105239_10082950 3300010375 Bacteria 3530
301 Ga0105239_10510512 3300010375 Bacteria 1367
302 Ga0105246_10076578 3300011119 Bacteria 2371
303 Ga0105246_10816343 3300011119 Bacteria 829
304 Ga0157347_1009871 3300012502 Bacteria 994
305 Ga0157313_1002708 3300012503 Bacteria 1085
306 Ga0157326_1003964 3300012513 Bacteria 1555
307 Ga0157373_10024655 3300013100 Bacteria 4357
308 Ga0157373_10449663 3300013100 Bacteria 927
309 Ga0157373_10487985 3300013100 Bacteria 889
310 Ga0157371_10159389 3300013102 Bacteria 1611
311 Ga0157371_10340723 3300013102 Bacteria 1090
312 Ga0157370_10491474 3300013104 Bacteria 1127
313 Ga0157369_11070952 3300013105 Bacteria 824
314 Ga0157374_10138179 3300013296 Bacteria 2363
315 Ga0157374_10207106 3300013296 Bacteria 1922
316 Ga0157374_10509864 3300013296 Bacteria 1208
317 Ga0157374_12792937 3300013296 Bacteria 516
318 Ga0157378_10006939 3300013297 Bacteria 9883
319 Ga0157378_10213432 3300013297 Bacteria 1831
320 Ga0163162_10047751 3300013306 Bacteria 4289
321 Ga0163162_10094840 3300013306 Bacteria 3070
322 Ga0157372_10531262 3300013307 Bacteria 1371
323 Ga0157372_11337572 3300013307 Bacteria 826
324 Ga0157372_12404903 3300013307 Bacteria 605
325 Ga0157375_10002695 3300013308 Bacteria 15380
326 Ga0157375_10165195 3300013308 Bacteria 2358
327 Ga0157375_10299559 3300013308 Bacteria 1771
328 Ga0157375_10846755 3300013308 Bacteria 1061
329 Ga0157375_11148205 3300013308 Bacteria 910
330 Ga0163163_10023833 3300014325 Bacteria 5816
331 Ga0163163_10046102 3300014325 Bacteria 4281
332 Ga0163163_10109870 3300014325 Bacteria 2785
333 Ga0163163_10221990 3300014325 Bacteria 1939
334 Ga0163163_10431856 3300014325 Bacteria 1376
335 Ga0157380_10004026 3300014326 Bacteria 10148
336 Ga0157380_10387959 3300014326 Bacteria 1320
337 Ga0157380_10719105 3300014326 Bacteria 1006
338 Ga0157380_12024386 3300014326 Bacteria 638
339 Ga0157380_12570285 3300014326 Bacteria 575
340 Ga0157379_10103256 3300014968 Bacteria 2558
341 Ga0157379_10240775 3300014968 Bacteria 1641
342 Ga0157376_10720596 3300014969 Bacteria 1004
343 Ga0157376_11034001 3300014969 Bacteria 845
344 Ga0163161_10001790 3300017792 Bacteria 15682
345 Ga0163161_10082933 3300017792 Bacteria 2363
346 Ga0197907_10525614 3300020069 Bacteria 1125
347 Ga0206356_10463979 3300020070 Bacteria 1694
348 Ga0206356_10908987 3300020070 Bacteria 1464
349 Ga0206352_10919806 3300020078 Unclassified 577
350 Ga0206353_11507390 3300020082 Bacteria 1725
351 Ga0154015_1421512 3300020610 Bacteria 596
352 Ga0224712_10627127 3300022467 Bacteria 526
353 Ga0207666_1001296 3300025271 Bacteria 2941
354 Ga0207673_1000114 3300025290 Bacteria 7463
355 Ga0207697_10000913 3300025315 Bacteria 16698
356 Ga0207697_10026179 3300025315 Bacteria 2386
357 Ga0207653_10041083 3300025885 Bacteria 1518
358 Ga0207682_10000107 3300025893 Bacteria 37788
359 Ga0207692_10001671 3300025898 Bacteria 8383
360 Ga0207642_10748833 3300025899 Unclassified 618
361 Ga0207710_10003883 3300025900 Bacteria 6609
362 Ga0207710_10061124 3300025900 Bacteria 1709
363 Ga0207688_10016191 3300025901 Bacteria 4042
364 Ga0207688_10051981 3300025901 Bacteria 2295
365 Ga0207688_10062206 3300025901 Bacteria 2104
366 Ga0207688_10380834 3300025901 Bacteria 873
367 Ga0207680_10004687 3300025903 Bacteria 6497
368 Ga0207680_10166488 3300025903 Bacteria 1482
369 Ga0207647_10010513 3300025904 Bacteria 6535
370 Ga0207647_10017796 3300025904 Bacteria 4822
371 Ga0207685_10001449 3300025905 Bacteria 4976
372 Ga0207699_10002364 3300025906 Bacteria 8905
373 Ga0207699_10056461 3300025906 Bacteria 2340
374 Ga0207699_10086923 3300025906 Bacteria 1954
375 Ga0207645_10000655 3300025907 Bacteria 28729
376 Ga0207643_10092580 3300025908 Bacteria 1764
377 Ga0207705_10009573 3300025909 Bacteria 7048
378 Ga0207654_10004317 3300025911 Bacteria 7166
379 Ga0207654_10009569 3300025911 Bacteria 4926
380 Ga0207707_10007710 3300025912 Bacteria 9376
381 Ga0207707_10024331 3300025912 Bacteria 5300
382 Ga0207707_10260577 3300025912 Bacteria 1505
383 Ga0207695_10437877 3300025913 Bacteria 1191
384 Ga0207695_10690028 3300025913 Bacteria 902
385 Ga0207671_10535604 3300025914 Bacteria 934
386 Ga0207671_10998033 3300025914 Bacteria 660
387 Ga0207693_10001389 3300025915 Bacteria 21464
388 Ga0207693_10003329 3300025915 Bacteria 13753
389 Ga0207693_10013980 3300025915 Bacteria 6464
390 Ga0207660_10061167 3300025917 Bacteria 2710
391 Ga0207660_10127706 3300025917 Bacteria 1932
392 Ga0207660_10294823 3300025917 Bacteria 1290
393 Ga0207660_10759623 3300025917 Bacteria 791
394 Ga0207662_10000219 3300025918 Bacteria 26640
395 Ga0207662_10048474 3300025918 Bacteria 2516
396 Ga0207657_10003532 3300025919 Bacteria 16698
397 Ga0207657_10012089 3300025919 Bacteria 8532
398 Ga0207649_10120601 3300025920 Bacteria 1767
399 Ga0207649_10142448 3300025920 Bacteria 1642
400 Ga0207649_10885866 3300025920 Bacteria 699
401 Ga0207652_10031841 3300025921 Bacteria 4429
402 Ga0207652_10039661 3300025921 Bacteria 3997
403 Ga0207652_10042562 3300025921 Bacteria 3866
404 Ga0207652_10066697 3300025921 Bacteria 3119
405 Ga0207681_10391696 3300025923 Bacteria 1120
406 Ga0207694_10038022 3300025924 Bacteria 3700
407 Ga0207694_10147335 3300025924 Bacteria 1895
408 Ga0207694_10421731 3300025924 Bacteria 1111
409 Ga0207650_10009061 3300025925 Bacteria 6802
410 Ga0207650_10128693 3300025925 Bacteria 1979
411 Ga0207650_11253838 3300025925 Bacteria 631
412 Ga0207659_10060672 3300025926 Bacteria 2723
413 Ga0207659_10183322 3300025926 Bacteria 1660
414 Ga0207659_10263314 3300025926 Bacteria 1403
415 Ga0207700_10523543 3300025928 Bacteria 1051
416 Ga0207664_10080162 3300025929 Bacteria 2653
417 Ga0207664_10103821 3300025929 Bacteria 2352
418 Ga0207664_10107277 3300025929 Bacteria 2317
419 Ga0207664_10193151 3300025929 Bacteria 1753
420 Ga0207664_11000693 3300025929 Bacteria 749
421 Ga0207644_10007296 3300025931 Bacteria 7195
422 Ga0207644_10010415 3300025931 Bacteria 6126
423 Ga0207644_10075013 3300025931 Bacteria 2484
424 Ga0207690_10009361 3300025932 Bacteria 5818
425 Ga0207690_10012020 3300025932 Bacteria 5177
426 Ga0207706_10054580 3300025933 Bacteria 3526
427 Ga0207706_10233409 3300025933 Bacteria 1609
428 Ga0207686_10005571 3300025934 Bacteria 6749
429 Ga0207686_10063062 3300025934 Bacteria 2355
430 Ga0207709_10003899 3300025935 Bacteria 8713
431 Ga0207709_10004724 3300025935 Bacteria 7824
432 Ga0207709_10045569 3300025935 Bacteria 2657
433 Ga0207709_10376686 3300025935 Bacteria 1079
434 Ga0207670_10016730 3300025936 Bacteria 4415
435 Ga0207670_10030395 3300025936 Bacteria 3451
436 Ga0207670_10061276 3300025936 Bacteria 2567
437 Ga0207670_10080900 3300025936 Bacteria 2272
438 Ga0207669_10009055 3300025937 Bacteria 4716
439 Ga0207669_10095007 3300025937 Bacteria 1953
440 Ga0207704_10130064 3300025938 Bacteria 1742
441 Ga0207665_10000662 3300025939 Bacteria 23233
442 Ga0207665_10124378 3300025939 Bacteria 1825
443 Ga0207665_11136284 3300025939 Bacteria 623
444 Ga0207691_10000885 3300025940 Bacteria 29733
445 Ga0207691_10138288 3300025940 Bacteria 2147
446 Ga0207691_10838861 3300025940 Bacteria 771
447 Ga0207711_10018008 3300025941 Bacteria 5871
448 Ga0207711_10556309 3300025941 Bacteria 1070
449 Ga0207711_10827766 3300025941 Bacteria 862
450 Ga0207689_10000348 3300025942 Bacteria 43237
451 Ga0207689_10089316 3300025942 Bacteria 2531
452 Ga0207689_10531413 3300025942 Bacteria 987
453 Ga0207661_10002293 3300025944 Bacteria 13172
454 Ga0207661_10032802 3300025944 Bacteria 4027
455 Ga0207661_10943997 3300025944 Bacteria 794
456 Ga0207679_10041801 3300025945 Bacteria 3290
457 Ga0207679_10044842 3300025945 Bacteria 3194
458 Ga0207679_11214277 3300025945 Bacteria 692
459 Ga0207667_10040369 3300025949 Bacteria 4969
460 Ga0207667_10052119 3300025949 Bacteria 4312
461 Ga0207667_10273612 3300025949 Bacteria 1726
462 Ga0207667_10784498 3300025949 Bacteria 950
463 Ga0207651_10053757 3300025960 Bacteria 2755
464 Ga0207651_10952117 3300025960 Bacteria 766
465 Ga0207712_10004014 3300025961 Bacteria 9292
466 Ga0207712_10384456 3300025961 Bacteria 1176
467 Ga0207712_10733033 3300025961 Bacteria 865
468 Ga0207712_10902748 3300025961 Bacteria 781
469 Ga0207668_10001277 3300025972 Bacteria 15017
470 Ga0207668_10176389 3300025972 Bacteria 1681
471 Ga0207640_10162280 3300025981 Bacteria 1655
472 Ga0207640_10849767 3300025981 Bacteria 794
473 Ga0207640_11650068 3300025981 Unclassified 578
474 Ga0207658_10043628 3300025986 Bacteria 3261
475 Ga0207658_10189798 3300025986 Bacteria 1707
476 Ga0207658_10533896 3300025986 Bacteria 1048
477 Ga0207677_10045838 3300026023 Bacteria 2922
478 Ga0207677_10400172 3300026023 Bacteria 1164
479 Ga0207703_10018706 3300026035 Bacteria 5411
480 Ga0207703_10092663 3300026035 Bacteria 2543
481 Ga0207703_10257683 3300026035 Bacteria 1575
482 Ga0207703_10345530 3300026035 Bacteria 1368
483 Ga0207703_10576085 3300026035 Bacteria 1063
484 Ga0207639_10100632 3300026041 Bacteria 2335
485 Ga0207639_10128412 3300026041 Bacteria 2095
486 Ga0207678_10024974 3300026067 Bacteria 5219
487 Ga0207678_10034392 3300026067 Bacteria 4414
488 Ga0207678_10035096 3300026067 Bacteria 4367
489 Ga0207678_11367442 3300026067 Bacteria 626
490 Ga0207708_10194787 3300026075 Bacteria 1615
491 Ga0207708_10296003 3300026075 Bacteria 1315
492 Ga0207702_10134036 3300026078 Bacteria 2233
493 Ga0207641_10013404 3300026088 Bacteria 6721
494 Ga0207641_10124651 3300026088 Bacteria 2305
495 Ga0207641_10865871 3300026088 Bacteria 896
496 Ga0207641_11315153 3300026088 Unclassified 723
497 Ga0207641_11671590 3300026088 Bacteria 639
498 Ga0207648_10090007 3300026089 Bacteria 2681
499 Ga0207648_10246217 3300026089 Bacteria 1593
500 Ga0207648_10432290 3300026089 Bacteria 1197
501 Ga0207676_10042485 3300026095 Bacteria 3497
502 Ga0207676_10064325 3300026095 Bacteria 2916
503 Ga0207676_10083304 3300026095 Bacteria 2604
504 Ga0207674_10001762 3300026116 Bacteria 27674
505 Ga0207674_10148315 3300026116 Bacteria 2303
506 Ga0207674_10293334 3300026116 Bacteria 1575
507 Ga0207675_100181619 3300026118 Bacteria 2015
508 Ga0207675_100966369 3300026118 Bacteria 869
509 Ga0207683_10000069 3300026121 Bacteria 78741
510 Ga0207683_10001587 3300026121 Bacteria 20510
511 Ga0207683_10161969 3300026121 Bacteria 2023
512 Ga0207698_10211693 3300026142 Bacteria 1745
513 Ga0207698_10212792 3300026142 Bacteria 1740
514 Ga0207698_10515015 3300026142 Bacteria 1166
515 Ga0207698_10820285 3300026142 Bacteria 934
516 Ga0207698_11609613 3300026142 Bacteria 665
517 Ga0210000_1068497 3300027462 Unclassified 578
518 Ga0209968_1049546 3300027526 Bacteria 728
519 Ga0210002_1002533 3300027617 Bacteria 2642
520 Ga0209998_10000492 3300027717 Bacteria 10876
521 Ga0209974_10013544 3300027876 Bacteria 2716
522 Ga0209974_10016533 3300027876 Bacteria 2450
523 Ga0207428_10000987 3300027907 Bacteria 31506
524 Ga0207428_10041754 3300027907 Bacteria 3712
525 Ga0207428_10146905 3300027907 Bacteria 1796
526 Ga0268266_10016263 3300028379 Bacteria 6358
527 Ga0268265_10058799 3300028380 Bacteria 2937
528 Ga0268265_11180630 3300028380 Bacteria 762
529 Ga0268264_10105628 3300028381 Bacteria 2457
530 Ga0268264_10495460 3300028381 Bacteria 1191
531 Ga0265338_10018308 3300028800 Bacteria 7503
532 Ga0265338_10116264 3300028800 Bacteria 2143
533 Ga0265338_10220772 3300028800 Bacteria 1416
534 Ga0265330_10002724 3300031235 Bacteria 9531
535 Ga0265332_10035583 3300031238 Bacteria 2162
536 Ga0265332_10056639 3300031238 Bacteria 1680
537 Ga0265332_10360111 3300031238 Unclassified 600
538 Ga0265325_10034748 3300031241 Bacteria 2680
539 Ga0265325_10052210 3300031241 Bacteria 2099
540 Ga0265325_10135664 3300031241 Bacteria 1174
541 Ga0265325_10216973 3300031241 Bacteria 877
542 Ga0265340_10025044 3300031247 Bacteria 3025
543 Ga0265340_10119635 3300031247 Bacteria 1212
544 Ga0265340_10482528 3300031247 Bacteria 546
545 Ga0265339_10013022 3300031249 Bacteria 5056
546 Ga0265339_10097306 3300031249 Bacteria 1535
547 Ga0265339_10318729 3300031249 Bacteria 738
548 Ga0265331_10034942 3300031250 Bacteria 2476
549 Ga0265316_10314627 3300031344 Bacteria 1138
550 Ga0265316_10640424 3300031344 Bacteria 752
551 Ga0307408_100160592 3300031548 Bacteria 1785
552 Ga0307408_102241823 3300031548 Bacteria 528
553 Ga0265313_10010158 3300031595 Bacteria 6007
554 Ga0265313_10107772 3300031595 Bacteria 1228
555 Ga0265313_10127542 3300031595 Bacteria 1105
556 Ga0316579_10107784 3300031691 Bacteria 1336
557 Ga0265314_10007553 3300031711 Bacteria 9420
558 Ga0265342_10002003 3300031712 Bacteria 18142
559 Ga0316578_10324386 3300031728 Bacteria 919
560 Ga0307406_10638637 3300031901 Bacteria 882
561 Ga0307409_102767534 3300031995 Bacteria 518
562 Ga0307416_101958657 3300032002 Bacteria 689
563 Ga0307415_101989201 3300032126 Bacteria 566
564 Ga0373930_0005010 3300034816 Bacteria 2182
565 Ga0373930_0008947 3300034816 Bacteria 1762
566 Ga0373930_0018724 3300034816 Bacteria 1335
567 Ga0373948_0002605 3300034817 Bacteria 2684
568 Ga0373948_0051812 3300034817 Bacteria 884
569 Ga0373950_0002519 3300034818 Bacteria 2526
570 Ga0373958_0008133 3300034819 Bacteria 1691
571 Ga0373959_0008341 3300034820 Bacteria 1761
572 Ga0373959_0118661 3300034820 Bacteria 645
573 Ga0373938_0000058 3300034957 Bacteria 14244
574 Ga0373926_0000688 3300035083 Bacteria 9315
575 Ga0373928_0000183 3300035084 Bacteria 12018
576 Ga0373928_0005826 3300035084 Bacteria 2356
577 Ga0373929_0000526 3300035085 Bacteria 7371
578 Ga0373934_0267719 3300035086 Unclassified 707
579 Ga0373940_0000164 3300035088 Bacteria 8813
580 Ga0373940_0016371 3300035088 Bacteria 1836
581 Ga0373940_0204597 3300035088 Bacteria 650
582 Ga0373944_0006754 3300035089 Bacteria 3054
583 Ga0373949_0002161 3300035090 Bacteria 5152
584 Ga0373949_0006499 3300035090 Bacteria 2570
585 Ga0373951_0000370 3300035091 Bacteria 13559
586 Ga0373951_0007650 3300035091 Bacteria 2453
587 Ga0373951_0013394 3300035091 Bacteria 1844
588 Ga0373952_0000467 3300035092 Bacteria 7046
589 Ga0373952_0063454 3300035092 Bacteria 909
590 Ga0373923_0000524 3300035111 Bacteria 9311
591 Ga0373932_0000811 3300035112 Bacteria 9244
592 Ga0373932_0005150 3300035112 Bacteria 3072
593 Ga0373936_0000524 3300035113 Bacteria 13102
594 Ga0373939_0002469 3300035114 Bacteria 4361
595 Ga0373941_0000450 3300035115 Bacteria 8192
596 Ga0373945_0001431 3300035116 Bacteria 7266
597 Ga0373953_0225502 3300035117 Unclassified 812
598 Ga0373954_0003182 3300035118 Bacteria 6940
599 Ga0373956_0134067 3300035119 Unclassified 1161
600 Ga0373960_0001125 3300035121 Bacteria 5777
601 Ga0373960_0001389 3300035121 Bacteria 5352
602 Ga0373943_0013004 3300035170 Bacteria 3754
603 Ga0373946_0002069 3300035171 Bacteria 7042
604 Ga0373955_0003523 3300035172 Bacteria 6886
605 Ga0373942_0000555 3300035207 Bacteria 10498
606 Ga0373961_0000817 3300035241 Bacteria 10586
607 Ga0373962_0000563 3300035242 Bacteria 8378
608 Ga0373962_0000865 3300035242 Bacteria 6903
609 Ga0373924_0017036 3300035410 Bacteria 2782
610 Ga0373931_0013723 3300035691 Bacteria 3950
611 Ga0373931_0015869 3300035691 Bacteria 3699
612 Ga0373931_0022095 3300035691 Bacteria 3198
613 Ga0373935_0019128 3300035692 Bacteria 4176
614 Ga0373927_0011605 3300035695 Bacteria 5867
615 Ga0373927_0022146 3300035695 Bacteria 4164
616 Ga0373927_0143975 3300035695 Bacteria 1560
617 Ga0373933_0263497 3300035724 Unclassified 1111
618 Ga0373947_0033285 3300035725 Bacteria 3041
619 Ga0373947_0080266 3300035725 Unclassified 2018
620 Ga0373947_0157689 3300035725 Bacteria 1466
621 Ga0373947_1204959 3300035725 Bacteria 516
622 Ga0373937_0026181 3300036401 Bacteria 5270
623 Ga0373937_0324758 3300036401 Bacteria 1456
624 Ga0373937_1341742 3300036401 Bacteria 663
625 Ga0373925_0005122 3300037068 Bacteria 9818
626 Ga0373925_0025378 3300037068 Bacteria 4329
627 Ga0373925_0234195 3300037068 Unclassified 1469
628 Ga0242420_012832 3300038996 Bacteria 1422
629 Ga0436361_0576226 3300039447 Bacteria 2180
630 Ga0436362_0119038 3300039453 Bacteria 2265
631 Ga0451839_1639025 3300041496 Unclassified 665
632 Ga0439448_0158406 3300042005 Bacteria 787
633 Ga0439459_0031236 3300042438 Bacteria 1085
634 Ga0439464_0036987 3300042439 Bacteria 1383
635 Ga0451577_0012196 3300042876 Bacteria 8082
636 Ga0451576_0054208 3300045051 Bacteria 4199
637 Ga0495617_169873 3300046452 Bacteria 689
638 Ga0495592_0044780 3300046454 Bacteria 3304
639 Ga0495603_0016333 3300046455 Bacteria 4490
640 Ga0495603_0071374 3300046455 Bacteria 2041
641 Ga0495641_0007860 3300046461 Bacteria 6594
642 Ga0495653_0002576 3300046463 Bacteria 14444
643 Ga0495580_0074209 3300046472 Bacteria 2374
644 Ga0495580_0279191 3300046472 Bacteria 1140
645 Ga0495582_0001169 3300046473 Bacteria 14776
646 Ga0495582_0075451 3300046473 Bacteria 1867
647 Ga0495605_0266587 3300046474 Unclassified 730
648 Ga0495639_0054454 3300046475 Bacteria 1824
649 Ga0495639_0067405 3300046475 Bacteria 1648
650 Ga0495639_0436556 3300046475 Bacteria 664
651 Ga0495662_0008406 3300046476 Bacteria 5076
652 Ga0495662_0148487 3300046476 Bacteria 1154
653 Ga0495664_0009618 3300046477 Bacteria 5411
654 Ga0495584_0023810 3300046491 Bacteria 3104
655 Ga0495585_0001628 3300046492 Bacteria 17232
656 Ga0495594_0008935 3300046499 Bacteria 5167
657 Ga0495607_0017460 3300046501 Bacteria 4606
658 Ga0495608_0017314 3300046511 Bacteria 4986
659 Ga0495618_0005710 3300046514 Bacteria 7563
660 Ga0495628_0022497 3300046516 Bacteria 5178
661 Ga0495630_0051023 3300046517 Bacteria 3095
662 Ga0495630_0097476 3300046517 Unclassified 2224
663 Ga0495637_0331149 3300046520 Unclassified 536
664 Ga0495644_0005413 3300046523 Bacteria 4987
665 Ga0495663_0155530 3300046525 Unclassified 782
666 Ga0495663_0326863 3300046525 Bacteria 556
667 Ga0495666_0002279 3300046526 Bacteria 9550
668 Ga0495652_0048315 3300046529 Bacteria 3646
669 Ga0495665_0005343 3300046531 Bacteria 6922
670 Ga0495640_0317433 3300046533 Unclassified 965
671 Ga0495587_0032694 3300046536 Bacteria 3143
672 Ga0495598_0032005 3300046537 Bacteria 1483
673 Ga0495609_0278873 3300046538 Unclassified 684
674 Ga0495645_0226297 3300046543 Unclassified 1255
675 Ga0495622_0005467 3300046557 Bacteria 5893
676 Ga0495633_0001638 3300046558 Bacteria 16887
677 Ga0495667_0002504 3300046559 Bacteria 12271
678 Ga0495656_0000844 3300046615 Bacteria 9889
679 Ga0495611_0015637 3300046648 Bacteria 3244
680 Ga0495635_0007089 3300046663 Bacteria 7836
681 Ga0495659_0000812 3300046664 Bacteria 11134
682 Ga0495588_0000780 3300046674 Bacteria 14439
683 Ga0495588_0274106 3300046674 Unclassified 889
684 Ga0495599_0010706 3300046678 Bacteria 5617
685 Ga0495647_0004832 3300046681 Bacteria 4402
686 Ga0495658_0002231 3300046683 Bacteria 9794
687 Ga0495658_0194311 3300046683 Unclassified 1263
688 Ga0495658_0303100 3300046683 Bacteria 1011
689 Ga0495613_0004955 3300046689 Bacteria 9998
690 Ga0495613_0253132 3300046689 Unclassified 1229
691 Ga0495624_0006812 3300046690 Bacteria 8067
692 Ga0495670_0001934 3300046691 Bacteria 10210
693 Ga0495600_0033824 3300046809 Bacteria 3318
694 Ga0495581_0005546 3300047315 Bacteria 7310
695 Ga0495604_0015259 3300047317 Bacteria 6133
696 Ga0495674_0119959 3300047319 Bacteria 2222
697 Ga0495676_0063761 3300047321 Bacteria 2870
698 Ga0495676_0114885 3300047321 Bacteria 1969
699 Ga0495680_0026301 3300047322 Bacteria 4800
700 Ga0495675_0025080 3300047444 Bacteria 3803
701 Ga0495679_076272 3300047446 Unclassified 958
702 Ga0495685_052209 3300047447 Bacteria 1385
703 Ga0495684_0005442 3300047471 Bacteria 9907
704 Ga0495593_0010044 3300047673 Bacteria 5482
705 Ga0495614_0006166 3300048089 Bacteria 5387
706 Ga0495615_0014445 3300048090 Bacteria 1669
707 Ga0496100_0012687 3300048903 Bacteria 4839
708 Ga0496100_0052321 3300048903 Bacteria 2654
709 Ga0496100_0395016 3300048903 Bacteria 1052
710 Ga0496100_1122334 3300048903 Unclassified 620
711 Ga0496101_0873105 3300048904 Bacteria 708
712 Ga0496101_0946955 3300048904 Bacteria 677
713 Ga0496102_0033003 3300048905 Bacteria 4651
714 Ga0496102_0113055 3300048905 Bacteria 2533
715 Ga0496102_0389225 3300048905 Bacteria 1311
716 Ga0496103_0050447 3300048906 Bacteria 2574
717 Ga0496103_0145462 3300048906 Bacteria 1517
718 Ga0496103_0301813 3300048906 Bacteria 1030
719 Ga0496104_0064827 3300048907 Bacteria 3465
720 Ga0496104_0195722 3300048907 Bacteria 1933
721 Ga0496104_0294781 3300048907 Bacteria 1534
722 Ga0496104_0406679 3300048907 Bacteria 1273
723 Ga0496105_0111266 3300048908 Bacteria 2260
724 Ga0496105_0120380 3300048908 Bacteria 2165
725 Ga0496105_0317621 3300048908 Bacteria 1249
726 Ga0496105_0466156 3300048908 Bacteria 995
727 Ga0496106_0041267 3300048909 Bacteria 3457
728 Ga0496106_0057963 3300048909 Bacteria 2930
729 Ga0496106_0123244 3300048909 Bacteria 2028
730 Ga0496106_0152321 3300048909 Bacteria 1824
731 Ga0496107_0045547 3300048910 Bacteria 3155
732 Ga0496107_0082706 3300048910 Bacteria 2341
733 Ga0496107_0089779 3300048910 Bacteria 2244
734 Ga0496108_0034538 3300048911 Bacteria 4202
735 Ga0496108_0050233 3300048911 Bacteria 3490
736 Ga0496108_0065764 3300048911 Bacteria 3056
737 Ga0496108_0074924 3300048911 Bacteria 2858
738 Ga0496108_0242923 3300048911 Bacteria 1566
739 Ga0496109_0002090 3300048912 Bacteria 16590
740 Ga0496109_0002254 3300048912 Bacteria 16021
741 Ga0496109_0102967 3300048912 Bacteria 2649
742 Ga0496109_0117084 3300048912 Bacteria 2480
743 Ga0496109_0475035 3300048912 Bacteria 1180
744 Ga0496109_0642980 3300048912 Bacteria 998
745 Ga0496109_0918091 3300048912 Bacteria 813
746 Ga0496110_0115364 3300048913 Bacteria 2417
747 Ga0496110_1805656 3300048913 Unclassified 522
748 Ga0496111_0025885 3300048914 Bacteria 4139
749 Ga0496111_0029383 3300048914 Bacteria 3904
750 Ga0496111_0224739 3300048914 Bacteria 1395
751 Ga0496111_0465298 3300048914 Bacteria 932
752 Ga0496111_0643964 3300048914 Bacteria 774
753 Ga0496112_0056447 3300048915 Bacteria 3864
754 Ga0496112_0066287 3300048915 Bacteria 3562
755 Ga0496112_0072914 3300048915 Bacteria 3394
756 Ga0496113_0014345 3300048916 Bacteria 5404
757 Ga0496113_0266593 3300048916 Bacteria 1368
758 Ga0496113_0361553 3300048916 Bacteria 1164
759 Ga0496113_0368712 3300048916 Bacteria 1152
760 Ga0496114_0016534 3300048917 Bacteria 5946
761 Ga0496115_0021801 3300048918 Bacteria 4952
762 Ga0496115_0042365 3300048918 Bacteria 3626
763 Ga0496115_0263393 3300048918 Bacteria 1417
764 Ga0496126_0550261 3300048929 Bacteria 916
765 Ga0501031_0351166 3300049568 Bacteria 955
766 Ga0501032_0126349 3300049569 Bacteria 1689
767 Ga0501032_0360168 3300049569 Bacteria 936
768 Ga0501033_0067965 3300049570 Bacteria 2621
769 Ga0501033_0208255 3300049570 Bacteria 1395
770 Ga0501033_0637071 3300049570 Bacteria 729
771 Ga0501034_0153702 3300049571 Bacteria 2276
772 Ga0501034_0409780 3300049571 Bacteria 1277
773 Ga0501036_0297324 3300049572 Bacteria 1350
774 Ga0501036_0766291 3300049572 Bacteria 796
775 Ga0501037_0029345 3300049573 Bacteria 4064
776 Ga0501037_0071082 3300049573 Bacteria 2532
777 Ga0501038_0077162 3300049574 Bacteria 2813
778 Ga0501038_0113764 3300049574 Bacteria 2239
779 Ga0501038_0324893 3300049574 Unclassified 1203
780 Ga0501039_0090454 3300049575 Bacteria 2385
781 Ga0501039_0694907 3300049575 Bacteria 795
782 Ga0501046_0189260 3300049580 Bacteria 1536
783 Ga0501046_0456108 3300049580 Bacteria 919
784 Ga0501047_0069693 3300049581 Bacteria 3386
785 Ga0501047_0465796 3300049581 Bacteria 1092
786 Ga0501047_0552002 3300049581 Bacteria 976
787 Ga0501067_0156732 3300049583 Bacteria 1269
788 Ga0501068_0160356 3300049584 Unclassified 1418
789 Ga0501070_0084445 3300049586 Bacteria 2629
790 Ga0501070_0351222 3300049586 Bacteria 1197
791 Ga0501070_1025133 3300049586 Bacteria 639
792 Ga0501072_0323739 3300049588 Unclassified 1225
793 Ga0501073_0046085 3300049589 Bacteria 3068
794 Ga0501073_0089637 3300049589 Bacteria 2138
795 Ga0501074_0083203 3300049590 Bacteria 2294
796 Ga0501074_0101568 3300049590 Bacteria 2059
797 Ga0501076_0057558 3300049592 Bacteria 3086
798 Ga0501076_1109858 3300049592 Bacteria 651
799 Ga0501079_0221647 3300049741 Bacteria 1478
800 Ga0501079_0300372 3300049741 Bacteria 1256
801 Ga0501079_0336165 3300049741 Bacteria 1183
802 Ga0501080_0058679 3300049742 Bacteria 3582
803 Ga0501080_0102707 3300049742 Bacteria 2652
804 Ga0501080_0584641 3300049742 Bacteria 992
805 Ga0501083_0078655 3300049744 Bacteria 2187
806 Ga0501083_0079439 3300049744 Bacteria 2175
807 Ga0501035_0443804 3300049822 Bacteria 1074
808 Ga0501044_0089132 3300049823 Bacteria 3114
809 Ga0501044_0093101 3300049823 Bacteria 3039
810 Ga0501044_0191241 3300049823 Bacteria 2009
811 Ga0501045_0922181 3300049824 Bacteria 641
812 nmdc:mga03n38_208105_c1 3300050490 Bacteria 1015
813 nmdc:mga0yw44_1092226_c1 3300050492 Unclassified 539
814 nmdc:mga0k408_602040_c1 3300050493 Bacteria 648
815 nmdc:mga06z11_383952_c1 3300050494 Bacteria 844
816 nmdc:mga05p37_133968_c1 3300050507 Bacteria 3040
817 nmdc:mga0qj67_84092_c1 3300050509 Bacteria 2551
818 nmdc:mga06r32_181227_c1 3300050510 Bacteria 2092
819 nmdc:mga06r32_318718_c1 3300050510 Bacteria 1540
820 nmdc:mga08y16_10396_c1 3300050511 Bacteria 9764
821 nmdc:mga08y16_113532_c1 3300050511 Bacteria 2820
822 nmdc:mga08y16_395940_c1 3300050511 Bacteria 1414
823 nmdc:mga08y16_60189_c1 3300050511 Bacteria 3967
824 nmdc:mga0n895_118965_c1 3300050512 Bacteria 2663
825 nmdc:mga0n895_191724_c1 3300050512 Bacteria 2075
826 nmdc:mga0n895_45193_c1 3300050512 Bacteria 4297
827 nmdc:mga0n895_459471_c1 3300050512 Bacteria 1285
828 nmdc:mga0n895_588412_c1 3300050512 Bacteria 1116
829 nmdc:mga0rr50_170766_c1 3300050513 Bacteria 1772
830 nmdc:mga0rr50_41470_c1 3300050513 Bacteria 3355
831 nmdc:mga08x19_36813_c1 3300050514 Bacteria 3101
832 nmdc:mga08x19_44829_c1 3300050514 Bacteria 2824
833 Ga0495601_0007242 3300053077 Bacteria 6507
834 Ga0495612_0001030 3300053078 Bacteria 11436
835 Ga0495595_0004950 3300053084 Bacteria 5370
836 Ga0495619_0070742 3300053085 Bacteria 2333
837 Ga0500644_0002792 3300053088 Bacteria 4344
838 Ga0500651_0135371 3300053093 Bacteria 1488
839 Ga0500566_0267021 3300053094 Unclassified 823
840 Ga0500650_0203447 3300053098 Bacteria 901
841 Ga0500652_006245 3300053131 Bacteria 3823
842 Ga0500616_0000001 3300053153 Bacteria 1986011
843 Ga0500645_000050 3300053730 Bacteria 99596
844 Ga0501084_0141228 3300054114 Bacteria 2028
845 Ga0501084_0260907 3300054114 Bacteria 1463
846 Ga0501084_1399634 3300054114 Unclassified 586
847 Ga0501084_1746792 3300054114 Bacteria 520
848 Ga0590071_085057 3300059421 Bacteria 789
849 Ga0501082_0436110 3300060353 Bacteria 1144
850 Ga0530510_0484222 3300061734 Bacteria 937

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035121 Ga0373960_0001125 Ga0373960_0001125_19_432 137
2 3300046455 Ga0495603_0071374 Ga0495603_0071374_19_432 137
3 3300050511 nmdc:mga08y16_395940_c1 nmdc:mga08y16_395940_c1_28_441 137
4 3300046473 Ga0495582_0075451 Ga0495582_0075451_17_433 138
5 3300046475 Ga0495639_0067405 Ga0495639_0067405_17_433 138
6 3300046476 Ga0495662_0148487 Ga0495662_0148487_25_441 138
7 3300053094 Ga0500566_0267021 Ga0500566_0267021_15_431 138
8 iso_pu_bacteria 2513237087 2513591476 144
9 3300013104 Ga0157370_10491474 Ga0157370_104914741 145
10 3300061734 Ga0530510_0484222 Ga0530510_0484222_224_661 145
11 3300031241 Ga0265325_10052210 Ga0265325_100522102 147
12 3300031247 Ga0265340_10482528 Ga0265340_104825281 147
13 3300031249 Ga0265339_10013022 Ga0265339_100130222 147
14 3300031344 Ga0265316_10640424 Ga0265316_106404242 147
15 3300035695 Ga0373927_0022146 Ga0373927_0022146_267_710 147
16 3300035725 Ga0373947_0080266 Ga0373947_0080266_141_584 147
17 3300037068 Ga0373925_0025378 Ga0373925_0025378_635_1078 147
18 3300046472 Ga0495580_0279191 Ga0495580_0279191_13_456 147
19 3300046475 Ga0495639_0436556 Ga0495639_0436556_41_484 147
20 3300046517 Ga0495630_0097476 Ga0495630_0097476_800_1243 147
21 3300046683 Ga0495658_0194311 Ga0495658_0194311_484_927 147
22 3300046689 Ga0495613_0253132 Ga0495613_0253132_264_707 147
23 3300005290 Ga0065712_10362046 Ga0065712_103620461 148
24 3300005328 Ga0070676_10523261 Ga0070676_105232611 148
25 3300005335 Ga0070666_10914347 Ga0070666_109143471 148
26 3300005343 Ga0070687_100177140 Ga0070687_1001771402 148
27 3300005343 Ga0070687_101035558 Ga0070687_1010355581 148
28 3300005353 Ga0070669_100848098 Ga0070669_1008480982 148
29 3300005355 Ga0070671_100073817 Ga0070671_1000738171 148
30 3300005364 Ga0070673_100098213 Ga0070673_1000982131 148
31 3300005364 Ga0070673_100837112 Ga0070673_1008371121 148
32 3300005367 Ga0070667_101171335 Ga0070667_1011713352 148
33 3300005436 Ga0070713_100268406 Ga0070713_1002684061 148
34 3300005466 Ga0070685_10050286 Ga0070685_100502863 148
35 3300005544 Ga0070686_100454436 Ga0070686_1004544361 148
36 3300005544 Ga0070686_100742351 Ga0070686_1007423511 148
37 3300005577 Ga0068857_100126454 Ga0068857_1001264543 148
38 3300005617 Ga0068859_100093053 Ga0068859_1000930533 148
39 3300005841 Ga0068863_100252417 Ga0068863_1002524172 148
40 3300005843 Ga0068860_100629226 Ga0068860_1006292262 148
41 3300005844 Ga0068862_100917966 Ga0068862_1009179662 148
42 3300005937 Ga0081455_10209824 Ga0081455_102098242 148
43 3300005981 Ga0081538_10047724 Ga0081538_100477242 148
44 3300005985 Ga0081539_10034315 Ga0081539_100343152 148
45 3300006048 Ga0075363_100583256 Ga0075363_1005832561 148
46 3300006058 Ga0075432_10160795 Ga0075432_101607952 148
47 3300006178 Ga0075367_10164761 Ga0075367_101647612 148
48 3300006195 Ga0075366_10664020 Ga0075366_106640202 148
49 3300006844 Ga0075428_100075386 Ga0075428_1000753866 148
50 3300006846 Ga0075430_100137691 Ga0075430_1001376912 148
51 3300006847 Ga0075431_100509572 Ga0075431_1005095722 148
52 3300006847 Ga0075431_100610157 Ga0075431_1006101572 148
53 3300006871 Ga0075434_100162917 Ga0075434_1001629174 148
54 3300006880 Ga0075429_100476984 Ga0075429_1004769841 148
55 3300006880 Ga0075429_101298219 Ga0075429_1012982192 148
56 3300006931 Ga0097620_100093045 Ga0097620_1000930453 148
57 3300009094 Ga0111539_10015411 Ga0111539_100154112 148
58 3300009098 Ga0105245_12115198 Ga0105245_121151981 148
59 3300009148 Ga0105243_11238678 Ga0105243_112386782 148
60 3300009177 Ga0105248_10916262 Ga0105248_109162622 148
61 3300009553 Ga0105249_10919413 Ga0105249_109194131 148
62 3300013296 Ga0157374_12792937 Ga0157374_127929371 148
63 3300013308 Ga0157375_10846755 Ga0157375_108467551 148
64 3300014325 Ga0163163_10109870 Ga0163163_101098702 148
65 3300014326 Ga0157380_12570285 Ga0157380_125702851 148
66 3300025901 Ga0207688_10051981 Ga0207688_100519812 148
67 3300025908 Ga0207643_10092580 Ga0207643_100925801 148
68 3300025924 Ga0207694_10421731 Ga0207694_104217312 148
69 3300025925 Ga0207650_10128693 Ga0207650_101286932 148
70 3300025925 Ga0207650_11253838 Ga0207650_112538381 148
71 3300025928 Ga0207700_10523543 Ga0207700_105235432 148
72 3300025931 Ga0207644_10075013 Ga0207644_100750133 148
73 3300025935 Ga0207709_10376686 Ga0207709_103766862 148
74 3300025939 Ga0207665_11136284 Ga0207665_111362841 148
75 3300025940 Ga0207691_10138288 Ga0207691_101382883 148
76 3300025941 Ga0207711_10556309 Ga0207711_105563092 148
77 3300025942 Ga0207689_10531413 Ga0207689_105314132 148
78 3300025961 Ga0207712_10733033 Ga0207712_107330332 148
79 3300026035 Ga0207703_10345530 Ga0207703_103455302 148
80 3300026088 Ga0207641_10124651 Ga0207641_101246512 148
81 3300026088 Ga0207641_11671590 Ga0207641_116715902 148
82 3300026089 Ga0207648_10432290 Ga0207648_104322902 148
83 3300026095 Ga0207676_10042485 Ga0207676_100424854 148
84 3300026118 Ga0207675_100966369 Ga0207675_1009663692 148
85 3300027907 Ga0207428_10041754 Ga0207428_100417542 148
86 3300028380 Ga0268265_11180630 Ga0268265_111806301 148
87 3300028381 Ga0268264_10495460 Ga0268264_104954602 148
88 3300031548 Ga0307408_100160592 Ga0307408_1001605921 148
89 3300031548 Ga0307408_102241823 Ga0307408_1022418231 148
90 3300031595 Ga0265313_10107772 Ga0265313_101077722 148
91 3300031901 Ga0307406_10638637 Ga0307406_106386372 148
92 3300031995 Ga0307409_102767534 Ga0307409_1027675341 148
93 3300032002 Ga0307416_101958657 Ga0307416_1019586572 148
94 3300032126 Ga0307415_101989201 Ga0307415_1019892011 148
95 3300035725 Ga0373947_1204959 Ga0373947_1204959_58_504 148
96 3300036401 Ga0373937_1341742 Ga0373937_1341742_59_505 148
97 3300039453 Ga0436362_0119038 Ga0436362_0119038_1115_1561 148
98 3300042438 Ga0439459_0031236 Ga0439459_0031236_83_529 148
99 3300046525 Ga0495663_0326863 Ga0495663_0326863_61_507 148
100 3300046683 Ga0495658_0303100 Ga0495658_0303100_349_822 148
101 3300047447 Ga0495685_052209 Ga0495685_052209_11_457 148
102 3300048090 Ga0495615_0014445 Ga0495615_0014445_147_593 148
103 3300048903 Ga0496100_0052321 Ga0496100_0052321_762_1208 148
104 3300048903 Ga0496100_0395016 Ga0496100_0395016_103_549 148
105 3300048905 Ga0496102_0033003 Ga0496102_0033003_242_688 148
106 3300048906 Ga0496103_0301813 Ga0496103_0301813_35_481 148
107 3300048907 Ga0496104_0064827 Ga0496104_0064827_547_993 148
108 3300048907 Ga0496104_0406679 Ga0496104_0406679_296_742 148
109 3300048908 Ga0496105_0120380 Ga0496105_0120380_1514_1960 148
110 3300048909 Ga0496106_0057963 Ga0496106_0057963_793_1239 148
111 3300048911 Ga0496108_0034538 Ga0496108_0034538_2104_2550 148
112 3300048912 Ga0496109_0642980 Ga0496109_0642980_35_481 148
113 3300048912 Ga0496109_0918091 Ga0496109_0918091_62_508 148
114 3300048913 Ga0496110_0115364 Ga0496110_0115364_1688_2134 148
115 3300048914 Ga0496111_0643964 Ga0496111_0643964_195_641 148
116 3300048915 Ga0496112_0056447 Ga0496112_0056447_142_588 148
117 3300048915 Ga0496112_0072914 Ga0496112_0072914_2042_2488 148
118 3300048916 Ga0496113_0266593 Ga0496113_0266593_849_1295 148
119 3300049568 Ga0501031_0351166 Ga0501031_0351166_314_844 148
120 3300049569 Ga0501032_0126349 Ga0501032_0126349_994_1524 148
121 3300049570 Ga0501033_0067965 Ga0501033_0067965_871_1401 148
122 3300049571 Ga0501034_0409780 Ga0501034_0409780_731_1261 148
123 3300049572 Ga0501036_0297324 Ga0501036_0297324_760_1290 148
124 3300049572 Ga0501036_0766291 Ga0501036_0766291_269_715 148
125 3300049573 Ga0501037_0071082 Ga0501037_0071082_213_743 148
126 3300049574 Ga0501038_0077162 Ga0501038_0077162_881_1411 148
127 3300049575 Ga0501039_0090454 Ga0501039_0090454_1177_1707 148
128 3300049580 Ga0501046_0189260 Ga0501046_0189260_943_1473 148
129 3300049589 Ga0501073_0089637 Ga0501073_0089637_941_1414 148
130 3300049742 Ga0501080_0102707 Ga0501080_0102707_186_659 148
131 3300049742 Ga0501080_0584641 Ga0501080_0584641_57_587 148
132 3300049744 Ga0501083_0078655 Ga0501083_0078655_1080_1610 148
133 3300049822 Ga0501035_0443804 Ga0501035_0443804_73_603 148
134 3300049823 Ga0501044_0191241 Ga0501044_0191241_278_808 148
135 3300049824 Ga0501045_0922181 Ga0501045_0922181_183_629 148
136 3300050493 nmdc:mga0k408_602040_c1 nmdc:mga0k408_602040_c1_33_479 148
137 3300050494 nmdc:mga06z11_383952_c1 nmdc:mga06z11_383952_c1_375_824 148
138 3300050509 nmdc:mga0qj67_84092_c1 nmdc:mga0qj67_84092_c1_558_1004 148
139 3300050510 nmdc:mga06r32_181227_c1 nmdc:mga06r32_181227_c1_639_1085 148
140 3300050510 nmdc:mga06r32_318718_c1 nmdc:mga06r32_318718_c1_881_1327 148
141 3300050511 nmdc:mga08y16_113532_c1 nmdc:mga08y16_113532_c1_495_941 148
142 3300050512 nmdc:mga0n895_588412_c1 nmdc:mga0n895_588412_c1_319_765 148
143 3300054114 Ga0501084_1399634 Ga0501084_1399634_69_515 148
144 3300054114 Ga0501084_1746792 Ga0501084_1746792_16_462 148
145 3300059421 Ga0590071_085057 Ga0590071_085057_114_560 148
146 3300060353 Ga0501082_0436110 Ga0501082_0436110_349_879 148
147 2162886007 SwRhRL2b_contig_1716414 SwRhRL2b_0331.00000920 149
148 2209111006 2214739662 2213746898 149
149 3300000042 ARSoilYngRDRAFT_c00052 ARSoilYngRDRAFT_0005215 149
150 3300000043 ARcpr5yngRDRAFT_c000147 ARcpr5yngRDRAFT_0001472 149
151 3300000044 ARSoilOldRDRAFT_c000002 ARSoilOldRDRAFT_0000024 149
152 3300000045 ARCol0oldRDRAFT_c00693 ARCol0oldRDRAFT_006932 149
153 3300000652 ARCol0yngRDRAFT_1000005 ARCol0yngRDRAFT_100000515 149
154 3300001989 JGI24739J22299_10173016 JGI24739J22299_101730161 149
155 3300001990 JGI24737J22298_10000816 JGI24737J22298_100008162 149
156 3300001990 JGI24737J22298_10009462 JGI24737J22298_100094622 149
157 3300002075 JGI24738J21930_10000057 JGI24738J21930_100000577 149
158 3300002076 JGI24749J21850_1002009 JGI24749J21850_10020093 149
159 3300002076 JGI24749J21850_1007925 JGI24749J21850_10079251 149
160 3300002077 JGI24744J21845_10000508 JGI24744J21845_100005083 149
161 3300002155 JGI24033J26618_1000475 JGI24033J26618_10004752 149
162 3300002239 JGI24034J26672_10108639 JGI24034J26672_101086391 149
163 3300005276 Ga0065717_1004452 Ga0065717_10044521 149
164 3300005277 Ga0065716_1002247 Ga0065716_10022472 149
165 3300005289 Ga0065704_10006448 Ga0065704_100064483 149
166 3300005290 Ga0065712_10004316 Ga0065712_100043163 149
167 3300005290 Ga0065712_10005073 Ga0065712_100050732 149
168 3300005293 Ga0065715_10002538 Ga0065715_1000253813 149
169 3300005295 Ga0065707_10035590 Ga0065707_100355902 149
170 3300005328 Ga0070676_10003844 Ga0070676_100038443 149
171 3300005329 Ga0070683_100115014 Ga0070683_1001150142 149
172 3300005329 Ga0070683_100231273 Ga0070683_1002312732 149
173 3300005329 Ga0070683_102181136 Ga0070683_1021811361 149
174 3300005330 Ga0070690_100000189 Ga0070690_1000001898 149
175 3300005330 Ga0070690_100001958 Ga0070690_1000019588 149
176 3300005330 Ga0070690_100019725 Ga0070690_1000197253 149
177 3300005331 Ga0070670_100007955 Ga0070670_1000079554 149
178 3300005331 Ga0070670_101035706 Ga0070670_1010357061 149
179 3300005333 Ga0070677_10000347 Ga0070677_100003474 149
180 3300005334 Ga0068869_100151596 Ga0068869_1001515962 149
181 3300005335 Ga0070666_10001280 Ga0070666_1000128011 149
182 3300005335 Ga0070666_10016467 Ga0070666_100164673 149
183 3300005336 Ga0070680_100003903 Ga0070680_1000039034 149
184 3300005336 Ga0070680_100011404 Ga0070680_1000114046 149
185 3300005336 Ga0070680_100013996 Ga0070680_1000139964 149
186 3300005336 Ga0070680_100255672 Ga0070680_1002556722 149
187 3300005336 Ga0070680_100999539 Ga0070680_1009995391 149
188 3300005337 Ga0070682_100006959 Ga0070682_1000069593 149
189 3300005337 Ga0070682_100027997 Ga0070682_1000279974 149
190 3300005337 Ga0070682_100076704 Ga0070682_1000767042 149
191 3300005337 Ga0070682_100398681 Ga0070682_1003986811 149
192 3300005338 Ga0068868_100002148 Ga0068868_1000021488 149
193 3300005338 Ga0068868_100016286 Ga0068868_1000162863 149
194 3300005339 Ga0070660_100001222 Ga0070660_10000122210 149
195 3300005339 Ga0070660_100039588 Ga0070660_1000395882 149
196 3300005339 Ga0070660_100094640 Ga0070660_1000946402 149
197 3300005339 Ga0070660_100136966 Ga0070660_1001369662 149
198 3300005340 Ga0070689_100000770 Ga0070689_10000077010 149
199 3300005340 Ga0070689_100151653 Ga0070689_1001516532 149
200 3300005341 Ga0070691_10088289 Ga0070691_100882891 149
201 3300005344 Ga0070661_100038917 Ga0070661_1000389173 149
202 3300005344 Ga0070661_100123073 Ga0070661_1001230732 149
203 3300005344 Ga0070661_100201492 Ga0070661_1002014922 149
204 3300005345 Ga0070692_10096422 Ga0070692_100964222 149
205 3300005345 Ga0070692_10441395 Ga0070692_104413951 149
206 3300005345 Ga0070692_10554337 Ga0070692_105543371 149
207 3300005347 Ga0070668_100007912 Ga0070668_1000079123 149
208 3300005347 Ga0070668_100123434 Ga0070668_1001234342 149
209 3300005353 Ga0070669_100010601 Ga0070669_1000106011 149
210 3300005353 Ga0070669_100198749 Ga0070669_1001987492 149
211 3300005353 Ga0070669_100384038 Ga0070669_1003840382 149
212 3300005354 Ga0070675_100085017 Ga0070675_1000850172 149
213 3300005354 Ga0070675_100663032 Ga0070675_1006630322 149
214 3300005355 Ga0070671_100001430 Ga0070671_1000014307 149
215 3300005355 Ga0070671_100009186 Ga0070671_1000091866 149
216 3300005356 Ga0070674_100002774 Ga0070674_1000027744 149
217 3300005356 Ga0070674_100039157 Ga0070674_1000391572 149
218 3300005356 Ga0070674_101119679 Ga0070674_1011196791 149
219 3300005364 Ga0070673_100000351 Ga0070673_10000035115 149
220 3300005364 Ga0070673_100004787 Ga0070673_1000047872 149
221 3300005365 Ga0070688_100000636 Ga0070688_1000006364 149
222 3300005365 Ga0070688_100007216 Ga0070688_1000072161 149
223 3300005365 Ga0070688_101175369 Ga0070688_1011753691 149
224 3300005366 Ga0070659_100043241 Ga0070659_1000432413 149
225 3300005366 Ga0070659_100049436 Ga0070659_1000494362 149
226 3300005366 Ga0070659_100577846 Ga0070659_1005778462 149
227 3300005367 Ga0070667_100013160 Ga0070667_1000131603 149
228 3300005367 Ga0070667_100039413 Ga0070667_1000394132 149
229 3300005367 Ga0070667_100394027 Ga0070667_1003940272 149
230 3300005406 Ga0070703_10002228 Ga0070703_100022282 149
231 3300005406 Ga0070703_10044342 Ga0070703_100443422 149
232 3300005434 Ga0070709_10001206 Ga0070709_100012068 149
233 3300005434 Ga0070709_10068063 Ga0070709_100680632 149
234 3300005434 Ga0070709_10250470 Ga0070709_102504702 149
235 3300005435 Ga0070714_100004005 Ga0070714_1000040057 149
236 3300005435 Ga0070714_100018072 Ga0070714_1000180723 149
237 3300005435 Ga0070714_100069015 Ga0070714_1000690152 149
238 3300005435 Ga0070714_100240283 Ga0070714_1002402832 149
239 3300005436 Ga0070713_100000423 Ga0070713_1000004233 149
240 3300005437 Ga0070710_10001578 Ga0070710_100015783 149
241 3300005437 Ga0070710_10040870 Ga0070710_100408702 149
242 3300005438 Ga0070701_10045191 Ga0070701_100451912 149
243 3300005439 Ga0070711_100130902 Ga0070711_1001309022 149
244 3300005439 Ga0070711_100145182 Ga0070711_1001451822 149
245 3300005440 Ga0070705_100007839 Ga0070705_1000078393 149
246 3300005440 Ga0070705_100090751 Ga0070705_1000907512 149
247 3300005441 Ga0070700_100043624 Ga0070700_1000436243 149
248 3300005441 Ga0070700_100777762 Ga0070700_1007777622 149
249 3300005444 Ga0070694_100000666 Ga0070694_1000006665 149
250 3300005444 Ga0070694_100499852 Ga0070694_1004998521 149
251 3300005445 Ga0070708_100292667 Ga0070708_1002926672 149
252 3300005455 Ga0070663_100008450 Ga0070663_1000084503 149
253 3300005455 Ga0070663_100026749 Ga0070663_1000267492 149
254 3300005455 Ga0070663_100137705 Ga0070663_1001377052 149
255 3300005456 Ga0070678_100006139 Ga0070678_1000061392 149
256 3300005456 Ga0070678_100019629 Ga0070678_1000196295 149
257 3300005457 Ga0070662_100008526 Ga0070662_1000085263 149
258 3300005457 Ga0070662_100206098 Ga0070662_1002060981 149
259 3300005457 Ga0070662_100429756 Ga0070662_1004297562 149
260 3300005457 Ga0070662_100835833 Ga0070662_1008358331 149
261 3300005458 Ga0070681_10001541 Ga0070681_100015418 149
262 3300005458 Ga0070681_10046591 Ga0070681_100465913 149
263 3300005458 Ga0070681_10057034 Ga0070681_100570343 149
264 3300005458 Ga0070681_10096426 Ga0070681_100964262 149
265 3300005458 Ga0070681_10351881 Ga0070681_103518812 149
266 3300005458 Ga0070681_10633913 Ga0070681_106339131 149
267 3300005459 Ga0068867_100167242 Ga0068867_1001672422 149
268 3300005466 Ga0070685_10008742 Ga0070685_100087423 149
269 3300005471 Ga0070698_100679973 Ga0070698_1006799732 149
270 3300005507 Ga0074259_10781806 Ga0074259_107818062 149
271 3300005530 Ga0070679_100001345 Ga0070679_1000013458 149
272 3300005530 Ga0070679_100048353 Ga0070679_1000483533 149
273 3300005530 Ga0070679_100141844 Ga0070679_1001418443 149
274 3300005530 Ga0070679_100299601 Ga0070679_1002996012 149
275 3300005530 Ga0070679_100548721 Ga0070679_1005487211 149
276 3300005535 Ga0070684_100032724 Ga0070684_1000327243 149
277 3300005535 Ga0070684_100167000 Ga0070684_1001670002 149
278 3300005535 Ga0070684_100206406 Ga0070684_1002064062 149
279 3300005536 Ga0070697_100261566 Ga0070697_1002615662 149
280 3300005539 Ga0068853_100075401 Ga0068853_1000754012 149
281 3300005539 Ga0068853_100207259 Ga0068853_1002072592 149
282 3300005539 Ga0068853_100629183 Ga0068853_1006291832 149
283 3300005539 Ga0068853_102002678 Ga0068853_1020026781 149
284 3300005543 Ga0070672_100001305 Ga0070672_1000013053 149
285 3300005544 Ga0070686_100000591 Ga0070686_1000005918 149
286 3300005544 Ga0070686_100050224 Ga0070686_1000502242 149
287 3300005544 Ga0070686_100212769 Ga0070686_1002127691 149
288 3300005545 Ga0070695_100096527 Ga0070695_1000965272 149
289 3300005545 Ga0070695_100535454 Ga0070695_1005354542 149
290 3300005546 Ga0070696_100010728 Ga0070696_1000107283 149
291 3300005546 Ga0070696_100016768 Ga0070696_1000167684 149
292 3300005546 Ga0070696_100038234 Ga0070696_1000382343 149
293 3300005546 Ga0070696_100251405 Ga0070696_1002514052 149
294 3300005546 Ga0070696_100601358 Ga0070696_1006013581 149
295 3300005547 Ga0070693_100023452 Ga0070693_1000234523 149
296 3300005547 Ga0070693_100045206 Ga0070693_1000452062 149
297 3300005547 Ga0070693_100615154 Ga0070693_1006151541 149
298 3300005548 Ga0070665_100062458 Ga0070665_1000624582 149
299 3300005549 Ga0070704_100014344 Ga0070704_1000143442 149
300 3300005549 Ga0070704_100042161 Ga0070704_1000421613 149
301 3300005563 Ga0068855_100021052 Ga0068855_1000210523 149
302 3300005563 Ga0068855_100088149 Ga0068855_1000881492 149
303 3300005563 Ga0068855_100172797 Ga0068855_1001727972 149
304 3300005564 Ga0070664_100008474 Ga0070664_1000084747 149
305 3300005564 Ga0070664_100064979 Ga0070664_1000649792 149
306 3300005564 Ga0070664_100142275 Ga0070664_1001422752 149
307 3300005564 Ga0070664_100241482 Ga0070664_1002414822 149
308 3300005577 Ga0068857_100001568 Ga0068857_10000156815 149
309 3300005577 Ga0068857_100205500 Ga0068857_1002055002 149
310 3300005577 Ga0068857_100629530 Ga0068857_1006295302 149
311 3300005578 Ga0068854_100069724 Ga0068854_1000697242 149
312 3300005578 Ga0068854_100482664 Ga0068854_1004826642 149
313 3300005614 Ga0068856_100088582 Ga0068856_1000885822 149
314 3300005614 Ga0068856_100266215 Ga0068856_1002662152 149
315 3300005614 Ga0068856_100730214 Ga0068856_1007302141 149
316 3300005614 Ga0068856_100823218 Ga0068856_1008232181 149
317 3300005615 Ga0070702_100001523 Ga0070702_1000015237 149
318 3300005615 Ga0070702_100036733 Ga0070702_1000367331 149
319 3300005616 Ga0068852_100292209 Ga0068852_1002922091 149
320 3300005616 Ga0068852_100349217 Ga0068852_1003492172 149
321 3300005616 Ga0068852_100378176 Ga0068852_1003781762 149
322 3300005616 Ga0068852_100423443 Ga0068852_1004234432 149
323 3300005617 Ga0068859_100004726 Ga0068859_10000472610 149
324 3300005617 Ga0068859_100068342 Ga0068859_1000683423 149
325 3300005617 Ga0068859_100069668 Ga0068859_1000696682 149
326 3300005617 Ga0068859_100206429 Ga0068859_1002064293 149
327 3300005618 Ga0068864_100072258 Ga0068864_1000722581 149
328 3300005618 Ga0068864_100841063 Ga0068864_1008410632 149
329 3300005718 Ga0068866_10392245 Ga0068866_103922451 149
330 3300005719 Ga0068861_100338496 Ga0068861_1003384962 149
331 3300005719 Ga0068861_100374788 Ga0068861_1003747882 149
332 3300005834 Ga0068851_10282260 Ga0068851_102822602 149
333 3300005840 Ga0068870_10000107 Ga0068870_1000010715 149
334 3300005840 Ga0068870_10723322 Ga0068870_107233222 149
335 3300005841 Ga0068863_100542679 Ga0068863_1005426792 149
336 3300005841 Ga0068863_100759791 Ga0068863_1007597911 149
337 3300005842 Ga0068858_100036809 Ga0068858_1000368092 149
338 3300005842 Ga0068858_100342234 Ga0068858_1003422342 149
339 3300005842 Ga0068858_100501436 Ga0068858_1005014362 149
340 3300005842 Ga0068858_100637002 Ga0068858_1006370021 149
341 3300005843 Ga0068860_100070594 Ga0068860_1000705942 149
342 3300005844 Ga0068862_100046532 Ga0068862_1000465323 149
343 3300005937 Ga0081455_10000012 Ga0081455_1000001228 149
344 3300005937 Ga0081455_10263464 Ga0081455_102634642 149
345 3300005983 Ga0081540_1087819 Ga0081540_10878191 149
346 3300006038 Ga0075365_11338890 Ga0075365_113388901 149
347 3300006048 Ga0075363_100325266 Ga0075363_1003252662 149
348 3300006058 Ga0075432_10048392 Ga0075432_100483922 149
349 3300006163 Ga0070715_10011106 Ga0070715_100111063 149
350 3300006173 Ga0070716_100001630 Ga0070716_1000016308 149
351 3300006173 Ga0070716_100056841 Ga0070716_1000568411 149
352 3300006173 Ga0070716_100297130 Ga0070716_1002971302 149
353 3300006175 Ga0070712_100030464 Ga0070712_1000304642 149
354 3300006175 Ga0070712_100072724 Ga0070712_1000727243 149
355 3300006175 Ga0070712_100110739 Ga0070712_1001107392 149
356 3300006237 Ga0097621_100006955 Ga0097621_1000069553 149
357 3300006358 Ga0068871_100003093 Ga0068871_1000030934 149
358 3300006358 Ga0068871_100059420 Ga0068871_1000594203 149
359 3300006871 Ga0075434_100102527 Ga0075434_1001025272 149
360 3300006871 Ga0075434_100104971 Ga0075434_1001049712 149
361 3300006871 Ga0075434_100494155 Ga0075434_1004941551 149
362 3300006871 Ga0075434_101017745 Ga0075434_1010177452 149
363 3300006881 Ga0068865_100044238 Ga0068865_1000442381 149
364 3300006881 Ga0068865_100056639 Ga0068865_1000566392 149
365 3300006914 Ga0075436_100075687 Ga0075436_1000756872 149
366 3300006931 Ga0097620_100004726 Ga0097620_10000472610 149
367 3300006931 Ga0097620_100068342 Ga0097620_1000683423 149
368 3300006931 Ga0097620_100069664 Ga0097620_1000696642 149
369 3300006931 Ga0097620_100206441 Ga0097620_1002064413 149
370 3300007076 Ga0075435_100064065 Ga0075435_1000640652 149
371 3300009011 Ga0105251_10019357 Ga0105251_100193572 149
372 3300009011 Ga0105251_10405144 Ga0105251_104051441 149
373 3300009092 Ga0105250_10086841 Ga0105250_100868412 149
374 3300009092 Ga0105250_10257303 Ga0105250_102573032 149
375 3300009093 Ga0105240_10029646 Ga0105240_100296462 149
376 3300009093 Ga0105240_10401726 Ga0105240_104017262 149
377 3300009093 Ga0105240_10516840 Ga0105240_105168402 149
378 3300009094 Ga0111539_10001217 Ga0111539_1000121721 149
379 3300009094 Ga0111539_10617522 Ga0111539_106175222 149
380 3300009098 Ga0105245_10161057 Ga0105245_101610572 149
381 3300009098 Ga0105245_10586372 Ga0105245_105863722 149
382 3300009101 Ga0105247_10001754 Ga0105247_100017542 149
383 3300009101 Ga0105247_10019797 Ga0105247_100197973 149
384 3300009101 Ga0105247_10028913 Ga0105247_100289132 149
385 3300009101 Ga0105247_10430530 Ga0105247_104305302 149
386 3300009147 Ga0114129_10038658 Ga0114129_100386582 149
387 3300009148 Ga0105243_10029408 Ga0105243_100294083 149
388 3300009148 Ga0105243_10048043 Ga0105243_100480432 149
389 3300009174 Ga0105241_10000891 Ga0105241_100008918 149
390 3300009174 Ga0105241_10011615 Ga0105241_100116155 149
391 3300009174 Ga0105241_11171438 Ga0105241_111714381 149
392 3300009176 Ga0105242_10007190 Ga0105242_100071903 149
393 3300009176 Ga0105242_10167123 Ga0105242_101671232 149
394 3300009177 Ga0105248_10000638 Ga0105248_1000063823 149
395 3300009177 Ga0105248_10007450 Ga0105248_1000745010 149
396 3300009177 Ga0105248_10683596 Ga0105248_106835961 149
397 3300009545 Ga0105237_10347842 Ga0105237_103478422 149
398 3300009545 Ga0105237_11729627 Ga0105237_117296271 149
399 3300009551 Ga0105238_10014196 Ga0105238_100141962 149
400 3300009551 Ga0105238_10028944 Ga0105238_100289442 149
401 3300009553 Ga0105249_10020932 Ga0105249_100209323 149
402 3300009553 Ga0105249_10564442 Ga0105249_105644421 149
403 3300009553 Ga0105249_10573051 Ga0105249_105730512 149
404 3300009553 Ga0105249_10797724 Ga0105249_107977241 149
405 3300009553 Ga0105249_11812988 Ga0105249_118129881 149
406 3300010375 Ga0105239_10005135 Ga0105239_100051357 149
407 3300010375 Ga0105239_10082950 Ga0105239_100829502 149
408 3300010375 Ga0105239_10510512 Ga0105239_105105121 149
409 3300011119 Ga0105246_10076578 Ga0105246_100765782 149
410 3300011119 Ga0105246_10816343 Ga0105246_108163431 149
411 3300012502 Ga0157347_1009871 Ga0157347_10098712 149
412 3300012503 Ga0157313_1002708 Ga0157313_10027082 149
413 3300012513 Ga0157326_1003964 Ga0157326_10039642 149
414 3300013100 Ga0157373_10024655 Ga0157373_100246553 149
415 3300013100 Ga0157373_10449663 Ga0157373_104496631 149
416 3300013100 Ga0157373_10487985 Ga0157373_104879852 149
417 3300013102 Ga0157371_10159389 Ga0157371_101593892 149
418 3300013102 Ga0157371_10340723 Ga0157371_103407232 149
419 3300013105 Ga0157369_11070952 Ga0157369_110709522 149
420 3300013296 Ga0157374_10138179 Ga0157374_101381792 149
421 3300013296 Ga0157374_10207106 Ga0157374_102071062 149
422 3300013296 Ga0157374_10509864 Ga0157374_105098641 149
423 3300013297 Ga0157378_10006939 Ga0157378_100069394 149
424 3300013297 Ga0157378_10213432 Ga0157378_102134322 149
425 3300013306 Ga0163162_10047751 Ga0163162_100477514 149
426 3300013306 Ga0163162_10094840 Ga0163162_100948403 149
427 3300013307 Ga0157372_10531262 Ga0157372_105312622 149
428 3300013307 Ga0157372_11337572 Ga0157372_113375722 149
429 3300013307 Ga0157372_12404903 Ga0157372_124049031 149
430 3300013308 Ga0157375_10002695 Ga0157375_100026957 149
431 3300013308 Ga0157375_10165195 Ga0157375_101651952 149
432 3300013308 Ga0157375_10299559 Ga0157375_102995592 149
433 3300013308 Ga0157375_11148205 Ga0157375_111482052 149
434 3300014325 Ga0163163_10023833 Ga0163163_100238335 149
435 3300014325 Ga0163163_10046102 Ga0163163_100461022 149
436 3300014325 Ga0163163_10221990 Ga0163163_102219902 149
437 3300014325 Ga0163163_10431856 Ga0163163_104318562 149
438 3300014326 Ga0157380_10004026 Ga0157380_100040267 149
439 3300014326 Ga0157380_10387959 Ga0157380_103879592 149
440 3300014326 Ga0157380_10719105 Ga0157380_107191052 149
441 3300014326 Ga0157380_12024386 Ga0157380_120243861 149
442 3300014968 Ga0157379_10103256 Ga0157379_101032562 149
443 3300014968 Ga0157379_10240775 Ga0157379_102407751 149
444 3300014969 Ga0157376_10720596 Ga0157376_107205962 149
445 3300014969 Ga0157376_11034001 Ga0157376_110340012 149
446 3300017792 Ga0163161_10001790 Ga0163161_100017902 149
447 3300017792 Ga0163161_10082933 Ga0163161_100829332 149
448 3300020069 Ga0197907_10525614 Ga0197907_105256142 149
449 3300020070 Ga0206356_10463979 Ga0206356_104639792 149
450 3300020070 Ga0206356_10908987 Ga0206356_109089872 149
451 3300020078 Ga0206352_10919806 Ga0206352_109198061 149
452 3300020082 Ga0206353_11507390 Ga0206353_115073902 149
453 3300020610 Ga0154015_1421512 Ga0154015_14215121 149
454 3300022467 Ga0224712_10627127 Ga0224712_106271271 149
455 3300025271 Ga0207666_1001296 Ga0207666_10012962 149
456 3300025290 Ga0207673_1000114 Ga0207673_10001144 149
457 3300025315 Ga0207697_10000913 Ga0207697_1000091313 149
458 3300025315 Ga0207697_10026179 Ga0207697_100261792 149
459 3300025885 Ga0207653_10041083 Ga0207653_100410832 149
460 3300025893 Ga0207682_10000107 Ga0207682_1000010724 149
461 3300025898 Ga0207692_10001671 Ga0207692_100016713 149
462 3300025899 Ga0207642_10748833 Ga0207642_107488331 149
463 3300025900 Ga0207710_10003883 Ga0207710_100038835 149
464 3300025900 Ga0207710_10061124 Ga0207710_100611242 149
465 3300025901 Ga0207688_10016191 Ga0207688_100161912 149
466 3300025901 Ga0207688_10062206 Ga0207688_100622062 149
467 3300025901 Ga0207688_10380834 Ga0207688_103808342 149
468 3300025903 Ga0207680_10004687 Ga0207680_100046877 149
469 3300025903 Ga0207680_10166488 Ga0207680_101664882 149
470 3300025904 Ga0207647_10010513 Ga0207647_100105133 149
471 3300025904 Ga0207647_10017796 Ga0207647_100177963 149
472 3300025905 Ga0207685_10001449 Ga0207685_100014491 149
473 3300025906 Ga0207699_10002364 Ga0207699_100023643 149
474 3300025906 Ga0207699_10056461 Ga0207699_100564613 149
475 3300025906 Ga0207699_10086923 Ga0207699_100869232 149
476 3300025907 Ga0207645_10000655 Ga0207645_1000065523 149
477 3300025909 Ga0207705_10009573 Ga0207705_100095735 149
478 3300025911 Ga0207654_10004317 Ga0207654_100043173 149
479 3300025911 Ga0207654_10009569 Ga0207654_100095693 149
480 3300025912 Ga0207707_10007710 Ga0207707_100077102 149
481 3300025912 Ga0207707_10024331 Ga0207707_100243314 149
482 3300025912 Ga0207707_10260577 Ga0207707_102605772 149
483 3300025913 Ga0207695_10437877 Ga0207695_104378772 149
484 3300025913 Ga0207695_10690028 Ga0207695_106900282 149
485 3300025914 Ga0207671_10535604 Ga0207671_105356041 149
486 3300025914 Ga0207671_10998033 Ga0207671_109980331 149
487 3300025915 Ga0207693_10001389 Ga0207693_100013893 149
488 3300025915 Ga0207693_10003329 Ga0207693_100033298 149
489 3300025915 Ga0207693_10013980 Ga0207693_100139803 149
490 3300025917 Ga0207660_10061167 Ga0207660_100611672 149
491 3300025917 Ga0207660_10127706 Ga0207660_101277062 149
492 3300025917 Ga0207660_10294823 Ga0207660_102948232 149
493 3300025917 Ga0207660_10759623 Ga0207660_107596231 149
494 3300025918 Ga0207662_10000219 Ga0207662_1000021923 149
495 3300025918 Ga0207662_10048474 Ga0207662_100484742 149
496 3300025919 Ga0207657_10003532 Ga0207657_100035322 149
497 3300025919 Ga0207657_10012089 Ga0207657_100120896 149
498 3300025920 Ga0207649_10120601 Ga0207649_101206012 149
499 3300025920 Ga0207649_10142448 Ga0207649_101424482 149
500 3300025920 Ga0207649_10885866 Ga0207649_108858661 149
501 3300025921 Ga0207652_10031841 Ga0207652_100318413 149
502 3300025921 Ga0207652_10039661 Ga0207652_100396612 149
503 3300025921 Ga0207652_10042562 Ga0207652_100425622 149
504 3300025921 Ga0207652_10066697 Ga0207652_100666973 149
505 3300025923 Ga0207681_10391696 Ga0207681_103916961 149
506 3300025924 Ga0207694_10038022 Ga0207694_100380224 149
507 3300025924 Ga0207694_10147335 Ga0207694_101473352 149
508 3300025925 Ga0207650_10009061 Ga0207650_100090613 149
509 3300025926 Ga0207659_10060672 Ga0207659_100606724 149
510 3300025926 Ga0207659_10183322 Ga0207659_101833222 149
511 3300025926 Ga0207659_10263314 Ga0207659_102633142 149
512 3300025929 Ga0207664_10080162 Ga0207664_100801622 149
513 3300025929 Ga0207664_10103821 Ga0207664_101038212 149
514 3300025929 Ga0207664_10107277 Ga0207664_101072773 149
515 3300025929 Ga0207664_10193151 Ga0207664_101931512 149
516 3300025929 Ga0207664_11000693 Ga0207664_110006931 149
517 3300025931 Ga0207644_10007296 Ga0207644_100072962 149
518 3300025931 Ga0207644_10010415 Ga0207644_100104154 149
519 3300025932 Ga0207690_10009361 Ga0207690_100093614 149
520 3300025932 Ga0207690_10012020 Ga0207690_100120204 149
521 3300025933 Ga0207706_10054580 Ga0207706_100545803 149
522 3300025933 Ga0207706_10233409 Ga0207706_102334091 149
523 3300025934 Ga0207686_10005571 Ga0207686_100055712 149
524 3300025934 Ga0207686_10063062 Ga0207686_100630621 149
525 3300025935 Ga0207709_10003899 Ga0207709_100038997 149
526 3300025935 Ga0207709_10004724 Ga0207709_100047243 149
527 3300025935 Ga0207709_10045569 Ga0207709_100455692 149
528 3300025936 Ga0207670_10016730 Ga0207670_100167303 149
529 3300025936 Ga0207670_10030395 Ga0207670_100303953 149
530 3300025936 Ga0207670_10061276 Ga0207670_100612762 149
531 3300025936 Ga0207670_10080900 Ga0207670_100809002 149
532 3300025937 Ga0207669_10009055 Ga0207669_100090553 149
533 3300025937 Ga0207669_10095007 Ga0207669_100950072 149
534 3300025938 Ga0207704_10130064 Ga0207704_101300642 149
535 3300025939 Ga0207665_10000662 Ga0207665_1000066210 149
536 3300025939 Ga0207665_10124378 Ga0207665_101243782 149
537 3300025940 Ga0207691_10000885 Ga0207691_1000088513 149
538 3300025940 Ga0207691_10838861 Ga0207691_108388612 149
539 3300025941 Ga0207711_10018008 Ga0207711_100180085 149
540 3300025941 Ga0207711_10827766 Ga0207711_108277662 149
541 3300025942 Ga0207689_10000348 Ga0207689_1000034813 149
542 3300025942 Ga0207689_10089316 Ga0207689_100893162 149
543 3300025944 Ga0207661_10002293 Ga0207661_100022934 149
544 3300025944 Ga0207661_10032802 Ga0207661_100328023 149
545 3300025944 Ga0207661_10943997 Ga0207661_109439972 149
546 3300025945 Ga0207679_10041801 Ga0207679_100418013 149
547 3300025945 Ga0207679_10044842 Ga0207679_100448422 149
548 3300025945 Ga0207679_11214277 Ga0207679_112142772 149
549 3300025949 Ga0207667_10040369 Ga0207667_100403692 149
550 3300025949 Ga0207667_10052119 Ga0207667_100521192 149
551 3300025949 Ga0207667_10273612 Ga0207667_102736121 149
552 3300025949 Ga0207667_10784498 Ga0207667_107844981 149
553 3300025960 Ga0207651_10053757 Ga0207651_100537572 149
554 3300025960 Ga0207651_10952117 Ga0207651_109521172 149
555 3300025961 Ga0207712_10004014 Ga0207712_100040143 149
556 3300025961 Ga0207712_10384456 Ga0207712_103844562 149
557 3300025961 Ga0207712_10902748 Ga0207712_109027482 149
558 3300025972 Ga0207668_10001277 Ga0207668_100012773 149
559 3300025972 Ga0207668_10176389 Ga0207668_101763892 149
560 3300025981 Ga0207640_10162280 Ga0207640_101622802 149
561 3300025981 Ga0207640_10849767 Ga0207640_108497672 149
562 3300025981 Ga0207640_11650068 Ga0207640_116500681 149
563 3300025986 Ga0207658_10043628 Ga0207658_100436282 149
564 3300025986 Ga0207658_10189798 Ga0207658_101897981 149
565 3300025986 Ga0207658_10533896 Ga0207658_105338962 149
566 3300026023 Ga0207677_10045838 Ga0207677_100458382 149
567 3300026023 Ga0207677_10400172 Ga0207677_104001722 149
568 3300026035 Ga0207703_10018706 Ga0207703_100187065 149
569 3300026035 Ga0207703_10092663 Ga0207703_100926632 149
570 3300026035 Ga0207703_10257683 Ga0207703_102576832 149
571 3300026035 Ga0207703_10576085 Ga0207703_105760851 149
572 3300026041 Ga0207639_10100632 Ga0207639_101006321 149
573 3300026041 Ga0207639_10128412 Ga0207639_101284122 149
574 3300026067 Ga0207678_10024974 Ga0207678_100249744 149
575 3300026067 Ga0207678_10034392 Ga0207678_100343923 149
576 3300026067 Ga0207678_10035096 Ga0207678_100350963 149
577 3300026067 Ga0207678_11367442 Ga0207678_113674421 149
578 3300026075 Ga0207708_10194787 Ga0207708_101947872 149
579 3300026075 Ga0207708_10296003 Ga0207708_102960032 149
580 3300026078 Ga0207702_10134036 Ga0207702_101340361 149
581 3300026088 Ga0207641_10013404 Ga0207641_100134043 149
582 3300026088 Ga0207641_10865871 Ga0207641_108658711 149
583 3300026088 Ga0207641_11315153 Ga0207641_113151531 149
584 3300026089 Ga0207648_10090007 Ga0207648_100900071 149
585 3300026089 Ga0207648_10246217 Ga0207648_102462172 149
586 3300026095 Ga0207676_10064325 Ga0207676_100643251 149
587 3300026095 Ga0207676_10083304 Ga0207676_100833042 149
588 3300026116 Ga0207674_10001762 Ga0207674_1000176221 149
589 3300026116 Ga0207674_10148315 Ga0207674_101483152 149
590 3300026116 Ga0207674_10293334 Ga0207674_102933342 149
591 3300026118 Ga0207675_100181619 Ga0207675_1001816192 149
592 3300026121 Ga0207683_10000069 Ga0207683_1000006924 149
593 3300026121 Ga0207683_10001587 Ga0207683_1000158714 149
594 3300026121 Ga0207683_10161969 Ga0207683_101619692 149
595 3300026142 Ga0207698_10211693 Ga0207698_102116932 149
596 3300026142 Ga0207698_10212792 Ga0207698_102127922 149
597 3300026142 Ga0207698_10515015 Ga0207698_105150152 149
598 3300026142 Ga0207698_10820285 Ga0207698_108202851 149
599 3300026142 Ga0207698_11609613 Ga0207698_116096131 149
600 3300027462 Ga0210000_1068497 Ga0210000_10684971 149
601 3300027526 Ga0209968_1049546 Ga0209968_10495461 149
602 3300027617 Ga0210002_1002533 Ga0210002_10025331 149
603 3300027717 Ga0209998_10000492 Ga0209998_100004925 149
604 3300027876 Ga0209974_10013544 Ga0209974_100135442 149
605 3300027876 Ga0209974_10016533 Ga0209974_100165332 149
606 3300027907 Ga0207428_10000987 Ga0207428_1000098724 149
607 3300027907 Ga0207428_10146905 Ga0207428_101469051 149
608 3300028379 Ga0268266_10016263 Ga0268266_100162631 149
609 3300028380 Ga0268265_10058799 Ga0268265_100587993 149
610 3300028381 Ga0268264_10105628 Ga0268264_101056282 149
611 3300028800 Ga0265338_10018308 Ga0265338_100183085 149
612 3300028800 Ga0265338_10116264 Ga0265338_101162643 149
613 3300028800 Ga0265338_10220772 Ga0265338_102207722 149
614 3300031235 Ga0265330_10002724 Ga0265330_100027242 149
615 3300031238 Ga0265332_10035583 Ga0265332_100355832 149
616 3300031238 Ga0265332_10056639 Ga0265332_100566392 149
617 3300031238 Ga0265332_10360111 Ga0265332_103601111 149
618 3300031241 Ga0265325_10034748 Ga0265325_100347482 149
619 3300031241 Ga0265325_10135664 Ga0265325_101356642 149
620 3300031241 Ga0265325_10216973 Ga0265325_102169732 149
621 3300031247 Ga0265340_10025044 Ga0265340_100250442 149
622 3300031247 Ga0265340_10119635 Ga0265340_101196352 149
623 3300031249 Ga0265339_10097306 Ga0265339_100973062 149
624 3300031249 Ga0265339_10318729 Ga0265339_103187292 149
625 3300031250 Ga0265331_10034942 Ga0265331_100349423 149
626 3300031344 Ga0265316_10314627 Ga0265316_103146271 149
627 3300031595 Ga0265313_10010158 Ga0265313_100101585 149
628 3300031595 Ga0265313_10127542 Ga0265313_101275422 149
629 3300031691 Ga0316579_10107784 Ga0316579_101077841 149
630 3300031711 Ga0265314_10007553 Ga0265314_1000755310 149
631 3300031712 Ga0265342_10002003 Ga0265342_1000200312 149
632 3300031728 Ga0316578_10324386 Ga0316578_103243861 149
633 3300034816 Ga0373930_0005010 Ga0373930_0005010_77_526 149
634 3300034816 Ga0373930_0008947 Ga0373930_0008947_93_542 149
635 3300034816 Ga0373930_0018724 Ga0373930_0018724_736_1185 149
636 3300034817 Ga0373948_0002605 Ga0373948_0002605_1411_1860 149
637 3300034817 Ga0373948_0051812 Ga0373948_0051812_363_812 149
638 3300034818 Ga0373950_0002519 Ga0373950_0002519_1746_2195 149
639 3300034819 Ga0373958_0008133 Ga0373958_0008133_148_597 149
640 3300034820 Ga0373959_0008341 Ga0373959_0008341_282_731 149
641 3300034820 Ga0373959_0118661 Ga0373959_0118661_149_598 149
642 3300034957 Ga0373938_0000058 Ga0373938_0000058_8345_8794 149
643 3300035083 Ga0373926_0000688 Ga0373926_0000688_2738_3187 149
644 3300035084 Ga0373928_0000183 Ga0373928_0000183_5377_5826 149
645 3300035084 Ga0373928_0005826 Ga0373928_0005826_421_870 149
646 3300035085 Ga0373929_0000526 Ga0373929_0000526_5618_6067 149
647 3300035086 Ga0373934_0267719 Ga0373934_0267719_147_596 149
648 3300035088 Ga0373940_0000164 Ga0373940_0000164_971_1420 149
649 3300035088 Ga0373940_0016371 Ga0373940_0016371_983_1432 149
650 3300035088 Ga0373940_0204597 Ga0373940_0204597_160_609 149
651 3300035089 Ga0373944_0006754 Ga0373944_0006754_795_1244 149
652 3300035090 Ga0373949_0002161 Ga0373949_0002161_1764_2213 149
653 3300035090 Ga0373949_0006499 Ga0373949_0006499_742_1191 149
654 3300035091 Ga0373951_0000370 Ga0373951_0000370_1095_1544 149
655 3300035091 Ga0373951_0007650 Ga0373951_0007650_1026_1475 149
656 3300035091 Ga0373951_0013394 Ga0373951_0013394_268_717 149
657 3300035092 Ga0373952_0000467 Ga0373952_0000467_806_1255 149
658 3300035092 Ga0373952_0063454 Ga0373952_0063454_10_459 149
659 3300035111 Ga0373923_0000524 Ga0373923_0000524_7018_7467 149
660 3300035112 Ga0373932_0000811 Ga0373932_0000811_2069_2518 149
661 3300035112 Ga0373932_0005150 Ga0373932_0005150_1234_1683 149
662 3300035113 Ga0373936_0000524 Ga0373936_0000524_11672_12121 149
663 3300035114 Ga0373939_0002469 Ga0373939_0002469_3059_3508 149
664 3300035115 Ga0373941_0000450 Ga0373941_0000450_1018_1467 149
665 3300035116 Ga0373945_0001431 Ga0373945_0001431_2330_2779 149
666 3300035117 Ga0373953_0225502 Ga0373953_0225502_93_542 149
667 3300035118 Ga0373954_0003182 Ga0373954_0003182_1668_2117 149
668 3300035119 Ga0373956_0134067 Ga0373956_0134067_80_529 149
669 3300035121 Ga0373960_0001389 Ga0373960_0001389_1825_2274 149
670 3300035170 Ga0373943_0013004 Ga0373943_0013004_482_931 149
671 3300035171 Ga0373946_0002069 Ga0373946_0002069_2846_3295 149
672 3300035172 Ga0373955_0003523 Ga0373955_0003523_6282_6731 149
673 3300035207 Ga0373942_0000555 Ga0373942_0000555_6484_6933 149
674 3300035241 Ga0373961_0000817 Ga0373961_0000817_2927_3376 149
675 3300035242 Ga0373962_0000563 Ga0373962_0000563_4818_5267 149
676 3300035242 Ga0373962_0000865 Ga0373962_0000865_4628_5077 149
677 3300035410 Ga0373924_0017036 Ga0373924_0017036_141_590 149
678 3300035691 Ga0373931_0013723 Ga0373931_0013723_1886_2335 149
679 3300035691 Ga0373931_0015869 Ga0373931_0015869_34_483 149
680 3300035691 Ga0373931_0022095 Ga0373931_0022095_2726_3175 149
681 3300035692 Ga0373935_0019128 Ga0373935_0019128_700_1149 149
682 3300035695 Ga0373927_0011605 Ga0373927_0011605_982_1431 149
683 3300035695 Ga0373927_0143975 Ga0373927_0143975_1079_1528 149
684 3300035724 Ga0373933_0263497 Ga0373933_0263497_83_532 149
685 3300035725 Ga0373947_0033285 Ga0373947_0033285_2111_2560 149
686 3300035725 Ga0373947_0157689 Ga0373947_0157689_646_1095 149
687 3300036401 Ga0373937_0026181 Ga0373937_0026181_2614_3063 149
688 3300036401 Ga0373937_0324758 Ga0373937_0324758_957_1409 149
689 3300037068 Ga0373925_0005122 Ga0373925_0005122_6594_7043 149
690 3300037068 Ga0373925_0234195 Ga0373925_0234195_800_1249 149
691 3300038996 Ga0242420_012832 Ga0242420_012832_699_1148 149
692 3300039447 Ga0436361_0576226 Ga0436361_0576226_1494_1943 149
693 3300041496 Ga0451839_1639025 Ga0451839_1639025_198_647 149
694 3300042005 Ga0439448_0158406 Ga0439448_0158406_293_742 149
695 3300042439 Ga0439464_0036987 Ga0439464_0036987_642_1091 149
696 3300042876 Ga0451577_0012196 Ga0451577_0012196_288_737 149
697 3300045051 Ga0451576_0054208 Ga0451576_0054208_3729_4178 149
698 3300046452 Ga0495617_169873 Ga0495617_169873_51_500 149
699 3300046454 Ga0495592_0044780 Ga0495592_0044780_862_1311 149
700 3300046455 Ga0495603_0016333 Ga0495603_0016333_923_1372 149
701 3300046461 Ga0495641_0007860 Ga0495641_0007860_267_716 149
702 3300046463 Ga0495653_0002576 Ga0495653_0002576_11229_11678 149
703 3300046472 Ga0495580_0074209 Ga0495580_0074209_1861_2310 149
704 3300046473 Ga0495582_0001169 Ga0495582_0001169_7524_7973 149
705 3300046474 Ga0495605_0266587 Ga0495605_0266587_237_686 149
706 3300046475 Ga0495639_0054454 Ga0495639_0054454_482_931 149
707 3300046476 Ga0495662_0008406 Ga0495662_0008406_3203_3652 149
708 3300046477 Ga0495664_0009618 Ga0495664_0009618_2110_2559 149
709 3300046491 Ga0495584_0023810 Ga0495584_0023810_131_580 149
710 3300046492 Ga0495585_0001628 Ga0495585_0001628_14795_15244 149
711 3300046499 Ga0495594_0008935 Ga0495594_0008935_4526_4975 149
712 3300046501 Ga0495607_0017460 Ga0495607_0017460_2080_2529 149
713 3300046511 Ga0495608_0017314 Ga0495608_0017314_3817_4266 149
714 3300046514 Ga0495618_0005710 Ga0495618_0005710_203_652 149
715 3300046516 Ga0495628_0022497 Ga0495628_0022497_2015_2464 149
716 3300046517 Ga0495630_0051023 Ga0495630_0051023_32_481 149
717 3300046520 Ga0495637_0331149 Ga0495637_0331149_48_497 149
718 3300046523 Ga0495644_0005413 Ga0495644_0005413_1808_2257 149
719 3300046525 Ga0495663_0155530 Ga0495663_0155530_237_686 149
720 3300046526 Ga0495666_0002279 Ga0495666_0002279_2318_2767 149
721 3300046529 Ga0495652_0048315 Ga0495652_0048315_2931_3380 149
722 3300046531 Ga0495665_0005343 Ga0495665_0005343_2658_3107 149
723 3300046533 Ga0495640_0317433 Ga0495640_0317433_35_484 149
724 3300046536 Ga0495587_0032694 Ga0495587_0032694_715_1164 149
725 3300046537 Ga0495598_0032005 Ga0495598_0032005_941_1390 149
726 3300046538 Ga0495609_0278873 Ga0495609_0278873_148_597 149
727 3300046543 Ga0495645_0226297 Ga0495645_0226297_748_1197 149
728 3300046557 Ga0495622_0005467 Ga0495622_0005467_2640_3089 149
729 3300046558 Ga0495633_0001638 Ga0495633_0001638_14568_15017 149
730 3300046559 Ga0495667_0002504 Ga0495667_0002504_1684_2133 149
731 3300046615 Ga0495656_0000844 Ga0495656_0000844_1975_2424 149
732 3300046648 Ga0495611_0015637 Ga0495611_0015637_795_1244 149
733 3300046663 Ga0495635_0007089 Ga0495635_0007089_699_1148 149
734 3300046664 Ga0495659_0000812 Ga0495659_0000812_1963_2412 149
735 3300046674 Ga0495588_0000780 Ga0495588_0000780_2318_2767 149
736 3300046674 Ga0495588_0274106 Ga0495588_0274106_392_841 149
737 3300046678 Ga0495599_0010706 Ga0495599_0010706_2432_2881 149
738 3300046681 Ga0495647_0004832 Ga0495647_0004832_1425_1874 149
739 3300046683 Ga0495658_0002231 Ga0495658_0002231_2455_2904 149
740 3300046689 Ga0495613_0004955 Ga0495613_0004955_491_940 149
741 3300046690 Ga0495624_0006812 Ga0495624_0006812_2145_2594 149
742 3300046691 Ga0495670_0001934 Ga0495670_0001934_2498_2947 149
743 3300046809 Ga0495600_0033824 Ga0495600_0033824_2680_3129 149
744 3300047315 Ga0495581_0005546 Ga0495581_0005546_1832_2281 149
745 3300047317 Ga0495604_0015259 Ga0495604_0015259_2116_2565 149
746 3300047319 Ga0495674_0119959 Ga0495674_0119959_482_931 149
747 3300047321 Ga0495676_0063761 Ga0495676_0063761_572_1021 149
748 3300047321 Ga0495676_0114885 Ga0495676_0114885_121_570 149
749 3300047322 Ga0495680_0026301 Ga0495680_0026301_1865_2314 149
750 3300047444 Ga0495675_0025080 Ga0495675_0025080_2666_3115 149
751 3300047446 Ga0495679_076272 Ga0495679_076272_89_538 149
752 3300047471 Ga0495684_0005442 Ga0495684_0005442_8977_9426 149
753 3300047673 Ga0495593_0010044 Ga0495593_0010044_2547_2996 149
754 3300048089 Ga0495614_0006166 Ga0495614_0006166_2389_2838 149
755 3300048903 Ga0496100_0012687 Ga0496100_0012687_1675_2124 149
756 3300048903 Ga0496100_1122334 Ga0496100_1122334_141_590 149
757 3300048904 Ga0496101_0873105 Ga0496101_0873105_146_595 149
758 3300048904 Ga0496101_0946955 Ga0496101_0946955_72_521 149
759 3300048905 Ga0496102_0113055 Ga0496102_0113055_104_553 149
760 3300048905 Ga0496102_0389225 Ga0496102_0389225_706_1155 149
761 3300048906 Ga0496103_0050447 Ga0496103_0050447_1969_2418 149
762 3300048906 Ga0496103_0145462 Ga0496103_0145462_909_1358 149
763 3300048907 Ga0496104_0195722 Ga0496104_0195722_672_1121 149
764 3300048907 Ga0496104_0294781 Ga0496104_0294781_157_606 149
765 3300048908 Ga0496105_0111266 Ga0496105_0111266_1139_1588 149
766 3300048908 Ga0496105_0317621 Ga0496105_0317621_183_632 149
767 3300048908 Ga0496105_0466156 Ga0496105_0466156_390_839 149
768 3300048909 Ga0496106_0041267 Ga0496106_0041267_2313_2762 149
769 3300048909 Ga0496106_0123244 Ga0496106_0123244_1404_1853 149
770 3300048909 Ga0496106_0152321 Ga0496106_0152321_1317_1766 149
771 3300048910 Ga0496107_0045547 Ga0496107_0045547_371_820 149
772 3300048910 Ga0496107_0082706 Ga0496107_0082706_260_709 149
773 3300048910 Ga0496107_0089779 Ga0496107_0089779_1150_1599 149
774 3300048911 Ga0496108_0050233 Ga0496108_0050233_1936_2385 149
775 3300048911 Ga0496108_0065764 Ga0496108_0065764_1469_1918 149
776 3300048911 Ga0496108_0074924 Ga0496108_0074924_285_734 149
777 3300048911 Ga0496108_0242923 Ga0496108_0242923_744_1193 149
778 3300048912 Ga0496109_0002090 Ga0496109_0002090_12117_12566 149
779 3300048912 Ga0496109_0002254 Ga0496109_0002254_8187_8636 149
780 3300048912 Ga0496109_0102967 Ga0496109_0102967_1137_1586 149
781 3300048912 Ga0496109_0117084 Ga0496109_0117084_1019_1468 149
782 3300048912 Ga0496109_0475035 Ga0496109_0475035_219_668 149
783 3300048913 Ga0496110_1805656 Ga0496110_1805656_37_486 149
784 3300048914 Ga0496111_0025885 Ga0496111_0025885_1083_1532 149
785 3300048914 Ga0496111_0029383 Ga0496111_0029383_1466_1915 149
786 3300048914 Ga0496111_0224739 Ga0496111_0224739_179_628 149
787 3300048914 Ga0496111_0465298 Ga0496111_0465298_161_610 149
788 3300048915 Ga0496112_0066287 Ga0496112_0066287_2707_3156 149
789 3300048916 Ga0496113_0014345 Ga0496113_0014345_3793_4242 149
790 3300048916 Ga0496113_0361553 Ga0496113_0361553_673_1122 149
791 3300048916 Ga0496113_0368712 Ga0496113_0368712_692_1141 149
792 3300048917 Ga0496114_0016534 Ga0496114_0016534_4627_5076 149
793 3300048918 Ga0496115_0021801 Ga0496115_0021801_1376_1825 149
794 3300048918 Ga0496115_0042365 Ga0496115_0042365_240_689 149
795 3300048918 Ga0496115_0263393 Ga0496115_0263393_206_655 149
796 3300048929 Ga0496126_0550261 Ga0496126_0550261_68_517 149
797 3300049569 Ga0501032_0360168 Ga0501032_0360168_162_677 149
798 3300049570 Ga0501033_0208255 Ga0501033_0208255_543_992 149
799 3300049570 Ga0501033_0637071 Ga0501033_0637071_260_709 149
800 3300049571 Ga0501034_0153702 Ga0501034_0153702_1151_1600 149
801 3300049573 Ga0501037_0029345 Ga0501037_0029345_3272_3787 149
802 3300049574 Ga0501038_0113764 Ga0501038_0113764_724_1173 149
803 3300049574 Ga0501038_0324893 Ga0501038_0324893_357_809 149
804 3300049575 Ga0501039_0694907 Ga0501039_0694907_186_638 149
805 3300049580 Ga0501046_0456108 Ga0501046_0456108_179_628 149
806 3300049581 Ga0501047_0069693 Ga0501047_0069693_2494_2943 149
807 3300049581 Ga0501047_0465796 Ga0501047_0465796_153_602 149
808 3300049581 Ga0501047_0552002 Ga0501047_0552002_112_561 149
809 3300049583 Ga0501067_0156732 Ga0501067_0156732_323_838 149
810 3300049584 Ga0501068_0160356 Ga0501068_0160356_396_848 149
811 3300049586 Ga0501070_0084445 Ga0501070_0084445_2137_2586 149
812 3300049586 Ga0501070_0351222 Ga0501070_0351222_665_1114 149
813 3300049586 Ga0501070_1025133 Ga0501070_1025133_136_585 149
814 3300049588 Ga0501072_0323739 Ga0501072_0323739_361_813 149
815 3300049589 Ga0501073_0046085 Ga0501073_0046085_1145_1594 149
816 3300049590 Ga0501074_0083203 Ga0501074_0083203_196_645 149
817 3300049590 Ga0501074_0101568 Ga0501074_0101568_750_1199 149
818 3300049592 Ga0501076_0057558 Ga0501076_0057558_389_838 149
819 3300049592 Ga0501076_1109858 Ga0501076_1109858_145_597 149
820 3300049741 Ga0501079_0221647 Ga0501079_0221647_325_840 149
821 3300049741 Ga0501079_0300372 Ga0501079_0300372_449_898 149
822 3300049741 Ga0501079_0336165 Ga0501079_0336165_273_722 149
823 3300049742 Ga0501080_0058679 Ga0501080_0058679_934_1383 149
824 3300049744 Ga0501083_0079439 Ga0501083_0079439_1152_1601 149
825 3300049823 Ga0501044_0089132 Ga0501044_0089132_58_507 149
826 3300049823 Ga0501044_0093101 Ga0501044_0093101_1915_2364 149
827 3300050490 nmdc:mga03n38_208105_c1 nmdc:mga03n38_208105_c1_211_660 149
828 3300050492 nmdc:mga0yw44_1092226_c1 nmdc:mga0yw44_1092226_c1_55_504 149
829 3300050507 nmdc:mga05p37_133968_c1 nmdc:mga05p37_133968_c1_470_919 149
830 3300050511 nmdc:mga08y16_10396_c1 nmdc:mga08y16_10396_c1_9298_9747 149
831 3300050511 nmdc:mga08y16_60189_c1 nmdc:mga08y16_60189_c1_46_495 149
832 3300050512 nmdc:mga0n895_118965_c1 nmdc:mga0n895_118965_c1_2184_2633 149
833 3300050512 nmdc:mga0n895_191724_c1 nmdc:mga0n895_191724_c1_1061_1510 149
834 3300050512 nmdc:mga0n895_45193_c1 nmdc:mga0n895_45193_c1_1523_1972 149
835 3300050512 nmdc:mga0n895_459471_c1 nmdc:mga0n895_459471_c1_585_1034 149
836 3300050513 nmdc:mga0rr50_170766_c1 nmdc:mga0rr50_170766_c1_1075_1524 149
837 3300050513 nmdc:mga0rr50_41470_c1 nmdc:mga0rr50_41470_c1_1423_1872 149
838 3300050514 nmdc:mga08x19_36813_c1 nmdc:mga08x19_36813_c1_1527_1976 149
839 3300050514 nmdc:mga08x19_44829_c1 nmdc:mga08x19_44829_c1_644_1093 149
840 3300053077 Ga0495601_0007242 Ga0495601_0007242_3572_4021 149
841 3300053078 Ga0495612_0001030 Ga0495612_0001030_2118_2567 149
842 3300053084 Ga0495595_0004950 Ga0495595_0004950_720_1169 149
843 3300053085 Ga0495619_0070742 Ga0495619_0070742_1850_2299 149
844 3300053088 Ga0500644_0002792 Ga0500644_0002792_3204_3653 149
845 3300053093 Ga0500651_0135371 Ga0500651_0135371_131_580 149
846 3300053098 Ga0500650_0203447 Ga0500650_0203447_251_700 149
847 3300053131 Ga0500652_006245 Ga0500652_006245_2874_3323 149
848 3300053153 Ga0500616_0000001 Ga0500616_0000001_1761834_1762283 149
849 3300053730 Ga0500645_000050 Ga0500645_000050_79927_80376 149
850 3300054114 Ga0501084_0141228 Ga0501084_0141228_606_1055 149
851 3300054114 Ga0501084_0260907 Ga0501084_0260907_697_1146 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18856

baeRF_family12

Bacterial archaeo-eukaryotic release factor family 12

32

168

0.99

PF10116

Host_attach

Protein required for attachment to host cells

33

168

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l20-assembly1.cif.gz_A crystal structure of a clostripain (bt_0727) from bacteroides thetaiotaomicron atcc 29148 in complex with peptide inhibitor btn-vltk-aomk 0.7447 11 41
2ex4-assembly1.cif.gz_B crystal structure of human methyltransferase ad-003 in complex with s-adenosyl-l-homocysteine 0.7353 97 137
5dmq-assembly1.cif.gz_B crystal structure of mouse erf1 in complex with reverse transcriptase (rt) of moloney murine leukemia virus 0.7336 11 148
6kdq-assembly1.cif.gz_A crystal structure of human nrmt1 in complex with alpha-n-monomethylated human cenp-a peptide 0.7324 97 137
6wh8-assembly1.cif.gz_B the structure of ntmt1 in complex with compound bm-30 0.7316 97 137
ID Description Score Start End Superfamily
af_Q19954_249_645_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7643 11 41 1.25.40.10
af_Q8SX44_133_405_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.708 18 41 2.130.10.10
af_Q57638_132_252_3.30.420.60 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;eRF1 domain 2 0.7045 11 145 3.30.420.60
af_Q08226_252_415_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.697 13 41 2.130.10.10
af_Q4DP40_365_536_3.40.50.11350 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6948 83 128 3.40.50.11350
ID Description Score Start End GO Terms
AF-A0A435LS04-F1-model_v4 deleted 0.9428 61 149
AF-A0A435LS04-F1-model_v4 deleted 0.9325 61 149
AF-A0A371WHU5-F1-model_v4 Host attachment protein 0.9241 2 147
AF-A0A840HNC6-F1-model_v4 Protein required for attachment to host cells 0.924 65 146
AF-A0A521VXU4-F1-model_v4 Host attachment protein 0.9205 1 149

Feature Viewer

pLDDT pTM Quality
78.9 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map