F483497

General Info

Members Datasets Scaffolds Average Seq Length
852 241 1704 407

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10014894|Ga0157373_100148943
Length 447
Sequence MRHSDLNSVSGVFIILPPACRPGRASPQPRIEGDDRMSLIADLKSLEPQQRSAIWASYLGWTLDAFDYFLMVFMLKAIAAEFGTDISAVSSAVFLTLAARPIGAFVFGWLAEHLGRRPVLMADIILFSIFEFASGFAPSLTSLLVLRFLFGIAMGGEWGLGASLVMESIPARLRGPVSGLLQSGYPSGYFVASIVYFLLFDTIGWRGMFMVGVAPALLVLLIRIYVKESPVFEAQRGKKRANPVAELLRYWKIALYMIVLMAAFNAFSHGTQDLYPTFLQQQHHYDTHTTGILTAIMNLGAIVGGIGFGIWSERLGRKRAIIIASILALPVIPLWAFASTPLLLAIGAFLMQVAVQGAWGIVPVHLNELSPPAARALFPGFAYQLGNLIMSKNAVFQAQIAESHGNNYGLALAIFGGSMAVVIVVWTAFGPERKEADFIADARAAET

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
102 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
103 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
104 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 5.52
Rhizosphere 93.78
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10014894 3300013100 Bacteria 5694
2 LJNas_1001617 3300000546 Bacteria 3073
3 JGI24741J21665_1007592 3300001915 Bacteria 2096
4 JGI24740J21852_10003203 3300001979 Bacteria 7222
5 JGI24740J21852_10021050 3300001979 Bacteria 2266
6 JGI24740J21852_10024635 3300001979 Bacteria 2039
7 JGI24739J22299_10004897 3300001989 Bacteria 5100
8 JGI24739J22299_10006120 3300001989 Bacteria 4547
9 JGI24737J22298_10001320 3300001990 Bacteria 8787
10 JGI24737J22298_10001643 3300001990 Bacteria 7973
11 JGI24737J22298_10010439 3300001990 Bacteria 3065
12 JGI24744J21845_10000004 3300002077 Bacteria 25863
13 JGI24742J22300_10010138 3300002244 Bacteria 1557
14 Ga0065715_10037121 3300005293 Bacteria 1477
15 Ga0070658_10000360 3300005327 Bacteria 39619
16 Ga0070658_10000743 3300005327 Bacteria 27964
17 Ga0070658_10000999 3300005327 Bacteria 24269
18 Ga0070658_10047112 3300005327 Bacteria 3488
19 Ga0070658_10075199 3300005327 Bacteria 2770
20 Ga0070658_10089199 3300005327 Bacteria 2539
21 Ga0070658_10094152 3300005327 Bacteria 2471
22 Ga0070658_10099086 3300005327 Bacteria 2408
23 Ga0070658_10211125 3300005327 Bacteria 1640
24 Ga0070658_10320879 3300005327 Bacteria 1323
25 Ga0070683_100000348 3300005329 Bacteria 31815
26 Ga0070683_100018151 3300005329 Bacteria 6226
27 Ga0070683_100023100 3300005329 Bacteria 5561
28 Ga0070683_100103155 3300005329 Bacteria 2687
29 Ga0070683_100103441 3300005329 Bacteria 2684
30 Ga0070690_100065591 3300005330 Bacteria 2348
31 Ga0070670_100003619 3300005331 Bacteria 12864
32 Ga0070670_100017820 3300005331 Bacteria 6094
33 Ga0070677_10034494 3300005333 Bacteria 1956
34 Ga0070666_10000361 3300005335 Bacteria 28647
35 Ga0070666_10002549 3300005335 Bacteria 11021
36 Ga0070666_10016340 3300005335 Bacteria 4747
37 Ga0070666_10037158 3300005335 Bacteria 3237
38 Ga0070680_100003113 3300005336 Bacteria 12313
39 Ga0070680_100023043 3300005336 Bacteria 4962
40 Ga0070680_100025180 3300005336 Bacteria 4754
41 Ga0070680_100038713 3300005336 Bacteria 3858
42 Ga0070682_100023814 3300005337 Bacteria 3639
43 Ga0070660_100000075 3300005339 Bacteria 59407
44 Ga0070660_100000085 3300005339 Bacteria 56233
45 Ga0070660_100004364 3300005339 Bacteria 9768
46 Ga0070660_100013229 3300005339 Bacteria 5913
47 Ga0070660_100020568 3300005339 Bacteria 4852
48 Ga0070660_100038463 3300005339 Bacteria 3632
49 Ga0070660_100041827 3300005339 Bacteria 3494
50 Ga0070660_100054919 3300005339 Bacteria 3077
51 Ga0070660_100063218 3300005339 Bacteria 2877
52 Ga0070689_100007712 3300005340 Bacteria 7540
53 Ga0070687_100038429 3300005343 Bacteria 2399
54 Ga0070661_100000273 3300005344 Bacteria 41798
55 Ga0070661_100005367 3300005344 Bacteria 8836
56 Ga0070661_100015698 3300005344 Bacteria 5346
57 Ga0070661_100019668 3300005344 Bacteria 4812
58 Ga0070661_100066607 3300005344 Bacteria 2646
59 Ga0070661_100072884 3300005344 Bacteria 2528
60 Ga0070661_100087715 3300005344 Bacteria 2302
61 Ga0070661_100095137 3300005344 Bacteria 2209
62 Ga0070661_100102671 3300005344 Bacteria 2129
63 Ga0070692_10010244 3300005345 Bacteria 4259
64 Ga0070692_10027385 3300005345 Bacteria 2824
65 Ga0070668_100048786 3300005347 Bacteria 3256
66 Ga0070669_100000223 3300005353 Bacteria 47302
67 Ga0070669_100049969 3300005353 Bacteria 3054
68 Ga0070675_100007141 3300005354 Bacteria 8604
69 Ga0070675_100054340 3300005354 Bacteria 3295
70 Ga0070675_100143386 3300005354 Bacteria 2043
71 Ga0070671_100000203 3300005355 Bacteria 39672
72 Ga0070671_100005825 3300005355 Bacteria 9817
73 Ga0070671_100007366 3300005355 Bacteria 8789
74 Ga0070671_100020491 3300005355 Bacteria 5393
75 Ga0070671_100020894 3300005355 Bacteria 5340
76 Ga0070671_100038153 3300005355 Bacteria 3988
77 Ga0070671_100046922 3300005355 Bacteria 3593
78 Ga0070671_100306176 3300005355 Bacteria 1353
79 Ga0070674_100010177 3300005356 Bacteria 5667
80 Ga0070674_100045871 3300005356 Bacteria 2987
81 Ga0070673_100001900 3300005364 Bacteria 12530
82 Ga0070673_100089442 3300005364 Bacteria 2513
83 Ga0070673_100210141 3300005364 Bacteria 1680
84 Ga0070688_100000374 3300005365 Bacteria 22697
85 Ga0070659_100000084 3300005366 Bacteria 71138
86 Ga0070659_100001028 3300005366 Bacteria 20424
87 Ga0070659_100005791 3300005366 Bacteria 8897
88 Ga0070659_100006706 3300005366 Bacteria 8325
89 Ga0070659_100016958 3300005366 Bacteria 5475
90 Ga0070659_100045177 3300005366 Bacteria 3450
91 Ga0070659_100080452 3300005366 Bacteria 2601
92 Ga0070659_100085542 3300005366 Bacteria 2522
93 Ga0070659_100095351 3300005366 Bacteria 2390
94 Ga0070659_100103374 3300005366 Bacteria 2294
95 Ga0070667_100007738 3300005367 Bacteria 8909
96 Ga0070667_100008302 3300005367 Bacteria 8608
97 Ga0070667_100026745 3300005367 Bacteria 4801
98 Ga0070667_100028226 3300005367 Bacteria 4671
99 Ga0070667_100051297 3300005367 Bacteria 3478
100 Ga0070709_10000022 3300005434 Bacteria 135498
101 Ga0070709_10000563 3300005434 Bacteria 21656
102 Ga0070709_10012639 3300005434 Bacteria 4728
103 Ga0070709_10019688 3300005434 Bacteria 3905
104 Ga0070714_100051939 3300005435 Bacteria 3495
105 Ga0070714_100053434 3300005435 Bacteria 3448
106 Ga0070714_100061763 3300005435 Unclassified 3219
107 Ga0070714_100072338 3300005435 Bacteria 2984
108 Ga0070714_100139711 3300005435 Bacteria 2173
109 Ga0070714_100223734 3300005435 Bacteria 1731
110 Ga0070713_100000021 3300005436 Bacteria 107806
111 Ga0070713_100000203 3300005436 Bacteria 39626
112 Ga0070713_100015342 3300005436 Bacteria 5722
113 Ga0070713_100018456 3300005436 Bacteria 5301
114 Ga0070713_100168170 3300005436 Unclassified 1962
115 Ga0070713_100333412 3300005436 Bacteria 1404
116 Ga0070710_10003233 3300005437 Bacteria 7717
117 Ga0070710_10082470 3300005437 Bacteria 1880
118 Ga0070701_10006994 3300005438 Bacteria 4784
119 Ga0070711_100000077 3300005439 Bacteria 54563
120 Ga0070711_100012307 3300005439 Bacteria 5338
121 Ga0070694_100048112 3300005444 Bacteria 2868
122 Ga0070708_100104197 3300005445 Bacteria 2601
123 Ga0070663_100009524 3300005455 Bacteria 6018
124 Ga0070663_100011408 3300005455 Bacteria 5577
125 Ga0070663_100019027 3300005455 Bacteria 4516
126 Ga0070663_100047093 3300005455 Bacteria 3054
127 Ga0070663_100048650 3300005455 Bacteria 3007
128 Ga0070663_100202163 3300005455 Bacteria 1551
129 Ga0070678_100000630 3300005456 Bacteria 17294
130 Ga0070662_100000058 3300005457 Bacteria 59818
131 Ga0070662_100052178 3300005457 Bacteria 2955
132 Ga0070662_100136191 3300005457 Bacteria 1899
133 Ga0070681_10018435 3300005458 Bacteria 6976
134 Ga0070681_10055945 3300005458 Bacteria 3926
135 Ga0070681_10102537 3300005458 Bacteria 2806
136 Ga0070681_10228626 3300005458 Bacteria 1774
137 Ga0070685_10001541 3300005466 Bacteria 12156
138 Ga0070706_100016985 3300005467 Bacteria 6722
139 Ga0070706_100021658 3300005467 Bacteria 5920
140 Ga0070707_100054897 3300005468 Bacteria 3820
141 Ga0070699_100017663 3300005518 Bacteria 6124
142 Ga0070699_100034322 3300005518 Bacteria 4384
143 Ga0070679_100009124 3300005530 Bacteria 9362
144 Ga0070679_100018253 3300005530 Bacteria 6804
145 Ga0070679_100065031 3300005530 Bacteria 3635
146 Ga0070679_100089656 3300005530 Bacteria 3062
147 Ga0070679_100100180 3300005530 Bacteria 2884
148 Ga0070679_100107772 3300005530 Bacteria 2772
149 Ga0070679_100266376 3300005530 Bacteria 1668
150 Ga0070684_100002051 3300005535 Bacteria 14834
151 Ga0070684_100010435 3300005535 Bacteria 7360
152 Ga0070684_100020947 3300005535 Bacteria 5428
153 Ga0068853_100000039 3300005539 Bacteria 107039
154 Ga0068853_100000223 3300005539 Bacteria 40165
155 Ga0068853_100001982 3300005539 Bacteria 15099
156 Ga0068853_100009358 3300005539 Bacteria 7899
157 Ga0068853_100009546 3300005539 Bacteria 7817
158 Ga0068853_100023634 3300005539 Bacteria 5148
159 Ga0068853_100035596 3300005539 Bacteria 4230
160 Ga0070672_100005790 3300005543 Bacteria 8242
161 Ga0070672_100201127 3300005543 Bacteria 1666
162 Ga0070693_100002238 3300005547 Bacteria 8882
163 Ga0070665_100004855 3300005548 Bacteria 13970
164 Ga0070665_100056169 3300005548 Bacteria 3948
165 Ga0070665_100081333 3300005548 Bacteria 3245
166 Ga0070665_100314707 3300005548 Bacteria 1569
167 Ga0068855_100001063 3300005563 Bacteria 34041
168 Ga0068855_100001315 3300005563 Bacteria 30794
169 Ga0068855_100003197 3300005563 Bacteria 20063
170 Ga0068855_100005593 3300005563 Bacteria 15339
171 Ga0068855_100011514 3300005563 Bacteria 10689
172 Ga0068855_100012825 3300005563 Bacteria 10112
173 Ga0068855_100018966 3300005563 Bacteria 8270
174 Ga0068855_100026375 3300005563 Bacteria 6950
175 Ga0068855_100041231 3300005563 Bacteria 5472
176 Ga0068855_100046984 3300005563 Bacteria 5102
177 Ga0068855_100057892 3300005563 Bacteria 4542
178 Ga0068855_100165480 3300005563 Bacteria 2507
179 Ga0068855_100172350 3300005563 Bacteria 2450
180 Ga0070664_100000032 3300005564 Bacteria 88298
181 Ga0070664_100006415 3300005564 Bacteria 9489
182 Ga0070664_100012600 3300005564 Bacteria 6881
183 Ga0070664_100096199 3300005564 Bacteria 2569
184 Ga0070664_100102747 3300005564 Bacteria 2487
185 Ga0070664_100107599 3300005564 Bacteria 2431
186 Ga0070664_100185018 3300005564 Bacteria 1853
187 Ga0068857_100004731 3300005577 Bacteria 11533
188 Ga0068857_100019952 3300005577 Bacteria 5891
189 Ga0068857_100091760 3300005577 Bacteria 2719
190 Ga0068857_100098639 3300005577 Bacteria 2620
191 Ga0068854_100000314 3300005578 Bacteria 31949
192 Ga0068854_100001532 3300005578 Bacteria 14025
193 Ga0068854_100016199 3300005578 Bacteria 4962
194 Ga0068854_100020640 3300005578 Bacteria 4462
195 Ga0068854_100024262 3300005578 Bacteria 4150
196 Ga0068854_100054774 3300005578 Bacteria 2870
197 Ga0068854_100118287 3300005578 Bacteria 2007
198 Ga0068856_100000161 3300005614 Bacteria 69696
199 Ga0068856_100001238 3300005614 Bacteria 26796
200 Ga0068856_100007720 3300005614 Bacteria 10503
201 Ga0068856_100026871 3300005614 Bacteria 5613
202 Ga0068856_100076712 3300005614 Bacteria 3311
203 Ga0068856_100078842 3300005614 Bacteria 3265
204 Ga0068856_100132313 3300005614 Bacteria 2499
205 Ga0068856_100197811 3300005614 Bacteria 2024
206 Ga0068856_100257849 3300005614 Bacteria 1759
207 Ga0068856_100306126 3300005614 Bacteria 1607
208 Ga0068852_100002985 3300005616 Bacteria 11756
209 Ga0068852_100013842 3300005616 Bacteria 6186
210 Ga0068852_100018448 3300005616 Bacteria 5497
211 Ga0068852_100020755 3300005616 Bacteria 5227
212 Ga0068852_100021513 3300005616 Bacteria 5153
213 Ga0068852_100030605 3300005616 Bacteria 4434
214 Ga0068852_100308124 3300005616 Bacteria 1534
215 Ga0068859_100017524 3300005617 Bacteria 7200
216 Ga0068859_100027593 3300005617 Bacteria 5694
217 Ga0068859_100031437 3300005617 Bacteria 5332
218 Ga0068864_100002932 3300005618 Bacteria 14102
219 Ga0068864_100006287 3300005618 Bacteria 9743
220 Ga0068864_100017685 3300005618 Bacteria 5946
221 Ga0068864_100101547 3300005618 Bacteria 2551
222 Ga0068866_10041703 3300005718 Bacteria 2279
223 Ga0068851_10028353 3300005834 Bacteria 2766
224 Ga0068851_10034363 3300005834 Bacteria 2530
225 Ga0068863_100008593 3300005841 Bacteria 9982
226 Ga0068863_100032339 3300005841 Bacteria 4986
227 Ga0068863_100074402 3300005841 Bacteria 3214
228 Ga0068863_100147519 3300005841 Bacteria 2250
229 Ga0068863_100157624 3300005841 Bacteria 2174
230 Ga0068858_100001179 3300005842 Bacteria 27095
231 Ga0068858_100003126 3300005842 Bacteria 16570
232 Ga0068858_100041193 3300005842 Bacteria 4283
233 Ga0068858_100069930 3300005842 Bacteria 3254
234 Ga0068858_100308446 3300005842 Bacteria 1511
235 Ga0068862_100176218 3300005844 Bacteria 1917
236 Ga0081539_10037046 3300005985 Bacteria 2910
237 Ga0070717_10004377 3300006028 Bacteria 10194
238 Ga0070717_10005493 3300006028 Bacteria 9252
239 Ga0070717_10013650 3300006028 Bacteria 6231
240 Ga0070717_10024489 3300006028 Bacteria 4793
241 Ga0070717_10056548 3300006028 Bacteria 3241
242 Ga0070717_10058540 3300006028 Unclassified 3186
243 Ga0070717_10122762 3300006028 Bacteria 2227
244 Ga0070716_100000377 3300006173 Bacteria 18215
245 Ga0070716_100000838 3300006173 Bacteria 13275
246 Ga0070716_100015929 3300006173 Bacteria 3873
247 Ga0070712_100000425 3300006175 Bacteria 24222
248 Ga0070712_100000440 3300006175 Bacteria 23727
249 Ga0070712_100005709 3300006175 Bacteria 7696
250 Ga0070712_100021452 3300006175 Unclassified 4242
251 Ga0070712_100149460 3300006175 Bacteria 1792
252 Ga0097621_100004933 3300006237 Bacteria 9362
253 Ga0097621_100143394 3300006237 Bacteria 2043
254 Ga0068871_100008802 3300006358 Bacteria 7271
255 Ga0068871_100026938 3300006358 Bacteria 4491
256 Ga0068871_100060747 3300006358 Bacteria 3084
257 Ga0068871_100174763 3300006358 Bacteria 1843
258 Ga0075434_100195250 3300006871 Bacteria 2044
259 Ga0097620_100017524 3300006931 Bacteria 7200
260 Ga0097620_100027593 3300006931 Bacteria 5694
261 Ga0097620_100031437 3300006931 Bacteria 5332
262 Ga0075435_100042914 3300007076 Bacteria 3619
263 Ga0099795_10002513 3300007788 Bacteria 4335
264 Ga0105240_10006207 3300009093 Bacteria 17584
265 Ga0105240_10017834 3300009093 Bacteria 9552
266 Ga0105240_10029819 3300009093 Bacteria 7100
267 Ga0105240_10038385 3300009093 Bacteria 6143
268 Ga0105240_10039803 3300009093 Bacteria 6017
269 Ga0105240_10086501 3300009093 Bacteria 3839
270 Ga0105240_10103756 3300009093 Bacteria 3453
271 Ga0105240_10118247 3300009093 Bacteria 3194
272 Ga0105245_10029098 3300009098 Bacteria 4879
273 Ga0105243_10019943 3300009148 Bacteria 5084
274 Ga0105241_10157266 3300009174 Bacteria 1865
275 Ga0105248_10000223 3300009177 Bacteria 65010
276 Ga0105248_10000678 3300009177 Bacteria 38605
277 Ga0105248_10002629 3300009177 Bacteria 19979
278 Ga0105248_10018018 3300009177 Bacteria 7795
279 Ga0105248_10023133 3300009177 Bacteria 6902
280 Ga0105248_10057947 3300009177 Bacteria 4349
281 Ga0105248_10063204 3300009177 Bacteria 4155
282 Ga0105248_10069080 3300009177 Bacteria 3967
283 Ga0105248_10080965 3300009177 Bacteria 3651
284 Ga0105237_10011865 3300009545 Bacteria 9214
285 Ga0105237_10059585 3300009545 Bacteria 3819
286 Ga0105238_10014708 3300009551 Bacteria 7913
287 Ga0105238_10026598 3300009551 Bacteria 5899
288 Ga0105238_10140706 3300009551 Bacteria 2390
289 Ga0105238_10238552 3300009551 Bacteria 1796
290 Ga0105249_10222332 3300009553 Bacteria 1858
291 Ga0105246_10000072 3300011119 Bacteria 41904
292 Ga0105246_10006938 3300011119 Bacteria 6932
293 Ga0105246_10043671 3300011119 Bacteria 3042
294 Ga0157373_10008901 3300013100 Bacteria 7428
295 Ga0157373_10020087 3300013100 Bacteria 4859
296 Ga0157373_10021720 3300013100 Bacteria 4658
297 Ga0157373_10125616 3300013100 Bacteria 1804
298 Ga0157373_10141875 3300013100 Bacteria 1690
299 Ga0157373_10186021 3300013100 Bacteria 1463
300 Ga0157371_10001103 3300013102 Bacteria 29269
301 Ga0157371_10001297 3300013102 Bacteria 26313
302 Ga0157371_10003962 3300013102 Bacteria 13135
303 Ga0157371_10007626 3300013102 Bacteria 8729
304 Ga0157371_10011159 3300013102 Bacteria 6949
305 Ga0157371_10012119 3300013102 Bacteria 6605
306 Ga0157371_10021573 3300013102 Bacteria 4727
307 Ga0157371_10022459 3300013102 Bacteria 4624
308 Ga0157371_10024032 3300013102 Bacteria 4452
309 Ga0157371_10032066 3300013102 Bacteria 3782
310 Ga0157371_10043946 3300013102 Bacteria 3182
311 Ga0157371_10056891 3300013102 Bacteria 2774
312 Ga0157371_10065238 3300013102 Bacteria 2579
313 Ga0157370_10001094 3300013104 Bacteria 33972
314 Ga0157370_10004189 3300013104 Bacteria 16690
315 Ga0157370_10018716 3300013104 Bacteria 6964
316 Ga0157370_10047298 3300013104 Bacteria 4124
317 Ga0157370_10059417 3300013104 Bacteria 3633
318 Ga0157370_10172510 3300013104 Bacteria 2010
319 Ga0157369_10000141 3300013105 Bacteria 102055
320 Ga0157369_10001072 3300013105 Bacteria 34302
321 Ga0157369_10001999 3300013105 Bacteria 24545
322 Ga0157369_10004058 3300013105 Bacteria 17343
323 Ga0157369_10006247 3300013105 Bacteria 13824
324 Ga0157369_10006378 3300013105 Bacteria 13682
325 Ga0157369_10014521 3300013105 Bacteria 8887
326 Ga0157369_10015998 3300013105 Bacteria 8442
327 Ga0157369_10053969 3300013105 Bacteria 4340
328 Ga0157369_10073116 3300013105 Bacteria 3679
329 Ga0157374_10001508 3300013296 Bacteria 19606
330 Ga0157374_10049268 3300013296 Bacteria 3912
331 Ga0157374_10053261 3300013296 Bacteria 3772
332 Ga0157374_10086814 3300013296 Bacteria 2977
333 Ga0157374_10104402 3300013296 Bacteria 2720
334 Ga0157378_10063467 3300013297 Bacteria 3301
335 Ga0163162_10002279 3300013306 Bacteria 18008
336 Ga0163162_10038319 3300013306 Bacteria 4784
337 Ga0163162_10063884 3300013306 Bacteria 3725
338 Ga0157372_10002710 3300013307 Bacteria 19159
339 Ga0157372_10010724 3300013307 Bacteria 9754
340 Ga0157372_10025893 3300013307 Bacteria 6380
341 Ga0157372_10160985 3300013307 Bacteria 2594
342 Ga0157375_10001921 3300013308 Bacteria 17878
343 Ga0157375_10065270 3300013308 Bacteria 3628
344 Ga0157375_10507883 3300013308 Bacteria 1369
345 Ga0163163_10000567 3300014325 Bacteria 32441
346 Ga0163163_10002130 3300014325 Bacteria 16711
347 Ga0163163_10053966 3300014325 Bacteria 3969
348 Ga0163163_10082522 3300014325 Bacteria 3218
349 Ga0157380_10151404 3300014326 Bacteria 2006
350 Ga0182008_10016095 3300014497 Bacteria 3892
351 Ga0157379_10000861 3300014968 Bacteria 24618
352 Ga0206356_10378585 3300020070 Bacteria 2505
353 Ga0206354_10978830 3300020081 Bacteria 1967
354 Ga0213871_10011864 3300021441 Bacteria 2009
355 Ga0224570_100432 3300022730 Bacteria 3302
356 Ga0224569_100572 3300022732 Bacteria 3168
357 Ga0224572_1003132 3300024225 Bacteria 2765
358 Ga0224572_1009654 3300024225 Bacteria 1804
359 Ga0228598_1000866 3300024227 Bacteria 6541
360 Ga0228598_1005518 3300024227 Bacteria 2640
361 Ga0209148_1003061 3300025254 Bacteria 4934
362 Ga0209233_1011609 3300025261 Bacteria 2591
363 Ga0209455_1000626 3300025272 Bacteria 21929
364 Ga0207697_10005851 3300025315 Bacteria 5651
365 Ga0207697_10017105 3300025315 Bacteria 2980
366 Ga0207697_10029316 3300025315 Bacteria 2252
367 Ga0207656_10026293 3300025321 Bacteria 2372
368 Ga0207682_10013147 3300025893 Bacteria 3228
369 Ga0207688_10007562 3300025901 Bacteria 5913
370 Ga0207680_10000518 3300025903 Bacteria 18426
371 Ga0207680_10006417 3300025903 Bacteria 5687
372 Ga0207680_10096884 3300025903 Bacteria 1888
373 Ga0207680_10136172 3300025903 Bacteria 1623
374 Ga0207647_10002810 3300025904 Bacteria 13132
375 Ga0207647_10006908 3300025904 Bacteria 8228
376 Ga0207647_10008256 3300025904 Bacteria 7478
377 Ga0207647_10037498 3300025904 Bacteria 3073
378 Ga0207647_10080546 3300025904 Bacteria 1953
379 Ga0207699_10000011 3300025906 Bacteria 282783
380 Ga0207699_10000364 3300025906 Bacteria 23996
381 Ga0207699_10024688 3300025906 Bacteria 3289
382 Ga0207699_10066436 3300025906 Bacteria 2189
383 Ga0207643_10035252 3300025908 Bacteria 2804
384 Ga0207705_10000003 3300025909 Bacteria 709270
385 Ga0207705_10000061 3300025909 Bacteria 150179
386 Ga0207705_10000918 3300025909 Bacteria 24102
387 Ga0207705_10013814 3300025909 Bacteria 5823
388 Ga0207705_10016227 3300025909 Bacteria 5342
389 Ga0207705_10016301 3300025909 Bacteria 5329
390 Ga0207705_10031351 3300025909 Bacteria 3794
391 Ga0207705_10036402 3300025909 Bacteria 3522
392 Ga0207705_10075318 3300025909 Bacteria 2451
393 Ga0207705_10082774 3300025909 Bacteria 2341
394 Ga0207705_10093020 3300025909 Bacteria 2210
395 Ga0207705_10136713 3300025909 Bacteria 1828
396 Ga0207707_10006776 3300025912 Bacteria 9996
397 Ga0207707_10046745 3300025912 Bacteria 3770
398 Ga0207695_10012696 3300025913 Bacteria 10086
399 Ga0207695_10013178 3300025913 Bacteria 9865
400 Ga0207695_10036067 3300025913 Bacteria 5350
401 Ga0207695_10050843 3300025913 Bacteria 4357
402 Ga0207695_10096511 3300025913 Bacteria 2958
403 Ga0207695_10204029 3300025913 Bacteria 1890
404 Ga0207693_10000047 3300025915 Bacteria 100876
405 Ga0207693_10000050 3300025915 Bacteria 100076
406 Ga0207693_10016751 3300025915 Bacteria 5854
407 Ga0207693_10040192 3300025915 Unclassified 3683
408 Ga0207693_10253604 3300025915 Bacteria 1380
409 Ga0207663_10000673 3300025916 Bacteria 15115
410 Ga0207663_10011303 3300025916 Bacteria 4791
411 Ga0207660_10000772 3300025917 Bacteria 21300
412 Ga0207660_10026011 3300025917 Bacteria 3980
413 Ga0207660_10068510 3300025917 Bacteria 2574
414 Ga0207660_10074043 3300025917 Bacteria 2484
415 Ga0207662_10016373 3300025918 Bacteria 4184
416 Ga0207657_10000164 3300025919 Bacteria 67184
417 Ga0207657_10000345 3300025919 Bacteria 49222
418 Ga0207657_10001584 3300025919 Bacteria 24464
419 Ga0207657_10001711 3300025919 Bacteria 23648
420 Ga0207657_10004331 3300025919 Bacteria 15036
421 Ga0207657_10005526 3300025919 Bacteria 13197
422 Ga0207657_10006149 3300025919 Bacteria 12479
423 Ga0207657_10015537 3300025919 Bacteria 7375
424 Ga0207657_10017974 3300025919 Bacteria 6766
425 Ga0207657_10019328 3300025919 Bacteria 6474
426 Ga0207657_10026751 3300025919 Bacteria 5294
427 Ga0207657_10033505 3300025919 Bacteria 4630
428 Ga0207657_10056776 3300025919 Bacteria 3376
429 Ga0207657_10092394 3300025919 Bacteria 2522
430 Ga0207657_10123617 3300025919 Bacteria 2127
431 Ga0207649_10000580 3300025920 Bacteria 25006
432 Ga0207649_10004183 3300025920 Bacteria 7858
433 Ga0207649_10016043 3300025920 Bacteria 4217
434 Ga0207649_10044351 3300025920 Bacteria 2722
435 Ga0207649_10071578 3300025920 Bacteria 2215
436 Ga0207649_10096519 3300025920 Bacteria 1947
437 Ga0207649_10104193 3300025920 Bacteria 1883
438 Ga0207652_10002403 3300025921 Bacteria 15807
439 Ga0207652_10003472 3300025921 Bacteria 12998
440 Ga0207652_10007674 3300025921 Bacteria 8675
441 Ga0207652_10037752 3300025921 Bacteria 4090
442 Ga0207681_10000160 3300025923 Bacteria 55315
443 Ga0207694_10006089 3300025924 Bacteria 9222
444 Ga0207694_10052729 3300025924 Bacteria 3153
445 Ga0207650_10015723 3300025925 Bacteria 5275
446 Ga0207650_10045673 3300025925 Bacteria 3223
447 Ga0207659_10010230 3300025926 Bacteria 5884
448 Ga0207659_10168094 3300025926 Bacteria 1728
449 Ga0207687_10124672 3300025927 Bacteria 1932
450 Ga0207700_10000136 3300025928 Bacteria 43796
451 Ga0207700_10000316 3300025928 Bacteria 28259
452 Ga0207700_10012026 3300025928 Bacteria 5557
453 Ga0207700_10119365 3300025928 Unclassified 2135
454 Ga0207664_10000282 3300025929 Bacteria 38631
455 Ga0207664_10008717 3300025929 Bacteria 7091
456 Ga0207664_10077778 3300025929 Bacteria 2689
457 Ga0207644_10000022 3300025931 Bacteria 160689
458 Ga0207644_10000746 3300025931 Bacteria 20634
459 Ga0207644_10001457 3300025931 Bacteria 15258
460 Ga0207644_10005632 3300025931 Bacteria 8156
461 Ga0207644_10009721 3300025931 Bacteria 6323
462 Ga0207644_10028759 3300025931 Bacteria 3851
463 Ga0207644_10042270 3300025931 Bacteria 3229
464 Ga0207644_10046607 3300025931 Bacteria 3089
465 Ga0207690_10000062 3300025932 Bacteria 96511
466 Ga0207690_10001573 3300025932 Bacteria 14274
467 Ga0207690_10004364 3300025932 Bacteria 8349
468 Ga0207690_10009010 3300025932 Bacteria 5923
469 Ga0207690_10013707 3300025932 Bacteria 4879
470 Ga0207690_10020587 3300025932 Bacteria 4079
471 Ga0207690_10046394 3300025932 Bacteria 2877
472 Ga0207690_10072138 3300025932 Bacteria 2384
473 Ga0207690_10126254 3300025932 Bacteria 1866
474 Ga0207690_10198165 3300025932 Bacteria 1523
475 Ga0207706_10000196 3300025933 Bacteria 67184
476 Ga0207706_10000715 3300025933 Bacteria 34638
477 Ga0207706_10006555 3300025933 Bacteria 10783
478 Ga0207706_10008742 3300025933 Bacteria 9323
479 Ga0207706_10027550 3300025933 Bacteria 5080
480 Ga0207706_10035013 3300025933 Bacteria 4467
481 Ga0207706_10122330 3300025933 Bacteria 2289
482 Ga0207709_10042968 3300025935 Bacteria 2722
483 Ga0207669_10097743 3300025937 Bacteria 1931
484 Ga0207669_10111833 3300025937 Bacteria 1832
485 Ga0207665_10047024 3300025939 Bacteria 2892
486 Ga0207691_10000892 3300025940 Bacteria 29583
487 Ga0207691_10043242 3300025940 Bacteria 4152
488 Ga0207691_10059083 3300025940 Bacteria 3487
489 Ga0207691_10086591 3300025940 Bacteria 2811
490 Ga0207691_10147772 3300025940 Bacteria 2068
491 Ga0207711_10000123 3300025941 Bacteria 80861
492 Ga0207711_10000698 3300025941 Bacteria 33120
493 Ga0207711_10001850 3300025941 Bacteria 19299
494 Ga0207711_10065841 3300025941 Bacteria 3133
495 Ga0207711_10085407 3300025941 Bacteria 2765
496 Ga0207711_10153177 3300025941 Bacteria 2082
497 Ga0207711_10293885 3300025941 Bacteria 1498
498 Ga0207689_10183436 3300025942 Bacteria 1726
499 Ga0207661_10084618 3300025944 Bacteria 2627
500 Ga0207661_10110634 3300025944 Bacteria 2323
501 Ga0207661_10201029 3300025944 Bacteria 1752
502 Ga0207679_10007348 3300025945 Bacteria 6986
503 Ga0207679_10026300 3300025945 Bacteria 4011
504 Ga0207679_10043736 3300025945 Bacteria 3227
505 Ga0207679_10177304 3300025945 Bacteria 1760
506 Ga0207667_10000187 3300025949 Bacteria 90766
507 Ga0207667_10001975 3300025949 Bacteria 25689
508 Ga0207667_10003114 3300025949 Bacteria 20524
509 Ga0207667_10005280 3300025949 Bacteria 15758
510 Ga0207667_10007569 3300025949 Bacteria 13032
511 Ga0207667_10017505 3300025949 Bacteria 8064
512 Ga0207667_10018230 3300025949 Bacteria 7877
513 Ga0207667_10022749 3300025949 Bacteria 6914
514 Ga0207667_10028314 3300025949 Bacteria 6086
515 Ga0207667_10048874 3300025949 Bacteria 4471
516 Ga0207667_10076419 3300025949 Bacteria 3475
517 Ga0207667_10137063 3300025949 Bacteria 2520
518 Ga0207667_10203175 3300025949 Bacteria 2032
519 Ga0207651_10029989 3300025960 Bacteria 3456
520 Ga0207651_10220262 3300025960 Bacteria 1533
521 Ga0207651_10232986 3300025960 Bacteria 1496
522 Ga0207668_10014655 3300025972 Bacteria 4855
523 Ga0207640_10000001 3300025981 Bacteria 628778
524 Ga0207640_10000526 3300025981 Bacteria 23106
525 Ga0207640_10000533 3300025981 Bacteria 22806
526 Ga0207640_10012035 3300025981 Bacteria 4917
527 Ga0207640_10012482 3300025981 Bacteria 4840
528 Ga0207640_10096943 3300025981 Bacteria 2057
529 Ga0207658_10004498 3300025986 Bacteria 9687
530 Ga0207658_10007286 3300025986 Bacteria 7544
531 Ga0207658_10066381 3300025986 Bacteria 2714
532 Ga0207677_10051407 3300026023 Bacteria 2794
533 Ga0207703_10002052 3300026035 Bacteria 17777
534 Ga0207703_10011537 3300026035 Bacteria 6874
535 Ga0207703_10073623 3300026035 Bacteria 2826
536 Ga0207639_10000037 3300026041 Bacteria 147685
537 Ga0207639_10000124 3300026041 Bacteria 57560
538 Ga0207639_10001229 3300026041 Bacteria 17375
539 Ga0207639_10001939 3300026041 Bacteria 13893
540 Ga0207639_10005669 3300026041 Bacteria 8449
541 Ga0207678_10000864 3300026067 Bacteria 27765
542 Ga0207678_10001943 3300026067 Bacteria 18865
543 Ga0207678_10002554 3300026067 Bacteria 16583
544 Ga0207678_10012310 3300026067 Bacteria 7511
545 Ga0207678_10012383 3300026067 Bacteria 7486
546 Ga0207678_10018770 3300026067 Bacteria 6075
547 Ga0207678_10032354 3300026067 Bacteria 4557
548 Ga0207678_10044093 3300026067 Bacteria 3859
549 Ga0207678_10068490 3300026067 Bacteria 3044
550 Ga0207678_10193110 3300026067 Bacteria 1740
551 Ga0207678_10211756 3300026067 Bacteria 1658
552 Ga0207702_10000373 3300026078 Bacteria 51177
553 Ga0207702_10000435 3300026078 Bacteria 47593
554 Ga0207702_10013863 3300026078 Bacteria 6694
555 Ga0207702_10019792 3300026078 Bacteria 5573
556 Ga0207702_10048269 3300026078 Bacteria 3590
557 Ga0207702_10073701 3300026078 Bacteria 2945
558 Ga0207702_10090505 3300026078 Bacteria 2677
559 Ga0207702_10105008 3300026078 Bacteria 2501
560 Ga0207702_10129869 3300026078 Bacteria 2266
561 Ga0207702_10234513 3300026078 Bacteria 1716
562 Ga0207641_10009762 3300026088 Bacteria 7904
563 Ga0207641_10033481 3300026088 Bacteria 4268
564 Ga0207641_10084720 3300026088 Bacteria 2760
565 Ga0207641_10135996 3300026088 Bacteria 2212
566 Ga0207641_10158780 3300026088 Bacteria 2054
567 Ga0207648_10001874 3300026089 Bacteria 22999
568 Ga0207676_10001817 3300026095 Bacteria 15638
569 Ga0207676_10004323 3300026095 Bacteria 10046
570 Ga0207676_10006547 3300026095 Bacteria 8236
571 Ga0207674_10000756 3300026116 Bacteria 42260
572 Ga0207674_10001923 3300026116 Bacteria 26367
573 Ga0207674_10002383 3300026116 Bacteria 23761
574 Ga0207674_10003759 3300026116 Bacteria 18521
575 Ga0207674_10003802 3300026116 Bacteria 18408
576 Ga0207674_10007288 3300026116 Bacteria 12892
577 Ga0207674_10088434 3300026116 Bacteria 3091
578 Ga0207674_10088777 3300026116 Bacteria 3084
579 Ga0207674_10120191 3300026116 Bacteria 2595
580 Ga0207683_10006484 3300026121 Bacteria 10014
581 Ga0207683_10020648 3300026121 Bacteria 5637
582 Ga0207683_10033518 3300026121 Bacteria 4461
583 Ga0207698_10001156 3300026142 Bacteria 15373
584 Ga0207698_10002484 3300026142 Bacteria 10938
585 Ga0207698_10003821 3300026142 Bacteria 9113
586 Ga0207698_10009904 3300026142 Bacteria 6097
587 Ga0207698_10011478 3300026142 Bacteria 5748
588 Ga0207698_10016438 3300026142 Bacteria 4987
589 Ga0207698_10019357 3300026142 Bacteria 4659
590 Ga0207698_10019720 3300026142 Bacteria 4623
591 Ga0207698_10022284 3300026142 Bacteria 4398
592 Ga0268266_10169636 3300028379 Bacteria 1980
593 Ga0268265_10329720 3300028380 Bacteria 1386
594 Ga0265334_10000048 3300028573 Bacteria 90958
595 Ga0265338_10005486 3300028800 Bacteria 16537
596 Ga0265338_10010452 3300028800 Bacteria 10880
597 Ga0265762_1000092 3300030760 Bacteria 12519
598 Ga0265762_1002205 3300030760 Bacteria 3526
599 Ga0265762_1005058 3300030760 Bacteria 2361
600 Ga0265762_1006105 3300030760 Bacteria 2158
601 Ga0265760_10003431 3300031090 Bacteria 4604
602 Ga0265760_10009198 3300031090 Bacteria 2822
603 Ga0265760_10021466 3300031090 Bacteria 1869
604 Ga0265325_10015715 3300031241 Bacteria 4248
605 Ga0265339_10019321 3300031249 Bacteria 4004
606 Ga0265339_10077173 3300031249 Bacteria 1766
607 Ga0307411_10237080 3300032005 Bacteria 1426
608 Ga0373944_0024637 3300035089 Bacteria 1766
609 Ga0373936_0001719 3300035113 Bacteria 8044
610 Ga0373936_0049715 3300035113 Bacteria 1694
611 Ga0373945_0010225 3300035116 Bacteria 3087
612 Ga0373954_0017426 3300035118 Bacteria 3227
613 Ga0373943_0000242 3300035170 Bacteria 22548
614 Ga0373943_0035288 3300035170 Bacteria 2389
615 Ga0373924_0025739 3300035410 Bacteria 2327
616 Ga0373931_0024543 3300035691 Bacteria 3055
617 Ga0373935_0005846 3300035692 Bacteria 7287
618 Ga0373935_0057713 3300035692 Bacteria 2477
619 Ga0373927_0000484 3300035695 Bacteria 30616
620 Ga0373933_0176948 3300035724 Bacteria 1359
621 Ga0373947_0000384 3300035725 Bacteria 24915
622 Ga0373937_0008424 3300036401 Bacteria 8963
623 Ga0373937_0031002 3300036401 Bacteria 4842
624 Ga0373937_0258570 3300036401 Bacteria 1642
625 Ga0373925_0003285 3300037068 Bacteria 12574
626 Ga0373925_0003873 3300037068 Bacteria 11445
627 Ga0373925_0020614 3300037068 Bacteria 4802
628 Ga0373925_0100627 3300037068 Bacteria 2221
629 Ga0395899_0000724 3300037312 Bacteria 32986
630 Ga0395899_0001699 3300037312 Bacteria 18359
631 Ga0395899_0002780 3300037312 Bacteria 14109
632 Ga0395899_0004300 3300037312 Bacteria 11125
633 Ga0395899_0004537 3300037312 Bacteria 10819
634 Ga0395899_0011605 3300037312 Bacteria 6746
635 Ga0395899_0025764 3300037312 Bacteria 4439
636 Ga0395899_0033450 3300037312 Bacteria 3861
637 Ga0395899_0043985 3300037312 Bacteria 3327
638 Ga0395899_0047972 3300037312 Bacteria 3178
639 Ga0395899_0078352 3300037312 Bacteria 2408
640 Ga0395899_0119782 3300037312 Bacteria 1886
641 Ga0395899_0125342 3300037312 Bacteria 1837
642 Ga0395899_0128834 3300037312 Bacteria 1808
643 Ga0395899_0185374 3300037312 Bacteria 1458
644 Ga0395899_0219659 3300037312 Bacteria 1317
645 Ga0395900_0000126 3300037418 Bacteria 127586
646 Ga0395900_0000221 3300037418 Bacteria 89883
647 Ga0395900_0000968 3300037418 Bacteria 37351
648 Ga0395900_0008903 3300037418 Bacteria 10297
649 Ga0395900_0013232 3300037418 Bacteria 8432
650 Ga0395900_0015040 3300037418 Bacteria 7888
651 Ga0395900_0023546 3300037418 Bacteria 6301
652 Ga0395900_0031602 3300037418 Bacteria 5442
653 Ga0395900_0105883 3300037418 Bacteria 2889
654 Ga0395900_0169089 3300037418 Bacteria 2226
655 Ga0395900_0169607 3300037418 Bacteria 2222
656 Ga0395900_0203591 3300037418 Bacteria 2001
657 Ga0395900_0229495 3300037418 Bacteria 1867
658 Ga0395900_0245264 3300037418 Bacteria 1795
659 Ga0395900_0249623 3300037418 Bacteria 1776
660 Ga0395900_0270079 3300037418 Bacteria 1695
661 Ga0395900_0335560 3300037418 Bacteria 1488
662 Ga0395900_0358412 3300037418 Bacteria 1430
663 Ga0395900_0378501 3300037418 Bacteria 1384
664 Ga0395900_0395854 3300037418 Bacteria 1346
665 Ga0395900_0430079 3300037418 Bacteria 1279
666 Ga0395898_0000053 3300037466 Bacteria 279600
667 Ga0395898_0001961 3300037466 Bacteria 25920
668 Ga0395898_0002022 3300037466 Bacteria 25434
669 Ga0395898_0006247 3300037466 Bacteria 12755
670 Ga0395898_0041439 3300037466 Bacteria 4547
671 Ga0395898_0041970 3300037466 Bacteria 4516
672 Ga0395898_0042675 3300037466 Bacteria 4473
673 Ga0395898_0045024 3300037466 Bacteria 4338
674 Ga0395898_0089165 3300037466 Bacteria 2968
675 Ga0395898_0090674 3300037466 Bacteria 2941
676 Ga0395898_0105705 3300037466 Bacteria 2699
677 Ga0395898_0248761 3300037466 Bacteria 1695
678 Ga0395905_0000031 3300037471 Bacteria 286757
679 Ga0395905_0003036 3300037471 Bacteria 18180
680 Ga0395905_0003464 3300037471 Bacteria 16874
681 Ga0395905_0003721 3300037471 Bacteria 16157
682 Ga0395905_0004414 3300037471 Bacteria 14630
683 Ga0395905_0005686 3300037471 Bacteria 12670
684 Ga0395905_0006451 3300037471 Bacteria 11809
685 Ga0395905_0008268 3300037471 Bacteria 10275
686 Ga0395905_0012320 3300037471 Bacteria 8232
687 Ga0395905_0020308 3300037471 Bacteria 6293
688 Ga0395905_0020932 3300037471 Bacteria 6193
689 Ga0395905_0028212 3300037471 Bacteria 5291
690 Ga0395905_0034529 3300037471 Bacteria 4749
691 Ga0395905_0052206 3300037471 Bacteria 3827
692 Ga0395905_0061555 3300037471 Bacteria 3511
693 Ga0395905_0073926 3300037471 Bacteria 3194
694 Ga0395905_0085148 3300037471 Bacteria 2962
695 Ga0395905_0136342 3300037471 Bacteria 2309
696 Ga0395905_0157648 3300037471 Bacteria 2134
697 Ga0395905_0187739 3300037471 Bacteria 1940
698 Ga0395905_0192204 3300037471 Bacteria 1914
699 Ga0395905_0192496 3300037471 Bacteria 1913
700 Ga0395905_0193426 3300037471 Bacteria 1908
701 Ga0395905_0205548 3300037471 Bacteria 1845
702 Ga0395905_0213542 3300037471 Bacteria 1807
703 Ga0395901_0000147 3300038443 Bacteria 91584
704 Ga0395901_0000163 3300038443 Bacteria 87103
705 Ga0395901_0000459 3300038443 Bacteria 47200
706 Ga0395901_0001546 3300038443 Bacteria 23839
707 Ga0395901_0017880 3300038443 Bacteria 7236
708 Ga0395901_0018889 3300038443 Bacteria 7047
709 Ga0395901_0023365 3300038443 Bacteria 6336
710 Ga0395901_0032067 3300038443 Bacteria 5421
711 Ga0395901_0040231 3300038443 Bacteria 4842
712 Ga0395901_0051252 3300038443 Bacteria 4290
713 Ga0395901_0072184 3300038443 Bacteria 3598
714 Ga0395901_0076250 3300038443 Bacteria 3498
715 Ga0395901_0088753 3300038443 Bacteria 3234
716 Ga0395901_0130884 3300038443 Bacteria 2636
717 Ga0395901_0133445 3300038443 Bacteria 2609
718 Ga0395901_0160505 3300038443 Bacteria 2361
719 Ga0395901_0175640 3300038443 Bacteria 2247
720 Ga0395901_0187023 3300038443 Bacteria 2172
721 Ga0395901_0189183 3300038443 Bacteria 2159
722 Ga0395901_0198114 3300038443 Bacteria 2105
723 Ga0395901_0277284 3300038443 Bacteria 1743
724 Ga0436365_1629872 3300039437 Bacteria 7784
725 Ga0436360_0148430 3300039438 Bacteria 2625
726 Ga0436360_1023609 3300039438 Bacteria 7805
727 Ga0436361_0999815 3300039447 Bacteria 1833
728 Ga0466969_0010018 3300044656 Bacteria 5026
729 Ga0466969_0021402 3300044656 Bacteria 3344
730 Ga0453683_0091056 3300044673 Bacteria 1912
731 Ga0466966_0000001 3300044684 Bacteria 410376
732 Ga0466966_0005584 3300044684 Bacteria 8269
733 Ga0466966_0029547 3300044684 Bacteria 3565
734 Ga0466966_0043256 3300044684 Bacteria 2888
735 Ga0466966_0060094 3300044684 Bacteria 2399
736 Ga0466963_0026504 3300044694 Bacteria 3707
737 Ga0466963_0046220 3300044694 Bacteria 2870
738 Ga0466963_0061792 3300044694 Bacteria 2505
739 Ga0466963_0074312 3300044694 Bacteria 2292
740 Ga0466963_0081530 3300044694 Bacteria 2191
741 Ga0466963_0082511 3300044694 Bacteria 2179
742 Ga0466971_0037444 3300044719 Bacteria 2174
743 Ga0466971_0042528 3300044719 Bacteria 2042
744 Ga0466970_0024147 3300044765 Bacteria 3178
745 Ga0466970_0034071 3300044765 Bacteria 2694
746 Ga0466970_0117053 3300044765 Bacteria 1458
747 Ga0466957_0006995 3300044842 Bacteria 6377
748 Ga0466957_0026017 3300044842 Bacteria 3470
749 Ga0466957_0079678 3300044842 Bacteria 2038
750 Ga0466957_0192747 3300044842 Bacteria 1336
751 Ga0466960_0021110 3300044901 Bacteria 2895
752 Ga0466959_0000995 3300045049 Bacteria 16867
753 Ga0466959_0032772 3300045049 Bacteria 3845
754 Ga0466959_0073754 3300045049 Bacteria 2468
755 Ga0466959_0077014 3300045049 Bacteria 2408
756 Ga0451576_0105187 3300045051 Bacteria 2936
757 Ga0466958_0000481 3300045836 Bacteria 16699
758 Ga0466958_0028229 3300045836 Bacteria 3326
759 Ga0466958_0040300 3300045836 Bacteria 2807
760 Ga0466958_0047699 3300045836 Bacteria 2586
761 Ga0466958_0157913 3300045836 Bacteria 1432
762 Ga0466967_0008320 3300045976 Bacteria 7587
763 Ga0466967_0009496 3300045976 Bacteria 7221
764 Ga0466967_0012369 3300045976 Bacteria 6523
765 Ga0466967_0017249 3300045976 Bacteria 5726
766 Ga0466967_0020168 3300045976 Bacteria 5379
767 Ga0466967_0057444 3300045976 Bacteria 3435
768 Ga0466967_0065889 3300045976 Bacteria 3226
769 Ga0466967_0106432 3300045976 Bacteria 2571
770 Ga0466967_0198881 3300045976 Bacteria 1897
771 Ga0466967_0220614 3300045976 Bacteria 1801
772 Ga0466967_0234001 3300045976 Bacteria 1750
773 Ga0466967_0266778 3300045976 Bacteria 1639
774 Ga0466967_0272001 3300045976 Bacteria 1623
775 Ga0495629_0043955 3300046459 Bacteria 3136
776 Ga0495629_0083945 3300046459 Bacteria 2223
777 Ga0495580_0010923 3300046472 Bacteria 7045
778 Ga0495580_0063386 3300046472 Bacteria 2593
779 Ga0495582_0071854 3300046473 Bacteria 1914
780 Ga0495664_0015318 3300046477 Bacteria 4357
781 Ga0495665_0038020 3300046531 Bacteria 2567
782 Ga0495668_0010922 3300046616 Bacteria 5468
783 Ga0495658_0032672 3300046683 Bacteria 2843
784 Ga0495669_0000256 3300046684 Bacteria 30798
785 Ga0495669_0007173 3300046684 Bacteria 4669
786 Ga0495613_0035600 3300046689 Bacteria 3694
787 Ga0495624_0067753 3300046690 Bacteria 2226
788 Ga0495600_0110355 3300046809 Bacteria 1791
789 Ga0495674_0037698 3300047319 Bacteria 4343
790 Ga0495683_0078534 3300047323 Bacteria 1613
791 Ga0495602_0027686 3300048088 Bacteria 5443
792 Ga0496100_0151592 3300048903 Bacteria 1654
793 Ga0496101_0007302 3300048904 Bacteria 7152
794 Ga0496101_0040068 3300048904 Bacteria 3336
795 Ga0496101_0083522 3300048904 Bacteria 2364
796 Ga0496102_0035740 3300048905 Bacteria 4474
797 Ga0496102_0120185 3300048905 Bacteria 2453
798 Ga0496102_0144821 3300048905 Bacteria 2229
799 Ga0496104_0091458 3300048907 Bacteria 2908
800 Ga0496104_0117971 3300048907 Bacteria 2547
801 Ga0496104_0123294 3300048907 Unclassified 2488
802 Ga0496104_0255146 3300048907 Bacteria 1666
803 Ga0496105_0010687 3300048908 Bacteria 7223
804 Ga0496105_0015809 3300048908 Bacteria 6020
805 Ga0496105_0063907 3300048908 Bacteria 3037
806 Ga0496105_0137524 3300048908 Bacteria 2012
807 Ga0496105_0276572 3300048908 Bacteria 1355
808 Ga0496106_0000373 3300048909 Bacteria 31824
809 Ga0496106_0040257 3300048909 Bacteria 3499
810 Ga0496107_0003101 3300048910 Bacteria 11048
811 Ga0496107_0006471 3300048910 Bacteria 8055
812 Ga0496107_0033699 3300048910 Bacteria 3665
813 Ga0496107_0046014 3300048910 Bacteria 3140
814 Ga0496107_0126921 3300048910 Bacteria 1882
815 Ga0496108_0001090 3300048911 Bacteria 21199
816 Ga0496108_0001833 3300048911 Bacteria 16979
817 Ga0496108_0024706 3300048911 Bacteria 4949
818 Ga0496109_0011758 3300048912 Bacteria 7532
819 Ga0496109_0031747 3300048912 Bacteria 4743
820 Ga0496110_0000437 3300048913 Bacteria 28365
821 Ga0496110_0054710 3300048913 Bacteria 3510
822 Ga0496111_0005971 3300048914 Bacteria 7860
823 Ga0496111_0011295 3300048914 Bacteria 6011
824 Ga0496111_0032967 3300048914 Bacteria 3694
825 Ga0496112_0002186 3300048915 Bacteria 15560
826 Ga0496112_0006749 3300048915 Bacteria 10113
827 Ga0496112_0026425 3300048915 Bacteria 5585
828 Ga0496112_0135045 3300048915 Bacteria 2437
829 Ga0496112_0250537 3300048915 Bacteria 1722
830 Ga0496113_0002318 3300048916 Bacteria 10998
831 Ga0496113_0002609 3300048916 Bacteria 10542
832 Ga0496113_0005539 3300048916 Bacteria 7885
833 Ga0496113_0015360 3300048916 Bacteria 5260
834 Ga0496113_0016082 3300048916 Bacteria 5163
835 Ga0496114_0100831 3300048917 Bacteria 2464
836 Ga0496115_0001337 3300048918 Bacteria 17576
837 Ga0496115_0013235 3300048918 Bacteria 6234
838 Ga0496115_0029580 3300048918 Unclassified 4303
839 Ga0496121_0000789 3300048924 Bacteria 57941
840 Ga0496126_0012887 3300048929 Bacteria 8540
841 Ga0501046_0088011 3300049580 Bacteria 2392
842 Ga0501047_0011428 3300049581 Bacteria 8403
843 Ga0501047_0263728 3300049581 Bacteria 1570
844 Ga0501079_0268853 3300049741 Bacteria 1333
845 Ga0501080_0249572 3300049742 Bacteria 1618
846 Ga0501080_0319035 3300049742 Bacteria 1407
847 Ga0501035_0117685 3300049822 Bacteria 2325
848 Ga0501044_0095897 3300049823 Bacteria 2989
849 Ga0501044_0228725 3300049823 Bacteria 1808
850 nmdc:mga0n895_362348_c1 3300050512 Bacteria 1468
851 nmdc:mga0rr50_8343_c1 3300050513 Bacteria 6445
852 Ga0495612_0058660 3300053078 Bacteria 1591
853 Ga0157373_10014894
854 LJNas_1001617
855 JGI24741J21665_1007592
856 JGI24740J21852_10003203
857 JGI24740J21852_10021050
858 JGI24740J21852_10024635
859 JGI24739J22299_10004897
860 JGI24739J22299_10006120
861 JGI24737J22298_10001320
862 JGI24737J22298_10001643
863 JGI24737J22298_10010439
864 JGI24744J21845_10000004
865 JGI24742J22300_10010138
866 Ga0065715_10037121
867 Ga0070658_10000360
868 Ga0070658_10000743
869 Ga0070658_10000999
870 Ga0070658_10047112
871 Ga0070658_10075199
872 Ga0070658_10089199
873 Ga0070658_10094152
874 Ga0070658_10099086
875 Ga0070658_10211125
876 Ga0070658_10320879
877 Ga0070683_100000348
878 Ga0070683_100018151
879 Ga0070683_100023100
880 Ga0070683_100103155
881 Ga0070683_100103441
882 Ga0070690_100065591
883 Ga0070670_100003619
884 Ga0070670_100017820
885 Ga0070677_10034494
886 Ga0070666_10000361
887 Ga0070666_10002549
888 Ga0070666_10016340
889 Ga0070666_10037158
890 Ga0070680_100003113
891 Ga0070680_100023043
892 Ga0070680_100025180
893 Ga0070680_100038713
894 Ga0070682_100023814
895 Ga0070660_100000075
896 Ga0070660_100000085
897 Ga0070660_100004364
898 Ga0070660_100013229
899 Ga0070660_100020568
900 Ga0070660_100038463
901 Ga0070660_100041827
902 Ga0070660_100054919
903 Ga0070660_100063218
904 Ga0070689_100007712
905 Ga0070687_100038429
906 Ga0070661_100000273
907 Ga0070661_100005367
908 Ga0070661_100015698
909 Ga0070661_100019668
910 Ga0070661_100066607
911 Ga0070661_100072884
912 Ga0070661_100087715
913 Ga0070661_100095137
914 Ga0070661_100102671
915 Ga0070692_10010244
916 Ga0070692_10027385
917 Ga0070668_100048786
918 Ga0070669_100000223
919 Ga0070669_100049969
920 Ga0070675_100007141
921 Ga0070675_100054340
922 Ga0070675_100143386
923 Ga0070671_100000203
924 Ga0070671_100005825
925 Ga0070671_100007366
926 Ga0070671_100020491
927 Ga0070671_100020894
928 Ga0070671_100038153
929 Ga0070671_100046922
930 Ga0070671_100306176
931 Ga0070674_100010177
932 Ga0070674_100045871
933 Ga0070673_100001900
934 Ga0070673_100089442
935 Ga0070673_100210141
936 Ga0070688_100000374
937 Ga0070659_100000084
938 Ga0070659_100001028
939 Ga0070659_100005791
940 Ga0070659_100006706
941 Ga0070659_100016958
942 Ga0070659_100045177
943 Ga0070659_100080452
944 Ga0070659_100085542
945 Ga0070659_100095351
946 Ga0070659_100103374
947 Ga0070667_100007738
948 Ga0070667_100008302
949 Ga0070667_100026745
950 Ga0070667_100028226
951 Ga0070667_100051297
952 Ga0070709_10000022
953 Ga0070709_10000563
954 Ga0070709_10012639
955 Ga0070709_10019688
956 Ga0070714_100051939
957 Ga0070714_100053434
958 Ga0070714_100061763
959 Ga0070714_100072338
960 Ga0070714_100139711
961 Ga0070714_100223734
962 Ga0070713_100000021
963 Ga0070713_100000203
964 Ga0070713_100015342
965 Ga0070713_100018456
966 Ga0070713_100168170
967 Ga0070713_100333412
968 Ga0070710_10003233
969 Ga0070710_10082470
970 Ga0070701_10006994
971 Ga0070711_100000077
972 Ga0070711_100012307
973 Ga0070694_100048112
974 Ga0070708_100104197
975 Ga0070663_100009524
976 Ga0070663_100011408
977 Ga0070663_100019027
978 Ga0070663_100047093
979 Ga0070663_100048650
980 Ga0070663_100202163
981 Ga0070678_100000630
982 Ga0070662_100000058
983 Ga0070662_100052178
984 Ga0070662_100136191
985 Ga0070681_10018435
986 Ga0070681_10055945
987 Ga0070681_10102537
988 Ga0070681_10228626
989 Ga0070685_10001541
990 Ga0070706_100016985
991 Ga0070706_100021658
992 Ga0070707_100054897
993 Ga0070699_100017663
994 Ga0070699_100034322
995 Ga0070679_100009124
996 Ga0070679_100018253
997 Ga0070679_100065031
998 Ga0070679_100089656
999 Ga0070679_100100180
1000 Ga0070679_100107772
1001 Ga0070679_100266376
1002 Ga0070684_100002051
1003 Ga0070684_100010435
1004 Ga0070684_100020947
1005 Ga0068853_100000039
1006 Ga0068853_100000223
1007 Ga0068853_100001982
1008 Ga0068853_100009358
1009 Ga0068853_100009546
1010 Ga0068853_100023634
1011 Ga0068853_100035596
1012 Ga0070672_100005790
1013 Ga0070672_100201127
1014 Ga0070693_100002238
1015 Ga0070665_100004855
1016 Ga0070665_100056169
1017 Ga0070665_100081333
1018 Ga0070665_100314707
1019 Ga0068855_100001063
1020 Ga0068855_100001315
1021 Ga0068855_100003197
1022 Ga0068855_100005593
1023 Ga0068855_100011514
1024 Ga0068855_100012825
1025 Ga0068855_100018966
1026 Ga0068855_100026375
1027 Ga0068855_100041231
1028 Ga0068855_100046984
1029 Ga0068855_100057892
1030 Ga0068855_100165480
1031 Ga0068855_100172350
1032 Ga0070664_100000032
1033 Ga0070664_100006415
1034 Ga0070664_100012600
1035 Ga0070664_100096199
1036 Ga0070664_100102747
1037 Ga0070664_100107599
1038 Ga0070664_100185018
1039 Ga0068857_100004731
1040 Ga0068857_100019952
1041 Ga0068857_100091760
1042 Ga0068857_100098639
1043 Ga0068854_100000314
1044 Ga0068854_100001532
1045 Ga0068854_100016199
1046 Ga0068854_100020640
1047 Ga0068854_100024262
1048 Ga0068854_100054774
1049 Ga0068854_100118287
1050 Ga0068856_100000161
1051 Ga0068856_100001238
1052 Ga0068856_100007720
1053 Ga0068856_100026871
1054 Ga0068856_100076712
1055 Ga0068856_100078842
1056 Ga0068856_100132313
1057 Ga0068856_100197811
1058 Ga0068856_100257849
1059 Ga0068856_100306126
1060 Ga0068852_100002985
1061 Ga0068852_100013842
1062 Ga0068852_100018448
1063 Ga0068852_100020755
1064 Ga0068852_100021513
1065 Ga0068852_100030605
1066 Ga0068852_100308124
1067 Ga0068859_100017524
1068 Ga0068859_100027593
1069 Ga0068859_100031437
1070 Ga0068864_100002932
1071 Ga0068864_100006287
1072 Ga0068864_100017685
1073 Ga0068864_100101547
1074 Ga0068866_10041703
1075 Ga0068851_10028353
1076 Ga0068851_10034363
1077 Ga0068863_100008593
1078 Ga0068863_100032339
1079 Ga0068863_100074402
1080 Ga0068863_100147519
1081 Ga0068863_100157624
1082 Ga0068858_100001179
1083 Ga0068858_100003126
1084 Ga0068858_100041193
1085 Ga0068858_100069930
1086 Ga0068858_100308446
1087 Ga0068862_100176218
1088 Ga0081539_10037046
1089 Ga0070717_10004377
1090 Ga0070717_10005493
1091 Ga0070717_10013650
1092 Ga0070717_10024489
1093 Ga0070717_10056548
1094 Ga0070717_10058540
1095 Ga0070717_10122762
1096 Ga0070716_100000377
1097 Ga0070716_100000838
1098 Ga0070716_100015929
1099 Ga0070712_100000425
1100 Ga0070712_100000440
1101 Ga0070712_100005709
1102 Ga0070712_100021452
1103 Ga0070712_100149460
1104 Ga0097621_100004933
1105 Ga0097621_100143394
1106 Ga0068871_100008802
1107 Ga0068871_100026938
1108 Ga0068871_100060747
1109 Ga0068871_100174763
1110 Ga0075434_100195250
1111 Ga0097620_100017524
1112 Ga0097620_100027593
1113 Ga0097620_100031437
1114 Ga0075435_100042914
1115 Ga0099795_10002513
1116 Ga0105240_10006207
1117 Ga0105240_10017834
1118 Ga0105240_10029819
1119 Ga0105240_10038385
1120 Ga0105240_10039803
1121 Ga0105240_10086501
1122 Ga0105240_10103756
1123 Ga0105240_10118247
1124 Ga0105245_10029098
1125 Ga0105243_10019943
1126 Ga0105241_10157266
1127 Ga0105248_10000223
1128 Ga0105248_10000678
1129 Ga0105248_10002629
1130 Ga0105248_10018018
1131 Ga0105248_10023133
1132 Ga0105248_10057947
1133 Ga0105248_10063204
1134 Ga0105248_10069080
1135 Ga0105248_10080965
1136 Ga0105237_10011865
1137 Ga0105237_10059585
1138 Ga0105238_10014708
1139 Ga0105238_10026598
1140 Ga0105238_10140706
1141 Ga0105238_10238552
1142 Ga0105249_10222332
1143 Ga0105246_10000072
1144 Ga0105246_10006938
1145 Ga0105246_10043671
1146 Ga0157373_10008901
1147 Ga0157373_10020087
1148 Ga0157373_10021720
1149 Ga0157373_10125616
1150 Ga0157373_10141875
1151 Ga0157373_10186021
1152 Ga0157371_10001103
1153 Ga0157371_10001297
1154 Ga0157371_10003962
1155 Ga0157371_10007626
1156 Ga0157371_10011159
1157 Ga0157371_10012119
1158 Ga0157371_10021573
1159 Ga0157371_10022459
1160 Ga0157371_10024032
1161 Ga0157371_10032066
1162 Ga0157371_10043946
1163 Ga0157371_10056891
1164 Ga0157371_10065238
1165 Ga0157370_10001094
1166 Ga0157370_10004189
1167 Ga0157370_10018716
1168 Ga0157370_10047298
1169 Ga0157370_10059417
1170 Ga0157370_10172510
1171 Ga0157369_10000141
1172 Ga0157369_10001072
1173 Ga0157369_10001999
1174 Ga0157369_10004058
1175 Ga0157369_10006247
1176 Ga0157369_10006378
1177 Ga0157369_10014521
1178 Ga0157369_10015998
1179 Ga0157369_10053969
1180 Ga0157369_10073116
1181 Ga0157374_10001508
1182 Ga0157374_10049268
1183 Ga0157374_10053261
1184 Ga0157374_10086814
1185 Ga0157374_10104402
1186 Ga0157378_10063467
1187 Ga0163162_10002279
1188 Ga0163162_10038319
1189 Ga0163162_10063884
1190 Ga0157372_10002710
1191 Ga0157372_10010724
1192 Ga0157372_10025893
1193 Ga0157372_10160985
1194 Ga0157375_10001921
1195 Ga0157375_10065270
1196 Ga0157375_10507883
1197 Ga0163163_10000567
1198 Ga0163163_10002130
1199 Ga0163163_10053966
1200 Ga0163163_10082522
1201 Ga0157380_10151404
1202 Ga0182008_10016095
1203 Ga0157379_10000861
1204 Ga0206356_10378585
1205 Ga0206354_10978830
1206 Ga0213871_10011864
1207 Ga0224570_100432
1208 Ga0224569_100572
1209 Ga0224572_1003132
1210 Ga0224572_1009654
1211 Ga0228598_1000866
1212 Ga0228598_1005518
1213 Ga0209148_1003061
1214 Ga0209233_1011609
1215 Ga0209455_1000626
1216 Ga0207697_10005851
1217 Ga0207697_10017105
1218 Ga0207697_10029316
1219 Ga0207656_10026293
1220 Ga0207682_10013147
1221 Ga0207688_10007562
1222 Ga0207680_10000518
1223 Ga0207680_10006417
1224 Ga0207680_10096884
1225 Ga0207680_10136172
1226 Ga0207647_10002810
1227 Ga0207647_10006908
1228 Ga0207647_10008256
1229 Ga0207647_10037498
1230 Ga0207647_10080546
1231 Ga0207699_10000011
1232 Ga0207699_10000364
1233 Ga0207699_10024688
1234 Ga0207699_10066436
1235 Ga0207643_10035252
1236 Ga0207705_10000003
1237 Ga0207705_10000061
1238 Ga0207705_10000918
1239 Ga0207705_10013814
1240 Ga0207705_10016227
1241 Ga0207705_10016301
1242 Ga0207705_10031351
1243 Ga0207705_10036402
1244 Ga0207705_10075318
1245 Ga0207705_10082774
1246 Ga0207705_10093020
1247 Ga0207705_10136713
1248 Ga0207707_10006776
1249 Ga0207707_10046745
1250 Ga0207695_10012696
1251 Ga0207695_10013178
1252 Ga0207695_10036067
1253 Ga0207695_10050843
1254 Ga0207695_10096511
1255 Ga0207695_10204029
1256 Ga0207693_10000047
1257 Ga0207693_10000050
1258 Ga0207693_10016751
1259 Ga0207693_10040192
1260 Ga0207693_10253604
1261 Ga0207663_10000673
1262 Ga0207663_10011303
1263 Ga0207660_10000772
1264 Ga0207660_10026011
1265 Ga0207660_10068510
1266 Ga0207660_10074043
1267 Ga0207662_10016373
1268 Ga0207657_10000164
1269 Ga0207657_10000345
1270 Ga0207657_10001584
1271 Ga0207657_10001711
1272 Ga0207657_10004331
1273 Ga0207657_10005526
1274 Ga0207657_10006149
1275 Ga0207657_10015537
1276 Ga0207657_10017974
1277 Ga0207657_10019328
1278 Ga0207657_10026751
1279 Ga0207657_10033505
1280 Ga0207657_10056776
1281 Ga0207657_10092394
1282 Ga0207657_10123617
1283 Ga0207649_10000580
1284 Ga0207649_10004183
1285 Ga0207649_10016043
1286 Ga0207649_10044351
1287 Ga0207649_10071578
1288 Ga0207649_10096519
1289 Ga0207649_10104193
1290 Ga0207652_10002403
1291 Ga0207652_10003472
1292 Ga0207652_10007674
1293 Ga0207652_10037752
1294 Ga0207681_10000160
1295 Ga0207694_10006089
1296 Ga0207694_10052729
1297 Ga0207650_10015723
1298 Ga0207650_10045673
1299 Ga0207659_10010230
1300 Ga0207659_10168094
1301 Ga0207687_10124672
1302 Ga0207700_10000136
1303 Ga0207700_10000316
1304 Ga0207700_10012026
1305 Ga0207700_10119365
1306 Ga0207664_10000282
1307 Ga0207664_10008717
1308 Ga0207664_10077778
1309 Ga0207644_10000022
1310 Ga0207644_10000746
1311 Ga0207644_10001457
1312 Ga0207644_10005632
1313 Ga0207644_10009721
1314 Ga0207644_10028759
1315 Ga0207644_10042270
1316 Ga0207644_10046607
1317 Ga0207690_10000062
1318 Ga0207690_10001573
1319 Ga0207690_10004364
1320 Ga0207690_10009010
1321 Ga0207690_10013707
1322 Ga0207690_10020587
1323 Ga0207690_10046394
1324 Ga0207690_10072138
1325 Ga0207690_10126254
1326 Ga0207690_10198165
1327 Ga0207706_10000196
1328 Ga0207706_10000715
1329 Ga0207706_10006555
1330 Ga0207706_10008742
1331 Ga0207706_10027550
1332 Ga0207706_10035013
1333 Ga0207706_10122330
1334 Ga0207709_10042968
1335 Ga0207669_10097743
1336 Ga0207669_10111833
1337 Ga0207665_10047024
1338 Ga0207691_10000892
1339 Ga0207691_10043242
1340 Ga0207691_10059083
1341 Ga0207691_10086591
1342 Ga0207691_10147772
1343 Ga0207711_10000123
1344 Ga0207711_10000698
1345 Ga0207711_10001850
1346 Ga0207711_10065841
1347 Ga0207711_10085407
1348 Ga0207711_10153177
1349 Ga0207711_10293885
1350 Ga0207689_10183436
1351 Ga0207661_10084618
1352 Ga0207661_10110634
1353 Ga0207661_10201029
1354 Ga0207679_10007348
1355 Ga0207679_10026300
1356 Ga0207679_10043736
1357 Ga0207679_10177304
1358 Ga0207667_10000187
1359 Ga0207667_10001975
1360 Ga0207667_10003114
1361 Ga0207667_10005280
1362 Ga0207667_10007569
1363 Ga0207667_10017505
1364 Ga0207667_10018230
1365 Ga0207667_10022749
1366 Ga0207667_10028314
1367 Ga0207667_10048874
1368 Ga0207667_10076419
1369 Ga0207667_10137063
1370 Ga0207667_10203175
1371 Ga0207651_10029989
1372 Ga0207651_10220262
1373 Ga0207651_10232986
1374 Ga0207668_10014655
1375 Ga0207640_10000001
1376 Ga0207640_10000526
1377 Ga0207640_10000533
1378 Ga0207640_10012035
1379 Ga0207640_10012482
1380 Ga0207640_10096943
1381 Ga0207658_10004498
1382 Ga0207658_10007286
1383 Ga0207658_10066381
1384 Ga0207677_10051407
1385 Ga0207703_10002052
1386 Ga0207703_10011537
1387 Ga0207703_10073623
1388 Ga0207639_10000037
1389 Ga0207639_10000124
1390 Ga0207639_10001229
1391 Ga0207639_10001939
1392 Ga0207639_10005669
1393 Ga0207678_10000864
1394 Ga0207678_10001943
1395 Ga0207678_10002554
1396 Ga0207678_10012310
1397 Ga0207678_10012383
1398 Ga0207678_10018770
1399 Ga0207678_10032354
1400 Ga0207678_10044093
1401 Ga0207678_10068490
1402 Ga0207678_10193110
1403 Ga0207678_10211756
1404 Ga0207702_10000373
1405 Ga0207702_10000435
1406 Ga0207702_10013863
1407 Ga0207702_10019792
1408 Ga0207702_10048269
1409 Ga0207702_10073701
1410 Ga0207702_10090505
1411 Ga0207702_10105008
1412 Ga0207702_10129869
1413 Ga0207702_10234513
1414 Ga0207641_10009762
1415 Ga0207641_10033481
1416 Ga0207641_10084720
1417 Ga0207641_10135996
1418 Ga0207641_10158780
1419 Ga0207648_10001874
1420 Ga0207676_10001817
1421 Ga0207676_10004323
1422 Ga0207676_10006547
1423 Ga0207674_10000756
1424 Ga0207674_10001923
1425 Ga0207674_10002383
1426 Ga0207674_10003759
1427 Ga0207674_10003802
1428 Ga0207674_10007288
1429 Ga0207674_10088434
1430 Ga0207674_10088777
1431 Ga0207674_10120191
1432 Ga0207683_10006484
1433 Ga0207683_10020648
1434 Ga0207683_10033518
1435 Ga0207698_10001156
1436 Ga0207698_10002484
1437 Ga0207698_10003821
1438 Ga0207698_10009904
1439 Ga0207698_10011478
1440 Ga0207698_10016438
1441 Ga0207698_10019357
1442 Ga0207698_10019720
1443 Ga0207698_10022284
1444 Ga0268266_10169636
1445 Ga0268265_10329720
1446 Ga0265334_10000048
1447 Ga0265338_10005486
1448 Ga0265338_10010452
1449 Ga0265762_1000092
1450 Ga0265762_1002205
1451 Ga0265762_1005058
1452 Ga0265762_1006105
1453 Ga0265760_10003431
1454 Ga0265760_10009198
1455 Ga0265760_10021466
1456 Ga0265325_10015715
1457 Ga0265339_10019321
1458 Ga0265339_10077173
1459 Ga0307411_10237080
1460 Ga0373944_0024637
1461 Ga0373936_0001719
1462 Ga0373936_0049715
1463 Ga0373945_0010225
1464 Ga0373954_0017426
1465 Ga0373943_0000242
1466 Ga0373943_0035288
1467 Ga0373924_0025739
1468 Ga0373931_0024543
1469 Ga0373935_0005846
1470 Ga0373935_0057713
1471 Ga0373927_0000484
1472 Ga0373933_0176948
1473 Ga0373947_0000384
1474 Ga0373937_0008424
1475 Ga0373937_0031002
1476 Ga0373937_0258570
1477 Ga0373925_0003285
1478 Ga0373925_0003873
1479 Ga0373925_0020614
1480 Ga0373925_0100627
1481 Ga0395899_0000724
1482 Ga0395899_0001699
1483 Ga0395899_0002780
1484 Ga0395899_0004300
1485 Ga0395899_0004537
1486 Ga0395899_0011605
1487 Ga0395899_0025764
1488 Ga0395899_0033450
1489 Ga0395899_0043985
1490 Ga0395899_0047972
1491 Ga0395899_0078352
1492 Ga0395899_0119782
1493 Ga0395899_0125342
1494 Ga0395899_0128834
1495 Ga0395899_0185374
1496 Ga0395899_0219659
1497 Ga0395900_0000126
1498 Ga0395900_0000221
1499 Ga0395900_0000968
1500 Ga0395900_0008903
1501 Ga0395900_0013232
1502 Ga0395900_0015040
1503 Ga0395900_0023546
1504 Ga0395900_0031602
1505 Ga0395900_0105883
1506 Ga0395900_0169089
1507 Ga0395900_0169607
1508 Ga0395900_0203591
1509 Ga0395900_0229495
1510 Ga0395900_0245264
1511 Ga0395900_0249623
1512 Ga0395900_0270079
1513 Ga0395900_0335560
1514 Ga0395900_0358412
1515 Ga0395900_0378501
1516 Ga0395900_0395854
1517 Ga0395900_0430079
1518 Ga0395898_0000053
1519 Ga0395898_0001961
1520 Ga0395898_0002022
1521 Ga0395898_0006247
1522 Ga0395898_0041439
1523 Ga0395898_0041970
1524 Ga0395898_0042675
1525 Ga0395898_0045024
1526 Ga0395898_0089165
1527 Ga0395898_0090674
1528 Ga0395898_0105705
1529 Ga0395898_0248761
1530 Ga0395905_0000031
1531 Ga0395905_0003036
1532 Ga0395905_0003464
1533 Ga0395905_0003721
1534 Ga0395905_0004414
1535 Ga0395905_0005686
1536 Ga0395905_0006451
1537 Ga0395905_0008268
1538 Ga0395905_0012320
1539 Ga0395905_0020308
1540 Ga0395905_0020932
1541 Ga0395905_0028212
1542 Ga0395905_0034529
1543 Ga0395905_0052206
1544 Ga0395905_0061555
1545 Ga0395905_0073926
1546 Ga0395905_0085148
1547 Ga0395905_0136342
1548 Ga0395905_0157648
1549 Ga0395905_0187739
1550 Ga0395905_0192204
1551 Ga0395905_0192496
1552 Ga0395905_0193426
1553 Ga0395905_0205548
1554 Ga0395905_0213542
1555 Ga0395901_0000147
1556 Ga0395901_0000163
1557 Ga0395901_0000459
1558 Ga0395901_0001546
1559 Ga0395901_0017880
1560 Ga0395901_0018889
1561 Ga0395901_0023365
1562 Ga0395901_0032067
1563 Ga0395901_0040231
1564 Ga0395901_0051252
1565 Ga0395901_0072184
1566 Ga0395901_0076250
1567 Ga0395901_0088753
1568 Ga0395901_0130884
1569 Ga0395901_0133445
1570 Ga0395901_0160505
1571 Ga0395901_0175640
1572 Ga0395901_0187023
1573 Ga0395901_0189183
1574 Ga0395901_0198114
1575 Ga0395901_0277284
1576 Ga0436365_1629872
1577 Ga0436360_0148430
1578 Ga0436360_1023609
1579 Ga0436361_0999815
1580 Ga0466969_0010018
1581 Ga0466969_0021402
1582 Ga0453683_0091056
1583 Ga0466966_0000001
1584 Ga0466966_0005584
1585 Ga0466966_0029547
1586 Ga0466966_0043256
1587 Ga0466966_0060094
1588 Ga0466963_0026504
1589 Ga0466963_0046220
1590 Ga0466963_0061792
1591 Ga0466963_0074312
1592 Ga0466963_0081530
1593 Ga0466963_0082511
1594 Ga0466971_0037444
1595 Ga0466971_0042528
1596 Ga0466970_0024147
1597 Ga0466970_0034071
1598 Ga0466970_0117053
1599 Ga0466957_0006995
1600 Ga0466957_0026017
1601 Ga0466957_0079678
1602 Ga0466957_0192747
1603 Ga0466960_0021110
1604 Ga0466959_0000995
1605 Ga0466959_0032772
1606 Ga0466959_0073754
1607 Ga0466959_0077014
1608 Ga0451576_0105187
1609 Ga0466958_0000481
1610 Ga0466958_0028229
1611 Ga0466958_0040300
1612 Ga0466958_0047699
1613 Ga0466958_0157913
1614 Ga0466967_0008320
1615 Ga0466967_0009496
1616 Ga0466967_0012369
1617 Ga0466967_0017249
1618 Ga0466967_0020168
1619 Ga0466967_0057444
1620 Ga0466967_0065889
1621 Ga0466967_0106432
1622 Ga0466967_0198881
1623 Ga0466967_0220614
1624 Ga0466967_0234001
1625 Ga0466967_0266778
1626 Ga0466967_0272001
1627 Ga0495629_0043955
1628 Ga0495629_0083945
1629 Ga0495580_0010923
1630 Ga0495580_0063386
1631 Ga0495582_0071854
1632 Ga0495664_0015318
1633 Ga0495665_0038020
1634 Ga0495668_0010922
1635 Ga0495658_0032672
1636 Ga0495669_0000256
1637 Ga0495669_0007173
1638 Ga0495613_0035600
1639 Ga0495624_0067753
1640 Ga0495600_0110355
1641 Ga0495674_0037698
1642 Ga0495683_0078534
1643 Ga0495602_0027686
1644 Ga0496100_0151592
1645 Ga0496101_0007302
1646 Ga0496101_0040068
1647 Ga0496101_0083522
1648 Ga0496102_0035740
1649 Ga0496102_0120185
1650 Ga0496102_0144821
1651 Ga0496104_0091458
1652 Ga0496104_0117971
1653 Ga0496104_0123294
1654 Ga0496104_0255146
1655 Ga0496105_0010687
1656 Ga0496105_0015809
1657 Ga0496105_0063907
1658 Ga0496105_0137524
1659 Ga0496105_0276572
1660 Ga0496106_0000373
1661 Ga0496106_0040257
1662 Ga0496107_0003101
1663 Ga0496107_0006471
1664 Ga0496107_0033699
1665 Ga0496107_0046014
1666 Ga0496107_0126921
1667 Ga0496108_0001090
1668 Ga0496108_0001833
1669 Ga0496108_0024706
1670 Ga0496109_0011758
1671 Ga0496109_0031747
1672 Ga0496110_0000437
1673 Ga0496110_0054710
1674 Ga0496111_0005971
1675 Ga0496111_0011295
1676 Ga0496111_0032967
1677 Ga0496112_0002186
1678 Ga0496112_0006749
1679 Ga0496112_0026425
1680 Ga0496112_0135045
1681 Ga0496112_0250537
1682 Ga0496113_0002318
1683 Ga0496113_0002609
1684 Ga0496113_0005539
1685 Ga0496113_0015360
1686 Ga0496113_0016082
1687 Ga0496114_0100831
1688 Ga0496115_0001337
1689 Ga0496115_0013235
1690 Ga0496115_0029580
1691 Ga0496121_0000789
1692 Ga0496126_0012887
1693 Ga0501046_0088011
1694 Ga0501047_0011428
1695 Ga0501047_0263728
1696 Ga0501079_0268853
1697 Ga0501080_0249572
1698 Ga0501080_0319035
1699 Ga0501035_0117685
1700 Ga0501044_0095897
1701 Ga0501044_0228725
1702 nmdc:mga0n895_362348_c1
1703 nmdc:mga0rr50_8343_c1
1704 Ga0495612_0058660

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

52

251

0.86

PF07690

MFS_1

Major Facilitator Superfamily

258

445

0.83

PF07690

MFS_1

Major Facilitator Superfamily

57

287

0.83

PF00083

Sugar_tr

Sugar (and other) transporter

244

432

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8516 16 396
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.8454 12 401
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.839 12 395
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8354 11 396
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.834 9 393
ID Description Score Start End Superfamily
af_O07730_11_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9592 15 200 1.20.1250.20
af_O07730_221_402_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9539 221 400 1.20.1250.20
af_A0A1D8PLY7_278_479_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9459 206 405 1.20.1250.20
af_P41036_15_224_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9397 11 208 1.20.1250.20
af_O07730_221_402_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9385 221 400 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0K8QG27-F1-model_v4 Carboxylic acid transporter protein homolog 0.9141 10 409 GO:0005886
GO:0046943
AF-A0A358L2B6-F1-model_v4 MFS transporter 0.9078 16 395 GO:0005886
GO:0022857
AF-A0A137PBB5-F1-model_v4 MFS general substrate transporter 0.9073 8 396 GO:0005886
GO:0046943
AF-A0A2V5MJN3-F1-model_v4 MFS transporter 0.903 1 325 GO:0005886
GO:0046943
AF-A0A5E7KTU3-F1-model_v4 Inner membrane transport protein YnfM 0.902 9 394 GO:0005886
GO:0022857

Map