F483497
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 852 | 241 | 1704 | 407 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10014894|Ga0157373_100148943 |
| Length | 447 |
| Sequence | MRHSDLNSVSGVFIILPPACRPGRASPQPRIEGDDRMSLIADLKSLEPQQRSAIWASYLGWTLDAFDYFLMVFMLKAIAAEFGTDISAVSSAVFLTLAARPIGAFVFGWLAEHLGRRPVLMADIILFSIFEFASGFAPSLTSLLVLRFLFGIAMGGEWGLGASLVMESIPARLRGPVSGLLQSGYPSGYFVASIVYFLLFDTIGWRGMFMVGVAPALLVLLIRIYVKESPVFEAQRGKKRANPVAELLRYWKIALYMIVLMAAFNAFSHGTQDLYPTFLQQQHHYDTHTTGILTAIMNLGAIVGGIGFGIWSERLGRKRAIIIASILALPVIPLWAFASTPLLLAIGAFLMQVAVQGAWGIVPVHLNELSPPAARALFPGFAYQLGNLIMSKNAVFQAQIAESHGNNYGLALAIFGGSMAVVIVVWTAFGPERKEADFIADARAAET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 101 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 102 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 103 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 104 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 167 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 189 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 190 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 191 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 230 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 231 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 232 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 233 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.94 |
| Metatranscriptomes | 1.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 5.52 |
| Rhizosphere | 93.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157373_10014894 | 3300013100 | Bacteria | 5694 |
| 2 | LJNas_1001617 | 3300000546 | Bacteria | 3073 |
| 3 | JGI24741J21665_1007592 | 3300001915 | Bacteria | 2096 |
| 4 | JGI24740J21852_10003203 | 3300001979 | Bacteria | 7222 |
| 5 | JGI24740J21852_10021050 | 3300001979 | Bacteria | 2266 |
| 6 | JGI24740J21852_10024635 | 3300001979 | Bacteria | 2039 |
| 7 | JGI24739J22299_10004897 | 3300001989 | Bacteria | 5100 |
| 8 | JGI24739J22299_10006120 | 3300001989 | Bacteria | 4547 |
| 9 | JGI24737J22298_10001320 | 3300001990 | Bacteria | 8787 |
| 10 | JGI24737J22298_10001643 | 3300001990 | Bacteria | 7973 |
| 11 | JGI24737J22298_10010439 | 3300001990 | Bacteria | 3065 |
| 12 | JGI24744J21845_10000004 | 3300002077 | Bacteria | 25863 |
| 13 | JGI24742J22300_10010138 | 3300002244 | Bacteria | 1557 |
| 14 | Ga0065715_10037121 | 3300005293 | Bacteria | 1477 |
| 15 | Ga0070658_10000360 | 3300005327 | Bacteria | 39619 |
| 16 | Ga0070658_10000743 | 3300005327 | Bacteria | 27964 |
| 17 | Ga0070658_10000999 | 3300005327 | Bacteria | 24269 |
| 18 | Ga0070658_10047112 | 3300005327 | Bacteria | 3488 |
| 19 | Ga0070658_10075199 | 3300005327 | Bacteria | 2770 |
| 20 | Ga0070658_10089199 | 3300005327 | Bacteria | 2539 |
| 21 | Ga0070658_10094152 | 3300005327 | Bacteria | 2471 |
| 22 | Ga0070658_10099086 | 3300005327 | Bacteria | 2408 |
| 23 | Ga0070658_10211125 | 3300005327 | Bacteria | 1640 |
| 24 | Ga0070658_10320879 | 3300005327 | Bacteria | 1323 |
| 25 | Ga0070683_100000348 | 3300005329 | Bacteria | 31815 |
| 26 | Ga0070683_100018151 | 3300005329 | Bacteria | 6226 |
| 27 | Ga0070683_100023100 | 3300005329 | Bacteria | 5561 |
| 28 | Ga0070683_100103155 | 3300005329 | Bacteria | 2687 |
| 29 | Ga0070683_100103441 | 3300005329 | Bacteria | 2684 |
| 30 | Ga0070690_100065591 | 3300005330 | Bacteria | 2348 |
| 31 | Ga0070670_100003619 | 3300005331 | Bacteria | 12864 |
| 32 | Ga0070670_100017820 | 3300005331 | Bacteria | 6094 |
| 33 | Ga0070677_10034494 | 3300005333 | Bacteria | 1956 |
| 34 | Ga0070666_10000361 | 3300005335 | Bacteria | 28647 |
| 35 | Ga0070666_10002549 | 3300005335 | Bacteria | 11021 |
| 36 | Ga0070666_10016340 | 3300005335 | Bacteria | 4747 |
| 37 | Ga0070666_10037158 | 3300005335 | Bacteria | 3237 |
| 38 | Ga0070680_100003113 | 3300005336 | Bacteria | 12313 |
| 39 | Ga0070680_100023043 | 3300005336 | Bacteria | 4962 |
| 40 | Ga0070680_100025180 | 3300005336 | Bacteria | 4754 |
| 41 | Ga0070680_100038713 | 3300005336 | Bacteria | 3858 |
| 42 | Ga0070682_100023814 | 3300005337 | Bacteria | 3639 |
| 43 | Ga0070660_100000075 | 3300005339 | Bacteria | 59407 |
| 44 | Ga0070660_100000085 | 3300005339 | Bacteria | 56233 |
| 45 | Ga0070660_100004364 | 3300005339 | Bacteria | 9768 |
| 46 | Ga0070660_100013229 | 3300005339 | Bacteria | 5913 |
| 47 | Ga0070660_100020568 | 3300005339 | Bacteria | 4852 |
| 48 | Ga0070660_100038463 | 3300005339 | Bacteria | 3632 |
| 49 | Ga0070660_100041827 | 3300005339 | Bacteria | 3494 |
| 50 | Ga0070660_100054919 | 3300005339 | Bacteria | 3077 |
| 51 | Ga0070660_100063218 | 3300005339 | Bacteria | 2877 |
| 52 | Ga0070689_100007712 | 3300005340 | Bacteria | 7540 |
| 53 | Ga0070687_100038429 | 3300005343 | Bacteria | 2399 |
| 54 | Ga0070661_100000273 | 3300005344 | Bacteria | 41798 |
| 55 | Ga0070661_100005367 | 3300005344 | Bacteria | 8836 |
| 56 | Ga0070661_100015698 | 3300005344 | Bacteria | 5346 |
| 57 | Ga0070661_100019668 | 3300005344 | Bacteria | 4812 |
| 58 | Ga0070661_100066607 | 3300005344 | Bacteria | 2646 |
| 59 | Ga0070661_100072884 | 3300005344 | Bacteria | 2528 |
| 60 | Ga0070661_100087715 | 3300005344 | Bacteria | 2302 |
| 61 | Ga0070661_100095137 | 3300005344 | Bacteria | 2209 |
| 62 | Ga0070661_100102671 | 3300005344 | Bacteria | 2129 |
| 63 | Ga0070692_10010244 | 3300005345 | Bacteria | 4259 |
| 64 | Ga0070692_10027385 | 3300005345 | Bacteria | 2824 |
| 65 | Ga0070668_100048786 | 3300005347 | Bacteria | 3256 |
| 66 | Ga0070669_100000223 | 3300005353 | Bacteria | 47302 |
| 67 | Ga0070669_100049969 | 3300005353 | Bacteria | 3054 |
| 68 | Ga0070675_100007141 | 3300005354 | Bacteria | 8604 |
| 69 | Ga0070675_100054340 | 3300005354 | Bacteria | 3295 |
| 70 | Ga0070675_100143386 | 3300005354 | Bacteria | 2043 |
| 71 | Ga0070671_100000203 | 3300005355 | Bacteria | 39672 |
| 72 | Ga0070671_100005825 | 3300005355 | Bacteria | 9817 |
| 73 | Ga0070671_100007366 | 3300005355 | Bacteria | 8789 |
| 74 | Ga0070671_100020491 | 3300005355 | Bacteria | 5393 |
| 75 | Ga0070671_100020894 | 3300005355 | Bacteria | 5340 |
| 76 | Ga0070671_100038153 | 3300005355 | Bacteria | 3988 |
| 77 | Ga0070671_100046922 | 3300005355 | Bacteria | 3593 |
| 78 | Ga0070671_100306176 | 3300005355 | Bacteria | 1353 |
| 79 | Ga0070674_100010177 | 3300005356 | Bacteria | 5667 |
| 80 | Ga0070674_100045871 | 3300005356 | Bacteria | 2987 |
| 81 | Ga0070673_100001900 | 3300005364 | Bacteria | 12530 |
| 82 | Ga0070673_100089442 | 3300005364 | Bacteria | 2513 |
| 83 | Ga0070673_100210141 | 3300005364 | Bacteria | 1680 |
| 84 | Ga0070688_100000374 | 3300005365 | Bacteria | 22697 |
| 85 | Ga0070659_100000084 | 3300005366 | Bacteria | 71138 |
| 86 | Ga0070659_100001028 | 3300005366 | Bacteria | 20424 |
| 87 | Ga0070659_100005791 | 3300005366 | Bacteria | 8897 |
| 88 | Ga0070659_100006706 | 3300005366 | Bacteria | 8325 |
| 89 | Ga0070659_100016958 | 3300005366 | Bacteria | 5475 |
| 90 | Ga0070659_100045177 | 3300005366 | Bacteria | 3450 |
| 91 | Ga0070659_100080452 | 3300005366 | Bacteria | 2601 |
| 92 | Ga0070659_100085542 | 3300005366 | Bacteria | 2522 |
| 93 | Ga0070659_100095351 | 3300005366 | Bacteria | 2390 |
| 94 | Ga0070659_100103374 | 3300005366 | Bacteria | 2294 |
| 95 | Ga0070667_100007738 | 3300005367 | Bacteria | 8909 |
| 96 | Ga0070667_100008302 | 3300005367 | Bacteria | 8608 |
| 97 | Ga0070667_100026745 | 3300005367 | Bacteria | 4801 |
| 98 | Ga0070667_100028226 | 3300005367 | Bacteria | 4671 |
| 99 | Ga0070667_100051297 | 3300005367 | Bacteria | 3478 |
| 100 | Ga0070709_10000022 | 3300005434 | Bacteria | 135498 |
| 101 | Ga0070709_10000563 | 3300005434 | Bacteria | 21656 |
| 102 | Ga0070709_10012639 | 3300005434 | Bacteria | 4728 |
| 103 | Ga0070709_10019688 | 3300005434 | Bacteria | 3905 |
| 104 | Ga0070714_100051939 | 3300005435 | Bacteria | 3495 |
| 105 | Ga0070714_100053434 | 3300005435 | Bacteria | 3448 |
| 106 | Ga0070714_100061763 | 3300005435 | Unclassified | 3219 |
| 107 | Ga0070714_100072338 | 3300005435 | Bacteria | 2984 |
| 108 | Ga0070714_100139711 | 3300005435 | Bacteria | 2173 |
| 109 | Ga0070714_100223734 | 3300005435 | Bacteria | 1731 |
| 110 | Ga0070713_100000021 | 3300005436 | Bacteria | 107806 |
| 111 | Ga0070713_100000203 | 3300005436 | Bacteria | 39626 |
| 112 | Ga0070713_100015342 | 3300005436 | Bacteria | 5722 |
| 113 | Ga0070713_100018456 | 3300005436 | Bacteria | 5301 |
| 114 | Ga0070713_100168170 | 3300005436 | Unclassified | 1962 |
| 115 | Ga0070713_100333412 | 3300005436 | Bacteria | 1404 |
| 116 | Ga0070710_10003233 | 3300005437 | Bacteria | 7717 |
| 117 | Ga0070710_10082470 | 3300005437 | Bacteria | 1880 |
| 118 | Ga0070701_10006994 | 3300005438 | Bacteria | 4784 |
| 119 | Ga0070711_100000077 | 3300005439 | Bacteria | 54563 |
| 120 | Ga0070711_100012307 | 3300005439 | Bacteria | 5338 |
| 121 | Ga0070694_100048112 | 3300005444 | Bacteria | 2868 |
| 122 | Ga0070708_100104197 | 3300005445 | Bacteria | 2601 |
| 123 | Ga0070663_100009524 | 3300005455 | Bacteria | 6018 |
| 124 | Ga0070663_100011408 | 3300005455 | Bacteria | 5577 |
| 125 | Ga0070663_100019027 | 3300005455 | Bacteria | 4516 |
| 126 | Ga0070663_100047093 | 3300005455 | Bacteria | 3054 |
| 127 | Ga0070663_100048650 | 3300005455 | Bacteria | 3007 |
| 128 | Ga0070663_100202163 | 3300005455 | Bacteria | 1551 |
| 129 | Ga0070678_100000630 | 3300005456 | Bacteria | 17294 |
| 130 | Ga0070662_100000058 | 3300005457 | Bacteria | 59818 |
| 131 | Ga0070662_100052178 | 3300005457 | Bacteria | 2955 |
| 132 | Ga0070662_100136191 | 3300005457 | Bacteria | 1899 |
| 133 | Ga0070681_10018435 | 3300005458 | Bacteria | 6976 |
| 134 | Ga0070681_10055945 | 3300005458 | Bacteria | 3926 |
| 135 | Ga0070681_10102537 | 3300005458 | Bacteria | 2806 |
| 136 | Ga0070681_10228626 | 3300005458 | Bacteria | 1774 |
| 137 | Ga0070685_10001541 | 3300005466 | Bacteria | 12156 |
| 138 | Ga0070706_100016985 | 3300005467 | Bacteria | 6722 |
| 139 | Ga0070706_100021658 | 3300005467 | Bacteria | 5920 |
| 140 | Ga0070707_100054897 | 3300005468 | Bacteria | 3820 |
| 141 | Ga0070699_100017663 | 3300005518 | Bacteria | 6124 |
| 142 | Ga0070699_100034322 | 3300005518 | Bacteria | 4384 |
| 143 | Ga0070679_100009124 | 3300005530 | Bacteria | 9362 |
| 144 | Ga0070679_100018253 | 3300005530 | Bacteria | 6804 |
| 145 | Ga0070679_100065031 | 3300005530 | Bacteria | 3635 |
| 146 | Ga0070679_100089656 | 3300005530 | Bacteria | 3062 |
| 147 | Ga0070679_100100180 | 3300005530 | Bacteria | 2884 |
| 148 | Ga0070679_100107772 | 3300005530 | Bacteria | 2772 |
| 149 | Ga0070679_100266376 | 3300005530 | Bacteria | 1668 |
| 150 | Ga0070684_100002051 | 3300005535 | Bacteria | 14834 |
| 151 | Ga0070684_100010435 | 3300005535 | Bacteria | 7360 |
| 152 | Ga0070684_100020947 | 3300005535 | Bacteria | 5428 |
| 153 | Ga0068853_100000039 | 3300005539 | Bacteria | 107039 |
| 154 | Ga0068853_100000223 | 3300005539 | Bacteria | 40165 |
| 155 | Ga0068853_100001982 | 3300005539 | Bacteria | 15099 |
| 156 | Ga0068853_100009358 | 3300005539 | Bacteria | 7899 |
| 157 | Ga0068853_100009546 | 3300005539 | Bacteria | 7817 |
| 158 | Ga0068853_100023634 | 3300005539 | Bacteria | 5148 |
| 159 | Ga0068853_100035596 | 3300005539 | Bacteria | 4230 |
| 160 | Ga0070672_100005790 | 3300005543 | Bacteria | 8242 |
| 161 | Ga0070672_100201127 | 3300005543 | Bacteria | 1666 |
| 162 | Ga0070693_100002238 | 3300005547 | Bacteria | 8882 |
| 163 | Ga0070665_100004855 | 3300005548 | Bacteria | 13970 |
| 164 | Ga0070665_100056169 | 3300005548 | Bacteria | 3948 |
| 165 | Ga0070665_100081333 | 3300005548 | Bacteria | 3245 |
| 166 | Ga0070665_100314707 | 3300005548 | Bacteria | 1569 |
| 167 | Ga0068855_100001063 | 3300005563 | Bacteria | 34041 |
| 168 | Ga0068855_100001315 | 3300005563 | Bacteria | 30794 |
| 169 | Ga0068855_100003197 | 3300005563 | Bacteria | 20063 |
| 170 | Ga0068855_100005593 | 3300005563 | Bacteria | 15339 |
| 171 | Ga0068855_100011514 | 3300005563 | Bacteria | 10689 |
| 172 | Ga0068855_100012825 | 3300005563 | Bacteria | 10112 |
| 173 | Ga0068855_100018966 | 3300005563 | Bacteria | 8270 |
| 174 | Ga0068855_100026375 | 3300005563 | Bacteria | 6950 |
| 175 | Ga0068855_100041231 | 3300005563 | Bacteria | 5472 |
| 176 | Ga0068855_100046984 | 3300005563 | Bacteria | 5102 |
| 177 | Ga0068855_100057892 | 3300005563 | Bacteria | 4542 |
| 178 | Ga0068855_100165480 | 3300005563 | Bacteria | 2507 |
| 179 | Ga0068855_100172350 | 3300005563 | Bacteria | 2450 |
| 180 | Ga0070664_100000032 | 3300005564 | Bacteria | 88298 |
| 181 | Ga0070664_100006415 | 3300005564 | Bacteria | 9489 |
| 182 | Ga0070664_100012600 | 3300005564 | Bacteria | 6881 |
| 183 | Ga0070664_100096199 | 3300005564 | Bacteria | 2569 |
| 184 | Ga0070664_100102747 | 3300005564 | Bacteria | 2487 |
| 185 | Ga0070664_100107599 | 3300005564 | Bacteria | 2431 |
| 186 | Ga0070664_100185018 | 3300005564 | Bacteria | 1853 |
| 187 | Ga0068857_100004731 | 3300005577 | Bacteria | 11533 |
| 188 | Ga0068857_100019952 | 3300005577 | Bacteria | 5891 |
| 189 | Ga0068857_100091760 | 3300005577 | Bacteria | 2719 |
| 190 | Ga0068857_100098639 | 3300005577 | Bacteria | 2620 |
| 191 | Ga0068854_100000314 | 3300005578 | Bacteria | 31949 |
| 192 | Ga0068854_100001532 | 3300005578 | Bacteria | 14025 |
| 193 | Ga0068854_100016199 | 3300005578 | Bacteria | 4962 |
| 194 | Ga0068854_100020640 | 3300005578 | Bacteria | 4462 |
| 195 | Ga0068854_100024262 | 3300005578 | Bacteria | 4150 |
| 196 | Ga0068854_100054774 | 3300005578 | Bacteria | 2870 |
| 197 | Ga0068854_100118287 | 3300005578 | Bacteria | 2007 |
| 198 | Ga0068856_100000161 | 3300005614 | Bacteria | 69696 |
| 199 | Ga0068856_100001238 | 3300005614 | Bacteria | 26796 |
| 200 | Ga0068856_100007720 | 3300005614 | Bacteria | 10503 |
| 201 | Ga0068856_100026871 | 3300005614 | Bacteria | 5613 |
| 202 | Ga0068856_100076712 | 3300005614 | Bacteria | 3311 |
| 203 | Ga0068856_100078842 | 3300005614 | Bacteria | 3265 |
| 204 | Ga0068856_100132313 | 3300005614 | Bacteria | 2499 |
| 205 | Ga0068856_100197811 | 3300005614 | Bacteria | 2024 |
| 206 | Ga0068856_100257849 | 3300005614 | Bacteria | 1759 |
| 207 | Ga0068856_100306126 | 3300005614 | Bacteria | 1607 |
| 208 | Ga0068852_100002985 | 3300005616 | Bacteria | 11756 |
| 209 | Ga0068852_100013842 | 3300005616 | Bacteria | 6186 |
| 210 | Ga0068852_100018448 | 3300005616 | Bacteria | 5497 |
| 211 | Ga0068852_100020755 | 3300005616 | Bacteria | 5227 |
| 212 | Ga0068852_100021513 | 3300005616 | Bacteria | 5153 |
| 213 | Ga0068852_100030605 | 3300005616 | Bacteria | 4434 |
| 214 | Ga0068852_100308124 | 3300005616 | Bacteria | 1534 |
| 215 | Ga0068859_100017524 | 3300005617 | Bacteria | 7200 |
| 216 | Ga0068859_100027593 | 3300005617 | Bacteria | 5694 |
| 217 | Ga0068859_100031437 | 3300005617 | Bacteria | 5332 |
| 218 | Ga0068864_100002932 | 3300005618 | Bacteria | 14102 |
| 219 | Ga0068864_100006287 | 3300005618 | Bacteria | 9743 |
| 220 | Ga0068864_100017685 | 3300005618 | Bacteria | 5946 |
| 221 | Ga0068864_100101547 | 3300005618 | Bacteria | 2551 |
| 222 | Ga0068866_10041703 | 3300005718 | Bacteria | 2279 |
| 223 | Ga0068851_10028353 | 3300005834 | Bacteria | 2766 |
| 224 | Ga0068851_10034363 | 3300005834 | Bacteria | 2530 |
| 225 | Ga0068863_100008593 | 3300005841 | Bacteria | 9982 |
| 226 | Ga0068863_100032339 | 3300005841 | Bacteria | 4986 |
| 227 | Ga0068863_100074402 | 3300005841 | Bacteria | 3214 |
| 228 | Ga0068863_100147519 | 3300005841 | Bacteria | 2250 |
| 229 | Ga0068863_100157624 | 3300005841 | Bacteria | 2174 |
| 230 | Ga0068858_100001179 | 3300005842 | Bacteria | 27095 |
| 231 | Ga0068858_100003126 | 3300005842 | Bacteria | 16570 |
| 232 | Ga0068858_100041193 | 3300005842 | Bacteria | 4283 |
| 233 | Ga0068858_100069930 | 3300005842 | Bacteria | 3254 |
| 234 | Ga0068858_100308446 | 3300005842 | Bacteria | 1511 |
| 235 | Ga0068862_100176218 | 3300005844 | Bacteria | 1917 |
| 236 | Ga0081539_10037046 | 3300005985 | Bacteria | 2910 |
| 237 | Ga0070717_10004377 | 3300006028 | Bacteria | 10194 |
| 238 | Ga0070717_10005493 | 3300006028 | Bacteria | 9252 |
| 239 | Ga0070717_10013650 | 3300006028 | Bacteria | 6231 |
| 240 | Ga0070717_10024489 | 3300006028 | Bacteria | 4793 |
| 241 | Ga0070717_10056548 | 3300006028 | Bacteria | 3241 |
| 242 | Ga0070717_10058540 | 3300006028 | Unclassified | 3186 |
| 243 | Ga0070717_10122762 | 3300006028 | Bacteria | 2227 |
| 244 | Ga0070716_100000377 | 3300006173 | Bacteria | 18215 |
| 245 | Ga0070716_100000838 | 3300006173 | Bacteria | 13275 |
| 246 | Ga0070716_100015929 | 3300006173 | Bacteria | 3873 |
| 247 | Ga0070712_100000425 | 3300006175 | Bacteria | 24222 |
| 248 | Ga0070712_100000440 | 3300006175 | Bacteria | 23727 |
| 249 | Ga0070712_100005709 | 3300006175 | Bacteria | 7696 |
| 250 | Ga0070712_100021452 | 3300006175 | Unclassified | 4242 |
| 251 | Ga0070712_100149460 | 3300006175 | Bacteria | 1792 |
| 252 | Ga0097621_100004933 | 3300006237 | Bacteria | 9362 |
| 253 | Ga0097621_100143394 | 3300006237 | Bacteria | 2043 |
| 254 | Ga0068871_100008802 | 3300006358 | Bacteria | 7271 |
| 255 | Ga0068871_100026938 | 3300006358 | Bacteria | 4491 |
| 256 | Ga0068871_100060747 | 3300006358 | Bacteria | 3084 |
| 257 | Ga0068871_100174763 | 3300006358 | Bacteria | 1843 |
| 258 | Ga0075434_100195250 | 3300006871 | Bacteria | 2044 |
| 259 | Ga0097620_100017524 | 3300006931 | Bacteria | 7200 |
| 260 | Ga0097620_100027593 | 3300006931 | Bacteria | 5694 |
| 261 | Ga0097620_100031437 | 3300006931 | Bacteria | 5332 |
| 262 | Ga0075435_100042914 | 3300007076 | Bacteria | 3619 |
| 263 | Ga0099795_10002513 | 3300007788 | Bacteria | 4335 |
| 264 | Ga0105240_10006207 | 3300009093 | Bacteria | 17584 |
| 265 | Ga0105240_10017834 | 3300009093 | Bacteria | 9552 |
| 266 | Ga0105240_10029819 | 3300009093 | Bacteria | 7100 |
| 267 | Ga0105240_10038385 | 3300009093 | Bacteria | 6143 |
| 268 | Ga0105240_10039803 | 3300009093 | Bacteria | 6017 |
| 269 | Ga0105240_10086501 | 3300009093 | Bacteria | 3839 |
| 270 | Ga0105240_10103756 | 3300009093 | Bacteria | 3453 |
| 271 | Ga0105240_10118247 | 3300009093 | Bacteria | 3194 |
| 272 | Ga0105245_10029098 | 3300009098 | Bacteria | 4879 |
| 273 | Ga0105243_10019943 | 3300009148 | Bacteria | 5084 |
| 274 | Ga0105241_10157266 | 3300009174 | Bacteria | 1865 |
| 275 | Ga0105248_10000223 | 3300009177 | Bacteria | 65010 |
| 276 | Ga0105248_10000678 | 3300009177 | Bacteria | 38605 |
| 277 | Ga0105248_10002629 | 3300009177 | Bacteria | 19979 |
| 278 | Ga0105248_10018018 | 3300009177 | Bacteria | 7795 |
| 279 | Ga0105248_10023133 | 3300009177 | Bacteria | 6902 |
| 280 | Ga0105248_10057947 | 3300009177 | Bacteria | 4349 |
| 281 | Ga0105248_10063204 | 3300009177 | Bacteria | 4155 |
| 282 | Ga0105248_10069080 | 3300009177 | Bacteria | 3967 |
| 283 | Ga0105248_10080965 | 3300009177 | Bacteria | 3651 |
| 284 | Ga0105237_10011865 | 3300009545 | Bacteria | 9214 |
| 285 | Ga0105237_10059585 | 3300009545 | Bacteria | 3819 |
| 286 | Ga0105238_10014708 | 3300009551 | Bacteria | 7913 |
| 287 | Ga0105238_10026598 | 3300009551 | Bacteria | 5899 |
| 288 | Ga0105238_10140706 | 3300009551 | Bacteria | 2390 |
| 289 | Ga0105238_10238552 | 3300009551 | Bacteria | 1796 |
| 290 | Ga0105249_10222332 | 3300009553 | Bacteria | 1858 |
| 291 | Ga0105246_10000072 | 3300011119 | Bacteria | 41904 |
| 292 | Ga0105246_10006938 | 3300011119 | Bacteria | 6932 |
| 293 | Ga0105246_10043671 | 3300011119 | Bacteria | 3042 |
| 294 | Ga0157373_10008901 | 3300013100 | Bacteria | 7428 |
| 295 | Ga0157373_10020087 | 3300013100 | Bacteria | 4859 |
| 296 | Ga0157373_10021720 | 3300013100 | Bacteria | 4658 |
| 297 | Ga0157373_10125616 | 3300013100 | Bacteria | 1804 |
| 298 | Ga0157373_10141875 | 3300013100 | Bacteria | 1690 |
| 299 | Ga0157373_10186021 | 3300013100 | Bacteria | 1463 |
| 300 | Ga0157371_10001103 | 3300013102 | Bacteria | 29269 |
| 301 | Ga0157371_10001297 | 3300013102 | Bacteria | 26313 |
| 302 | Ga0157371_10003962 | 3300013102 | Bacteria | 13135 |
| 303 | Ga0157371_10007626 | 3300013102 | Bacteria | 8729 |
| 304 | Ga0157371_10011159 | 3300013102 | Bacteria | 6949 |
| 305 | Ga0157371_10012119 | 3300013102 | Bacteria | 6605 |
| 306 | Ga0157371_10021573 | 3300013102 | Bacteria | 4727 |
| 307 | Ga0157371_10022459 | 3300013102 | Bacteria | 4624 |
| 308 | Ga0157371_10024032 | 3300013102 | Bacteria | 4452 |
| 309 | Ga0157371_10032066 | 3300013102 | Bacteria | 3782 |
| 310 | Ga0157371_10043946 | 3300013102 | Bacteria | 3182 |
| 311 | Ga0157371_10056891 | 3300013102 | Bacteria | 2774 |
| 312 | Ga0157371_10065238 | 3300013102 | Bacteria | 2579 |
| 313 | Ga0157370_10001094 | 3300013104 | Bacteria | 33972 |
| 314 | Ga0157370_10004189 | 3300013104 | Bacteria | 16690 |
| 315 | Ga0157370_10018716 | 3300013104 | Bacteria | 6964 |
| 316 | Ga0157370_10047298 | 3300013104 | Bacteria | 4124 |
| 317 | Ga0157370_10059417 | 3300013104 | Bacteria | 3633 |
| 318 | Ga0157370_10172510 | 3300013104 | Bacteria | 2010 |
| 319 | Ga0157369_10000141 | 3300013105 | Bacteria | 102055 |
| 320 | Ga0157369_10001072 | 3300013105 | Bacteria | 34302 |
| 321 | Ga0157369_10001999 | 3300013105 | Bacteria | 24545 |
| 322 | Ga0157369_10004058 | 3300013105 | Bacteria | 17343 |
| 323 | Ga0157369_10006247 | 3300013105 | Bacteria | 13824 |
| 324 | Ga0157369_10006378 | 3300013105 | Bacteria | 13682 |
| 325 | Ga0157369_10014521 | 3300013105 | Bacteria | 8887 |
| 326 | Ga0157369_10015998 | 3300013105 | Bacteria | 8442 |
| 327 | Ga0157369_10053969 | 3300013105 | Bacteria | 4340 |
| 328 | Ga0157369_10073116 | 3300013105 | Bacteria | 3679 |
| 329 | Ga0157374_10001508 | 3300013296 | Bacteria | 19606 |
| 330 | Ga0157374_10049268 | 3300013296 | Bacteria | 3912 |
| 331 | Ga0157374_10053261 | 3300013296 | Bacteria | 3772 |
| 332 | Ga0157374_10086814 | 3300013296 | Bacteria | 2977 |
| 333 | Ga0157374_10104402 | 3300013296 | Bacteria | 2720 |
| 334 | Ga0157378_10063467 | 3300013297 | Bacteria | 3301 |
| 335 | Ga0163162_10002279 | 3300013306 | Bacteria | 18008 |
| 336 | Ga0163162_10038319 | 3300013306 | Bacteria | 4784 |
| 337 | Ga0163162_10063884 | 3300013306 | Bacteria | 3725 |
| 338 | Ga0157372_10002710 | 3300013307 | Bacteria | 19159 |
| 339 | Ga0157372_10010724 | 3300013307 | Bacteria | 9754 |
| 340 | Ga0157372_10025893 | 3300013307 | Bacteria | 6380 |
| 341 | Ga0157372_10160985 | 3300013307 | Bacteria | 2594 |
| 342 | Ga0157375_10001921 | 3300013308 | Bacteria | 17878 |
| 343 | Ga0157375_10065270 | 3300013308 | Bacteria | 3628 |
| 344 | Ga0157375_10507883 | 3300013308 | Bacteria | 1369 |
| 345 | Ga0163163_10000567 | 3300014325 | Bacteria | 32441 |
| 346 | Ga0163163_10002130 | 3300014325 | Bacteria | 16711 |
| 347 | Ga0163163_10053966 | 3300014325 | Bacteria | 3969 |
| 348 | Ga0163163_10082522 | 3300014325 | Bacteria | 3218 |
| 349 | Ga0157380_10151404 | 3300014326 | Bacteria | 2006 |
| 350 | Ga0182008_10016095 | 3300014497 | Bacteria | 3892 |
| 351 | Ga0157379_10000861 | 3300014968 | Bacteria | 24618 |
| 352 | Ga0206356_10378585 | 3300020070 | Bacteria | 2505 |
| 353 | Ga0206354_10978830 | 3300020081 | Bacteria | 1967 |
| 354 | Ga0213871_10011864 | 3300021441 | Bacteria | 2009 |
| 355 | Ga0224570_100432 | 3300022730 | Bacteria | 3302 |
| 356 | Ga0224569_100572 | 3300022732 | Bacteria | 3168 |
| 357 | Ga0224572_1003132 | 3300024225 | Bacteria | 2765 |
| 358 | Ga0224572_1009654 | 3300024225 | Bacteria | 1804 |
| 359 | Ga0228598_1000866 | 3300024227 | Bacteria | 6541 |
| 360 | Ga0228598_1005518 | 3300024227 | Bacteria | 2640 |
| 361 | Ga0209148_1003061 | 3300025254 | Bacteria | 4934 |
| 362 | Ga0209233_1011609 | 3300025261 | Bacteria | 2591 |
| 363 | Ga0209455_1000626 | 3300025272 | Bacteria | 21929 |
| 364 | Ga0207697_10005851 | 3300025315 | Bacteria | 5651 |
| 365 | Ga0207697_10017105 | 3300025315 | Bacteria | 2980 |
| 366 | Ga0207697_10029316 | 3300025315 | Bacteria | 2252 |
| 367 | Ga0207656_10026293 | 3300025321 | Bacteria | 2372 |
| 368 | Ga0207682_10013147 | 3300025893 | Bacteria | 3228 |
| 369 | Ga0207688_10007562 | 3300025901 | Bacteria | 5913 |
| 370 | Ga0207680_10000518 | 3300025903 | Bacteria | 18426 |
| 371 | Ga0207680_10006417 | 3300025903 | Bacteria | 5687 |
| 372 | Ga0207680_10096884 | 3300025903 | Bacteria | 1888 |
| 373 | Ga0207680_10136172 | 3300025903 | Bacteria | 1623 |
| 374 | Ga0207647_10002810 | 3300025904 | Bacteria | 13132 |
| 375 | Ga0207647_10006908 | 3300025904 | Bacteria | 8228 |
| 376 | Ga0207647_10008256 | 3300025904 | Bacteria | 7478 |
| 377 | Ga0207647_10037498 | 3300025904 | Bacteria | 3073 |
| 378 | Ga0207647_10080546 | 3300025904 | Bacteria | 1953 |
| 379 | Ga0207699_10000011 | 3300025906 | Bacteria | 282783 |
| 380 | Ga0207699_10000364 | 3300025906 | Bacteria | 23996 |
| 381 | Ga0207699_10024688 | 3300025906 | Bacteria | 3289 |
| 382 | Ga0207699_10066436 | 3300025906 | Bacteria | 2189 |
| 383 | Ga0207643_10035252 | 3300025908 | Bacteria | 2804 |
| 384 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 385 | Ga0207705_10000061 | 3300025909 | Bacteria | 150179 |
| 386 | Ga0207705_10000918 | 3300025909 | Bacteria | 24102 |
| 387 | Ga0207705_10013814 | 3300025909 | Bacteria | 5823 |
| 388 | Ga0207705_10016227 | 3300025909 | Bacteria | 5342 |
| 389 | Ga0207705_10016301 | 3300025909 | Bacteria | 5329 |
| 390 | Ga0207705_10031351 | 3300025909 | Bacteria | 3794 |
| 391 | Ga0207705_10036402 | 3300025909 | Bacteria | 3522 |
| 392 | Ga0207705_10075318 | 3300025909 | Bacteria | 2451 |
| 393 | Ga0207705_10082774 | 3300025909 | Bacteria | 2341 |
| 394 | Ga0207705_10093020 | 3300025909 | Bacteria | 2210 |
| 395 | Ga0207705_10136713 | 3300025909 | Bacteria | 1828 |
| 396 | Ga0207707_10006776 | 3300025912 | Bacteria | 9996 |
| 397 | Ga0207707_10046745 | 3300025912 | Bacteria | 3770 |
| 398 | Ga0207695_10012696 | 3300025913 | Bacteria | 10086 |
| 399 | Ga0207695_10013178 | 3300025913 | Bacteria | 9865 |
| 400 | Ga0207695_10036067 | 3300025913 | Bacteria | 5350 |
| 401 | Ga0207695_10050843 | 3300025913 | Bacteria | 4357 |
| 402 | Ga0207695_10096511 | 3300025913 | Bacteria | 2958 |
| 403 | Ga0207695_10204029 | 3300025913 | Bacteria | 1890 |
| 404 | Ga0207693_10000047 | 3300025915 | Bacteria | 100876 |
| 405 | Ga0207693_10000050 | 3300025915 | Bacteria | 100076 |
| 406 | Ga0207693_10016751 | 3300025915 | Bacteria | 5854 |
| 407 | Ga0207693_10040192 | 3300025915 | Unclassified | 3683 |
| 408 | Ga0207693_10253604 | 3300025915 | Bacteria | 1380 |
| 409 | Ga0207663_10000673 | 3300025916 | Bacteria | 15115 |
| 410 | Ga0207663_10011303 | 3300025916 | Bacteria | 4791 |
| 411 | Ga0207660_10000772 | 3300025917 | Bacteria | 21300 |
| 412 | Ga0207660_10026011 | 3300025917 | Bacteria | 3980 |
| 413 | Ga0207660_10068510 | 3300025917 | Bacteria | 2574 |
| 414 | Ga0207660_10074043 | 3300025917 | Bacteria | 2484 |
| 415 | Ga0207662_10016373 | 3300025918 | Bacteria | 4184 |
| 416 | Ga0207657_10000164 | 3300025919 | Bacteria | 67184 |
| 417 | Ga0207657_10000345 | 3300025919 | Bacteria | 49222 |
| 418 | Ga0207657_10001584 | 3300025919 | Bacteria | 24464 |
| 419 | Ga0207657_10001711 | 3300025919 | Bacteria | 23648 |
| 420 | Ga0207657_10004331 | 3300025919 | Bacteria | 15036 |
| 421 | Ga0207657_10005526 | 3300025919 | Bacteria | 13197 |
| 422 | Ga0207657_10006149 | 3300025919 | Bacteria | 12479 |
| 423 | Ga0207657_10015537 | 3300025919 | Bacteria | 7375 |
| 424 | Ga0207657_10017974 | 3300025919 | Bacteria | 6766 |
| 425 | Ga0207657_10019328 | 3300025919 | Bacteria | 6474 |
| 426 | Ga0207657_10026751 | 3300025919 | Bacteria | 5294 |
| 427 | Ga0207657_10033505 | 3300025919 | Bacteria | 4630 |
| 428 | Ga0207657_10056776 | 3300025919 | Bacteria | 3376 |
| 429 | Ga0207657_10092394 | 3300025919 | Bacteria | 2522 |
| 430 | Ga0207657_10123617 | 3300025919 | Bacteria | 2127 |
| 431 | Ga0207649_10000580 | 3300025920 | Bacteria | 25006 |
| 432 | Ga0207649_10004183 | 3300025920 | Bacteria | 7858 |
| 433 | Ga0207649_10016043 | 3300025920 | Bacteria | 4217 |
| 434 | Ga0207649_10044351 | 3300025920 | Bacteria | 2722 |
| 435 | Ga0207649_10071578 | 3300025920 | Bacteria | 2215 |
| 436 | Ga0207649_10096519 | 3300025920 | Bacteria | 1947 |
| 437 | Ga0207649_10104193 | 3300025920 | Bacteria | 1883 |
| 438 | Ga0207652_10002403 | 3300025921 | Bacteria | 15807 |
| 439 | Ga0207652_10003472 | 3300025921 | Bacteria | 12998 |
| 440 | Ga0207652_10007674 | 3300025921 | Bacteria | 8675 |
| 441 | Ga0207652_10037752 | 3300025921 | Bacteria | 4090 |
| 442 | Ga0207681_10000160 | 3300025923 | Bacteria | 55315 |
| 443 | Ga0207694_10006089 | 3300025924 | Bacteria | 9222 |
| 444 | Ga0207694_10052729 | 3300025924 | Bacteria | 3153 |
| 445 | Ga0207650_10015723 | 3300025925 | Bacteria | 5275 |
| 446 | Ga0207650_10045673 | 3300025925 | Bacteria | 3223 |
| 447 | Ga0207659_10010230 | 3300025926 | Bacteria | 5884 |
| 448 | Ga0207659_10168094 | 3300025926 | Bacteria | 1728 |
| 449 | Ga0207687_10124672 | 3300025927 | Bacteria | 1932 |
| 450 | Ga0207700_10000136 | 3300025928 | Bacteria | 43796 |
| 451 | Ga0207700_10000316 | 3300025928 | Bacteria | 28259 |
| 452 | Ga0207700_10012026 | 3300025928 | Bacteria | 5557 |
| 453 | Ga0207700_10119365 | 3300025928 | Unclassified | 2135 |
| 454 | Ga0207664_10000282 | 3300025929 | Bacteria | 38631 |
| 455 | Ga0207664_10008717 | 3300025929 | Bacteria | 7091 |
| 456 | Ga0207664_10077778 | 3300025929 | Bacteria | 2689 |
| 457 | Ga0207644_10000022 | 3300025931 | Bacteria | 160689 |
| 458 | Ga0207644_10000746 | 3300025931 | Bacteria | 20634 |
| 459 | Ga0207644_10001457 | 3300025931 | Bacteria | 15258 |
| 460 | Ga0207644_10005632 | 3300025931 | Bacteria | 8156 |
| 461 | Ga0207644_10009721 | 3300025931 | Bacteria | 6323 |
| 462 | Ga0207644_10028759 | 3300025931 | Bacteria | 3851 |
| 463 | Ga0207644_10042270 | 3300025931 | Bacteria | 3229 |
| 464 | Ga0207644_10046607 | 3300025931 | Bacteria | 3089 |
| 465 | Ga0207690_10000062 | 3300025932 | Bacteria | 96511 |
| 466 | Ga0207690_10001573 | 3300025932 | Bacteria | 14274 |
| 467 | Ga0207690_10004364 | 3300025932 | Bacteria | 8349 |
| 468 | Ga0207690_10009010 | 3300025932 | Bacteria | 5923 |
| 469 | Ga0207690_10013707 | 3300025932 | Bacteria | 4879 |
| 470 | Ga0207690_10020587 | 3300025932 | Bacteria | 4079 |
| 471 | Ga0207690_10046394 | 3300025932 | Bacteria | 2877 |
| 472 | Ga0207690_10072138 | 3300025932 | Bacteria | 2384 |
| 473 | Ga0207690_10126254 | 3300025932 | Bacteria | 1866 |
| 474 | Ga0207690_10198165 | 3300025932 | Bacteria | 1523 |
| 475 | Ga0207706_10000196 | 3300025933 | Bacteria | 67184 |
| 476 | Ga0207706_10000715 | 3300025933 | Bacteria | 34638 |
| 477 | Ga0207706_10006555 | 3300025933 | Bacteria | 10783 |
| 478 | Ga0207706_10008742 | 3300025933 | Bacteria | 9323 |
| 479 | Ga0207706_10027550 | 3300025933 | Bacteria | 5080 |
| 480 | Ga0207706_10035013 | 3300025933 | Bacteria | 4467 |
| 481 | Ga0207706_10122330 | 3300025933 | Bacteria | 2289 |
| 482 | Ga0207709_10042968 | 3300025935 | Bacteria | 2722 |
| 483 | Ga0207669_10097743 | 3300025937 | Bacteria | 1931 |
| 484 | Ga0207669_10111833 | 3300025937 | Bacteria | 1832 |
| 485 | Ga0207665_10047024 | 3300025939 | Bacteria | 2892 |
| 486 | Ga0207691_10000892 | 3300025940 | Bacteria | 29583 |
| 487 | Ga0207691_10043242 | 3300025940 | Bacteria | 4152 |
| 488 | Ga0207691_10059083 | 3300025940 | Bacteria | 3487 |
| 489 | Ga0207691_10086591 | 3300025940 | Bacteria | 2811 |
| 490 | Ga0207691_10147772 | 3300025940 | Bacteria | 2068 |
| 491 | Ga0207711_10000123 | 3300025941 | Bacteria | 80861 |
| 492 | Ga0207711_10000698 | 3300025941 | Bacteria | 33120 |
| 493 | Ga0207711_10001850 | 3300025941 | Bacteria | 19299 |
| 494 | Ga0207711_10065841 | 3300025941 | Bacteria | 3133 |
| 495 | Ga0207711_10085407 | 3300025941 | Bacteria | 2765 |
| 496 | Ga0207711_10153177 | 3300025941 | Bacteria | 2082 |
| 497 | Ga0207711_10293885 | 3300025941 | Bacteria | 1498 |
| 498 | Ga0207689_10183436 | 3300025942 | Bacteria | 1726 |
| 499 | Ga0207661_10084618 | 3300025944 | Bacteria | 2627 |
| 500 | Ga0207661_10110634 | 3300025944 | Bacteria | 2323 |
| 501 | Ga0207661_10201029 | 3300025944 | Bacteria | 1752 |
| 502 | Ga0207679_10007348 | 3300025945 | Bacteria | 6986 |
| 503 | Ga0207679_10026300 | 3300025945 | Bacteria | 4011 |
| 504 | Ga0207679_10043736 | 3300025945 | Bacteria | 3227 |
| 505 | Ga0207679_10177304 | 3300025945 | Bacteria | 1760 |
| 506 | Ga0207667_10000187 | 3300025949 | Bacteria | 90766 |
| 507 | Ga0207667_10001975 | 3300025949 | Bacteria | 25689 |
| 508 | Ga0207667_10003114 | 3300025949 | Bacteria | 20524 |
| 509 | Ga0207667_10005280 | 3300025949 | Bacteria | 15758 |
| 510 | Ga0207667_10007569 | 3300025949 | Bacteria | 13032 |
| 511 | Ga0207667_10017505 | 3300025949 | Bacteria | 8064 |
| 512 | Ga0207667_10018230 | 3300025949 | Bacteria | 7877 |
| 513 | Ga0207667_10022749 | 3300025949 | Bacteria | 6914 |
| 514 | Ga0207667_10028314 | 3300025949 | Bacteria | 6086 |
| 515 | Ga0207667_10048874 | 3300025949 | Bacteria | 4471 |
| 516 | Ga0207667_10076419 | 3300025949 | Bacteria | 3475 |
| 517 | Ga0207667_10137063 | 3300025949 | Bacteria | 2520 |
| 518 | Ga0207667_10203175 | 3300025949 | Bacteria | 2032 |
| 519 | Ga0207651_10029989 | 3300025960 | Bacteria | 3456 |
| 520 | Ga0207651_10220262 | 3300025960 | Bacteria | 1533 |
| 521 | Ga0207651_10232986 | 3300025960 | Bacteria | 1496 |
| 522 | Ga0207668_10014655 | 3300025972 | Bacteria | 4855 |
| 523 | Ga0207640_10000001 | 3300025981 | Bacteria | 628778 |
| 524 | Ga0207640_10000526 | 3300025981 | Bacteria | 23106 |
| 525 | Ga0207640_10000533 | 3300025981 | Bacteria | 22806 |
| 526 | Ga0207640_10012035 | 3300025981 | Bacteria | 4917 |
| 527 | Ga0207640_10012482 | 3300025981 | Bacteria | 4840 |
| 528 | Ga0207640_10096943 | 3300025981 | Bacteria | 2057 |
| 529 | Ga0207658_10004498 | 3300025986 | Bacteria | 9687 |
| 530 | Ga0207658_10007286 | 3300025986 | Bacteria | 7544 |
| 531 | Ga0207658_10066381 | 3300025986 | Bacteria | 2714 |
| 532 | Ga0207677_10051407 | 3300026023 | Bacteria | 2794 |
| 533 | Ga0207703_10002052 | 3300026035 | Bacteria | 17777 |
| 534 | Ga0207703_10011537 | 3300026035 | Bacteria | 6874 |
| 535 | Ga0207703_10073623 | 3300026035 | Bacteria | 2826 |
| 536 | Ga0207639_10000037 | 3300026041 | Bacteria | 147685 |
| 537 | Ga0207639_10000124 | 3300026041 | Bacteria | 57560 |
| 538 | Ga0207639_10001229 | 3300026041 | Bacteria | 17375 |
| 539 | Ga0207639_10001939 | 3300026041 | Bacteria | 13893 |
| 540 | Ga0207639_10005669 | 3300026041 | Bacteria | 8449 |
| 541 | Ga0207678_10000864 | 3300026067 | Bacteria | 27765 |
| 542 | Ga0207678_10001943 | 3300026067 | Bacteria | 18865 |
| 543 | Ga0207678_10002554 | 3300026067 | Bacteria | 16583 |
| 544 | Ga0207678_10012310 | 3300026067 | Bacteria | 7511 |
| 545 | Ga0207678_10012383 | 3300026067 | Bacteria | 7486 |
| 546 | Ga0207678_10018770 | 3300026067 | Bacteria | 6075 |
| 547 | Ga0207678_10032354 | 3300026067 | Bacteria | 4557 |
| 548 | Ga0207678_10044093 | 3300026067 | Bacteria | 3859 |
| 549 | Ga0207678_10068490 | 3300026067 | Bacteria | 3044 |
| 550 | Ga0207678_10193110 | 3300026067 | Bacteria | 1740 |
| 551 | Ga0207678_10211756 | 3300026067 | Bacteria | 1658 |
| 552 | Ga0207702_10000373 | 3300026078 | Bacteria | 51177 |
| 553 | Ga0207702_10000435 | 3300026078 | Bacteria | 47593 |
| 554 | Ga0207702_10013863 | 3300026078 | Bacteria | 6694 |
| 555 | Ga0207702_10019792 | 3300026078 | Bacteria | 5573 |
| 556 | Ga0207702_10048269 | 3300026078 | Bacteria | 3590 |
| 557 | Ga0207702_10073701 | 3300026078 | Bacteria | 2945 |
| 558 | Ga0207702_10090505 | 3300026078 | Bacteria | 2677 |
| 559 | Ga0207702_10105008 | 3300026078 | Bacteria | 2501 |
| 560 | Ga0207702_10129869 | 3300026078 | Bacteria | 2266 |
| 561 | Ga0207702_10234513 | 3300026078 | Bacteria | 1716 |
| 562 | Ga0207641_10009762 | 3300026088 | Bacteria | 7904 |
| 563 | Ga0207641_10033481 | 3300026088 | Bacteria | 4268 |
| 564 | Ga0207641_10084720 | 3300026088 | Bacteria | 2760 |
| 565 | Ga0207641_10135996 | 3300026088 | Bacteria | 2212 |
| 566 | Ga0207641_10158780 | 3300026088 | Bacteria | 2054 |
| 567 | Ga0207648_10001874 | 3300026089 | Bacteria | 22999 |
| 568 | Ga0207676_10001817 | 3300026095 | Bacteria | 15638 |
| 569 | Ga0207676_10004323 | 3300026095 | Bacteria | 10046 |
| 570 | Ga0207676_10006547 | 3300026095 | Bacteria | 8236 |
| 571 | Ga0207674_10000756 | 3300026116 | Bacteria | 42260 |
| 572 | Ga0207674_10001923 | 3300026116 | Bacteria | 26367 |
| 573 | Ga0207674_10002383 | 3300026116 | Bacteria | 23761 |
| 574 | Ga0207674_10003759 | 3300026116 | Bacteria | 18521 |
| 575 | Ga0207674_10003802 | 3300026116 | Bacteria | 18408 |
| 576 | Ga0207674_10007288 | 3300026116 | Bacteria | 12892 |
| 577 | Ga0207674_10088434 | 3300026116 | Bacteria | 3091 |
| 578 | Ga0207674_10088777 | 3300026116 | Bacteria | 3084 |
| 579 | Ga0207674_10120191 | 3300026116 | Bacteria | 2595 |
| 580 | Ga0207683_10006484 | 3300026121 | Bacteria | 10014 |
| 581 | Ga0207683_10020648 | 3300026121 | Bacteria | 5637 |
| 582 | Ga0207683_10033518 | 3300026121 | Bacteria | 4461 |
| 583 | Ga0207698_10001156 | 3300026142 | Bacteria | 15373 |
| 584 | Ga0207698_10002484 | 3300026142 | Bacteria | 10938 |
| 585 | Ga0207698_10003821 | 3300026142 | Bacteria | 9113 |
| 586 | Ga0207698_10009904 | 3300026142 | Bacteria | 6097 |
| 587 | Ga0207698_10011478 | 3300026142 | Bacteria | 5748 |
| 588 | Ga0207698_10016438 | 3300026142 | Bacteria | 4987 |
| 589 | Ga0207698_10019357 | 3300026142 | Bacteria | 4659 |
| 590 | Ga0207698_10019720 | 3300026142 | Bacteria | 4623 |
| 591 | Ga0207698_10022284 | 3300026142 | Bacteria | 4398 |
| 592 | Ga0268266_10169636 | 3300028379 | Bacteria | 1980 |
| 593 | Ga0268265_10329720 | 3300028380 | Bacteria | 1386 |
| 594 | Ga0265334_10000048 | 3300028573 | Bacteria | 90958 |
| 595 | Ga0265338_10005486 | 3300028800 | Bacteria | 16537 |
| 596 | Ga0265338_10010452 | 3300028800 | Bacteria | 10880 |
| 597 | Ga0265762_1000092 | 3300030760 | Bacteria | 12519 |
| 598 | Ga0265762_1002205 | 3300030760 | Bacteria | 3526 |
| 599 | Ga0265762_1005058 | 3300030760 | Bacteria | 2361 |
| 600 | Ga0265762_1006105 | 3300030760 | Bacteria | 2158 |
| 601 | Ga0265760_10003431 | 3300031090 | Bacteria | 4604 |
| 602 | Ga0265760_10009198 | 3300031090 | Bacteria | 2822 |
| 603 | Ga0265760_10021466 | 3300031090 | Bacteria | 1869 |
| 604 | Ga0265325_10015715 | 3300031241 | Bacteria | 4248 |
| 605 | Ga0265339_10019321 | 3300031249 | Bacteria | 4004 |
| 606 | Ga0265339_10077173 | 3300031249 | Bacteria | 1766 |
| 607 | Ga0307411_10237080 | 3300032005 | Bacteria | 1426 |
| 608 | Ga0373944_0024637 | 3300035089 | Bacteria | 1766 |
| 609 | Ga0373936_0001719 | 3300035113 | Bacteria | 8044 |
| 610 | Ga0373936_0049715 | 3300035113 | Bacteria | 1694 |
| 611 | Ga0373945_0010225 | 3300035116 | Bacteria | 3087 |
| 612 | Ga0373954_0017426 | 3300035118 | Bacteria | 3227 |
| 613 | Ga0373943_0000242 | 3300035170 | Bacteria | 22548 |
| 614 | Ga0373943_0035288 | 3300035170 | Bacteria | 2389 |
| 615 | Ga0373924_0025739 | 3300035410 | Bacteria | 2327 |
| 616 | Ga0373931_0024543 | 3300035691 | Bacteria | 3055 |
| 617 | Ga0373935_0005846 | 3300035692 | Bacteria | 7287 |
| 618 | Ga0373935_0057713 | 3300035692 | Bacteria | 2477 |
| 619 | Ga0373927_0000484 | 3300035695 | Bacteria | 30616 |
| 620 | Ga0373933_0176948 | 3300035724 | Bacteria | 1359 |
| 621 | Ga0373947_0000384 | 3300035725 | Bacteria | 24915 |
| 622 | Ga0373937_0008424 | 3300036401 | Bacteria | 8963 |
| 623 | Ga0373937_0031002 | 3300036401 | Bacteria | 4842 |
| 624 | Ga0373937_0258570 | 3300036401 | Bacteria | 1642 |
| 625 | Ga0373925_0003285 | 3300037068 | Bacteria | 12574 |
| 626 | Ga0373925_0003873 | 3300037068 | Bacteria | 11445 |
| 627 | Ga0373925_0020614 | 3300037068 | Bacteria | 4802 |
| 628 | Ga0373925_0100627 | 3300037068 | Bacteria | 2221 |
| 629 | Ga0395899_0000724 | 3300037312 | Bacteria | 32986 |
| 630 | Ga0395899_0001699 | 3300037312 | Bacteria | 18359 |
| 631 | Ga0395899_0002780 | 3300037312 | Bacteria | 14109 |
| 632 | Ga0395899_0004300 | 3300037312 | Bacteria | 11125 |
| 633 | Ga0395899_0004537 | 3300037312 | Bacteria | 10819 |
| 634 | Ga0395899_0011605 | 3300037312 | Bacteria | 6746 |
| 635 | Ga0395899_0025764 | 3300037312 | Bacteria | 4439 |
| 636 | Ga0395899_0033450 | 3300037312 | Bacteria | 3861 |
| 637 | Ga0395899_0043985 | 3300037312 | Bacteria | 3327 |
| 638 | Ga0395899_0047972 | 3300037312 | Bacteria | 3178 |
| 639 | Ga0395899_0078352 | 3300037312 | Bacteria | 2408 |
| 640 | Ga0395899_0119782 | 3300037312 | Bacteria | 1886 |
| 641 | Ga0395899_0125342 | 3300037312 | Bacteria | 1837 |
| 642 | Ga0395899_0128834 | 3300037312 | Bacteria | 1808 |
| 643 | Ga0395899_0185374 | 3300037312 | Bacteria | 1458 |
| 644 | Ga0395899_0219659 | 3300037312 | Bacteria | 1317 |
| 645 | Ga0395900_0000126 | 3300037418 | Bacteria | 127586 |
| 646 | Ga0395900_0000221 | 3300037418 | Bacteria | 89883 |
| 647 | Ga0395900_0000968 | 3300037418 | Bacteria | 37351 |
| 648 | Ga0395900_0008903 | 3300037418 | Bacteria | 10297 |
| 649 | Ga0395900_0013232 | 3300037418 | Bacteria | 8432 |
| 650 | Ga0395900_0015040 | 3300037418 | Bacteria | 7888 |
| 651 | Ga0395900_0023546 | 3300037418 | Bacteria | 6301 |
| 652 | Ga0395900_0031602 | 3300037418 | Bacteria | 5442 |
| 653 | Ga0395900_0105883 | 3300037418 | Bacteria | 2889 |
| 654 | Ga0395900_0169089 | 3300037418 | Bacteria | 2226 |
| 655 | Ga0395900_0169607 | 3300037418 | Bacteria | 2222 |
| 656 | Ga0395900_0203591 | 3300037418 | Bacteria | 2001 |
| 657 | Ga0395900_0229495 | 3300037418 | Bacteria | 1867 |
| 658 | Ga0395900_0245264 | 3300037418 | Bacteria | 1795 |
| 659 | Ga0395900_0249623 | 3300037418 | Bacteria | 1776 |
| 660 | Ga0395900_0270079 | 3300037418 | Bacteria | 1695 |
| 661 | Ga0395900_0335560 | 3300037418 | Bacteria | 1488 |
| 662 | Ga0395900_0358412 | 3300037418 | Bacteria | 1430 |
| 663 | Ga0395900_0378501 | 3300037418 | Bacteria | 1384 |
| 664 | Ga0395900_0395854 | 3300037418 | Bacteria | 1346 |
| 665 | Ga0395900_0430079 | 3300037418 | Bacteria | 1279 |
| 666 | Ga0395898_0000053 | 3300037466 | Bacteria | 279600 |
| 667 | Ga0395898_0001961 | 3300037466 | Bacteria | 25920 |
| 668 | Ga0395898_0002022 | 3300037466 | Bacteria | 25434 |
| 669 | Ga0395898_0006247 | 3300037466 | Bacteria | 12755 |
| 670 | Ga0395898_0041439 | 3300037466 | Bacteria | 4547 |
| 671 | Ga0395898_0041970 | 3300037466 | Bacteria | 4516 |
| 672 | Ga0395898_0042675 | 3300037466 | Bacteria | 4473 |
| 673 | Ga0395898_0045024 | 3300037466 | Bacteria | 4338 |
| 674 | Ga0395898_0089165 | 3300037466 | Bacteria | 2968 |
| 675 | Ga0395898_0090674 | 3300037466 | Bacteria | 2941 |
| 676 | Ga0395898_0105705 | 3300037466 | Bacteria | 2699 |
| 677 | Ga0395898_0248761 | 3300037466 | Bacteria | 1695 |
| 678 | Ga0395905_0000031 | 3300037471 | Bacteria | 286757 |
| 679 | Ga0395905_0003036 | 3300037471 | Bacteria | 18180 |
| 680 | Ga0395905_0003464 | 3300037471 | Bacteria | 16874 |
| 681 | Ga0395905_0003721 | 3300037471 | Bacteria | 16157 |
| 682 | Ga0395905_0004414 | 3300037471 | Bacteria | 14630 |
| 683 | Ga0395905_0005686 | 3300037471 | Bacteria | 12670 |
| 684 | Ga0395905_0006451 | 3300037471 | Bacteria | 11809 |
| 685 | Ga0395905_0008268 | 3300037471 | Bacteria | 10275 |
| 686 | Ga0395905_0012320 | 3300037471 | Bacteria | 8232 |
| 687 | Ga0395905_0020308 | 3300037471 | Bacteria | 6293 |
| 688 | Ga0395905_0020932 | 3300037471 | Bacteria | 6193 |
| 689 | Ga0395905_0028212 | 3300037471 | Bacteria | 5291 |
| 690 | Ga0395905_0034529 | 3300037471 | Bacteria | 4749 |
| 691 | Ga0395905_0052206 | 3300037471 | Bacteria | 3827 |
| 692 | Ga0395905_0061555 | 3300037471 | Bacteria | 3511 |
| 693 | Ga0395905_0073926 | 3300037471 | Bacteria | 3194 |
| 694 | Ga0395905_0085148 | 3300037471 | Bacteria | 2962 |
| 695 | Ga0395905_0136342 | 3300037471 | Bacteria | 2309 |
| 696 | Ga0395905_0157648 | 3300037471 | Bacteria | 2134 |
| 697 | Ga0395905_0187739 | 3300037471 | Bacteria | 1940 |
| 698 | Ga0395905_0192204 | 3300037471 | Bacteria | 1914 |
| 699 | Ga0395905_0192496 | 3300037471 | Bacteria | 1913 |
| 700 | Ga0395905_0193426 | 3300037471 | Bacteria | 1908 |
| 701 | Ga0395905_0205548 | 3300037471 | Bacteria | 1845 |
| 702 | Ga0395905_0213542 | 3300037471 | Bacteria | 1807 |
| 703 | Ga0395901_0000147 | 3300038443 | Bacteria | 91584 |
| 704 | Ga0395901_0000163 | 3300038443 | Bacteria | 87103 |
| 705 | Ga0395901_0000459 | 3300038443 | Bacteria | 47200 |
| 706 | Ga0395901_0001546 | 3300038443 | Bacteria | 23839 |
| 707 | Ga0395901_0017880 | 3300038443 | Bacteria | 7236 |
| 708 | Ga0395901_0018889 | 3300038443 | Bacteria | 7047 |
| 709 | Ga0395901_0023365 | 3300038443 | Bacteria | 6336 |
| 710 | Ga0395901_0032067 | 3300038443 | Bacteria | 5421 |
| 711 | Ga0395901_0040231 | 3300038443 | Bacteria | 4842 |
| 712 | Ga0395901_0051252 | 3300038443 | Bacteria | 4290 |
| 713 | Ga0395901_0072184 | 3300038443 | Bacteria | 3598 |
| 714 | Ga0395901_0076250 | 3300038443 | Bacteria | 3498 |
| 715 | Ga0395901_0088753 | 3300038443 | Bacteria | 3234 |
| 716 | Ga0395901_0130884 | 3300038443 | Bacteria | 2636 |
| 717 | Ga0395901_0133445 | 3300038443 | Bacteria | 2609 |
| 718 | Ga0395901_0160505 | 3300038443 | Bacteria | 2361 |
| 719 | Ga0395901_0175640 | 3300038443 | Bacteria | 2247 |
| 720 | Ga0395901_0187023 | 3300038443 | Bacteria | 2172 |
| 721 | Ga0395901_0189183 | 3300038443 | Bacteria | 2159 |
| 722 | Ga0395901_0198114 | 3300038443 | Bacteria | 2105 |
| 723 | Ga0395901_0277284 | 3300038443 | Bacteria | 1743 |
| 724 | Ga0436365_1629872 | 3300039437 | Bacteria | 7784 |
| 725 | Ga0436360_0148430 | 3300039438 | Bacteria | 2625 |
| 726 | Ga0436360_1023609 | 3300039438 | Bacteria | 7805 |
| 727 | Ga0436361_0999815 | 3300039447 | Bacteria | 1833 |
| 728 | Ga0466969_0010018 | 3300044656 | Bacteria | 5026 |
| 729 | Ga0466969_0021402 | 3300044656 | Bacteria | 3344 |
| 730 | Ga0453683_0091056 | 3300044673 | Bacteria | 1912 |
| 731 | Ga0466966_0000001 | 3300044684 | Bacteria | 410376 |
| 732 | Ga0466966_0005584 | 3300044684 | Bacteria | 8269 |
| 733 | Ga0466966_0029547 | 3300044684 | Bacteria | 3565 |
| 734 | Ga0466966_0043256 | 3300044684 | Bacteria | 2888 |
| 735 | Ga0466966_0060094 | 3300044684 | Bacteria | 2399 |
| 736 | Ga0466963_0026504 | 3300044694 | Bacteria | 3707 |
| 737 | Ga0466963_0046220 | 3300044694 | Bacteria | 2870 |
| 738 | Ga0466963_0061792 | 3300044694 | Bacteria | 2505 |
| 739 | Ga0466963_0074312 | 3300044694 | Bacteria | 2292 |
| 740 | Ga0466963_0081530 | 3300044694 | Bacteria | 2191 |
| 741 | Ga0466963_0082511 | 3300044694 | Bacteria | 2179 |
| 742 | Ga0466971_0037444 | 3300044719 | Bacteria | 2174 |
| 743 | Ga0466971_0042528 | 3300044719 | Bacteria | 2042 |
| 744 | Ga0466970_0024147 | 3300044765 | Bacteria | 3178 |
| 745 | Ga0466970_0034071 | 3300044765 | Bacteria | 2694 |
| 746 | Ga0466970_0117053 | 3300044765 | Bacteria | 1458 |
| 747 | Ga0466957_0006995 | 3300044842 | Bacteria | 6377 |
| 748 | Ga0466957_0026017 | 3300044842 | Bacteria | 3470 |
| 749 | Ga0466957_0079678 | 3300044842 | Bacteria | 2038 |
| 750 | Ga0466957_0192747 | 3300044842 | Bacteria | 1336 |
| 751 | Ga0466960_0021110 | 3300044901 | Bacteria | 2895 |
| 752 | Ga0466959_0000995 | 3300045049 | Bacteria | 16867 |
| 753 | Ga0466959_0032772 | 3300045049 | Bacteria | 3845 |
| 754 | Ga0466959_0073754 | 3300045049 | Bacteria | 2468 |
| 755 | Ga0466959_0077014 | 3300045049 | Bacteria | 2408 |
| 756 | Ga0451576_0105187 | 3300045051 | Bacteria | 2936 |
| 757 | Ga0466958_0000481 | 3300045836 | Bacteria | 16699 |
| 758 | Ga0466958_0028229 | 3300045836 | Bacteria | 3326 |
| 759 | Ga0466958_0040300 | 3300045836 | Bacteria | 2807 |
| 760 | Ga0466958_0047699 | 3300045836 | Bacteria | 2586 |
| 761 | Ga0466958_0157913 | 3300045836 | Bacteria | 1432 |
| 762 | Ga0466967_0008320 | 3300045976 | Bacteria | 7587 |
| 763 | Ga0466967_0009496 | 3300045976 | Bacteria | 7221 |
| 764 | Ga0466967_0012369 | 3300045976 | Bacteria | 6523 |
| 765 | Ga0466967_0017249 | 3300045976 | Bacteria | 5726 |
| 766 | Ga0466967_0020168 | 3300045976 | Bacteria | 5379 |
| 767 | Ga0466967_0057444 | 3300045976 | Bacteria | 3435 |
| 768 | Ga0466967_0065889 | 3300045976 | Bacteria | 3226 |
| 769 | Ga0466967_0106432 | 3300045976 | Bacteria | 2571 |
| 770 | Ga0466967_0198881 | 3300045976 | Bacteria | 1897 |
| 771 | Ga0466967_0220614 | 3300045976 | Bacteria | 1801 |
| 772 | Ga0466967_0234001 | 3300045976 | Bacteria | 1750 |
| 773 | Ga0466967_0266778 | 3300045976 | Bacteria | 1639 |
| 774 | Ga0466967_0272001 | 3300045976 | Bacteria | 1623 |
| 775 | Ga0495629_0043955 | 3300046459 | Bacteria | 3136 |
| 776 | Ga0495629_0083945 | 3300046459 | Bacteria | 2223 |
| 777 | Ga0495580_0010923 | 3300046472 | Bacteria | 7045 |
| 778 | Ga0495580_0063386 | 3300046472 | Bacteria | 2593 |
| 779 | Ga0495582_0071854 | 3300046473 | Bacteria | 1914 |
| 780 | Ga0495664_0015318 | 3300046477 | Bacteria | 4357 |
| 781 | Ga0495665_0038020 | 3300046531 | Bacteria | 2567 |
| 782 | Ga0495668_0010922 | 3300046616 | Bacteria | 5468 |
| 783 | Ga0495658_0032672 | 3300046683 | Bacteria | 2843 |
| 784 | Ga0495669_0000256 | 3300046684 | Bacteria | 30798 |
| 785 | Ga0495669_0007173 | 3300046684 | Bacteria | 4669 |
| 786 | Ga0495613_0035600 | 3300046689 | Bacteria | 3694 |
| 787 | Ga0495624_0067753 | 3300046690 | Bacteria | 2226 |
| 788 | Ga0495600_0110355 | 3300046809 | Bacteria | 1791 |
| 789 | Ga0495674_0037698 | 3300047319 | Bacteria | 4343 |
| 790 | Ga0495683_0078534 | 3300047323 | Bacteria | 1613 |
| 791 | Ga0495602_0027686 | 3300048088 | Bacteria | 5443 |
| 792 | Ga0496100_0151592 | 3300048903 | Bacteria | 1654 |
| 793 | Ga0496101_0007302 | 3300048904 | Bacteria | 7152 |
| 794 | Ga0496101_0040068 | 3300048904 | Bacteria | 3336 |
| 795 | Ga0496101_0083522 | 3300048904 | Bacteria | 2364 |
| 796 | Ga0496102_0035740 | 3300048905 | Bacteria | 4474 |
| 797 | Ga0496102_0120185 | 3300048905 | Bacteria | 2453 |
| 798 | Ga0496102_0144821 | 3300048905 | Bacteria | 2229 |
| 799 | Ga0496104_0091458 | 3300048907 | Bacteria | 2908 |
| 800 | Ga0496104_0117971 | 3300048907 | Bacteria | 2547 |
| 801 | Ga0496104_0123294 | 3300048907 | Unclassified | 2488 |
| 802 | Ga0496104_0255146 | 3300048907 | Bacteria | 1666 |
| 803 | Ga0496105_0010687 | 3300048908 | Bacteria | 7223 |
| 804 | Ga0496105_0015809 | 3300048908 | Bacteria | 6020 |
| 805 | Ga0496105_0063907 | 3300048908 | Bacteria | 3037 |
| 806 | Ga0496105_0137524 | 3300048908 | Bacteria | 2012 |
| 807 | Ga0496105_0276572 | 3300048908 | Bacteria | 1355 |
| 808 | Ga0496106_0000373 | 3300048909 | Bacteria | 31824 |
| 809 | Ga0496106_0040257 | 3300048909 | Bacteria | 3499 |
| 810 | Ga0496107_0003101 | 3300048910 | Bacteria | 11048 |
| 811 | Ga0496107_0006471 | 3300048910 | Bacteria | 8055 |
| 812 | Ga0496107_0033699 | 3300048910 | Bacteria | 3665 |
| 813 | Ga0496107_0046014 | 3300048910 | Bacteria | 3140 |
| 814 | Ga0496107_0126921 | 3300048910 | Bacteria | 1882 |
| 815 | Ga0496108_0001090 | 3300048911 | Bacteria | 21199 |
| 816 | Ga0496108_0001833 | 3300048911 | Bacteria | 16979 |
| 817 | Ga0496108_0024706 | 3300048911 | Bacteria | 4949 |
| 818 | Ga0496109_0011758 | 3300048912 | Bacteria | 7532 |
| 819 | Ga0496109_0031747 | 3300048912 | Bacteria | 4743 |
| 820 | Ga0496110_0000437 | 3300048913 | Bacteria | 28365 |
| 821 | Ga0496110_0054710 | 3300048913 | Bacteria | 3510 |
| 822 | Ga0496111_0005971 | 3300048914 | Bacteria | 7860 |
| 823 | Ga0496111_0011295 | 3300048914 | Bacteria | 6011 |
| 824 | Ga0496111_0032967 | 3300048914 | Bacteria | 3694 |
| 825 | Ga0496112_0002186 | 3300048915 | Bacteria | 15560 |
| 826 | Ga0496112_0006749 | 3300048915 | Bacteria | 10113 |
| 827 | Ga0496112_0026425 | 3300048915 | Bacteria | 5585 |
| 828 | Ga0496112_0135045 | 3300048915 | Bacteria | 2437 |
| 829 | Ga0496112_0250537 | 3300048915 | Bacteria | 1722 |
| 830 | Ga0496113_0002318 | 3300048916 | Bacteria | 10998 |
| 831 | Ga0496113_0002609 | 3300048916 | Bacteria | 10542 |
| 832 | Ga0496113_0005539 | 3300048916 | Bacteria | 7885 |
| 833 | Ga0496113_0015360 | 3300048916 | Bacteria | 5260 |
| 834 | Ga0496113_0016082 | 3300048916 | Bacteria | 5163 |
| 835 | Ga0496114_0100831 | 3300048917 | Bacteria | 2464 |
| 836 | Ga0496115_0001337 | 3300048918 | Bacteria | 17576 |
| 837 | Ga0496115_0013235 | 3300048918 | Bacteria | 6234 |
| 838 | Ga0496115_0029580 | 3300048918 | Unclassified | 4303 |
| 839 | Ga0496121_0000789 | 3300048924 | Bacteria | 57941 |
| 840 | Ga0496126_0012887 | 3300048929 | Bacteria | 8540 |
| 841 | Ga0501046_0088011 | 3300049580 | Bacteria | 2392 |
| 842 | Ga0501047_0011428 | 3300049581 | Bacteria | 8403 |
| 843 | Ga0501047_0263728 | 3300049581 | Bacteria | 1570 |
| 844 | Ga0501079_0268853 | 3300049741 | Bacteria | 1333 |
| 845 | Ga0501080_0249572 | 3300049742 | Bacteria | 1618 |
| 846 | Ga0501080_0319035 | 3300049742 | Bacteria | 1407 |
| 847 | Ga0501035_0117685 | 3300049822 | Bacteria | 2325 |
| 848 | Ga0501044_0095897 | 3300049823 | Bacteria | 2989 |
| 849 | Ga0501044_0228725 | 3300049823 | Bacteria | 1808 |
| 850 | nmdc:mga0n895_362348_c1 | 3300050512 | Bacteria | 1468 |
| 851 | nmdc:mga0rr50_8343_c1 | 3300050513 | Bacteria | 6445 |
| 852 | Ga0495612_0058660 | 3300053078 | Bacteria | 1591 |
| 853 | Ga0157373_10014894 | |||
| 854 | LJNas_1001617 | |||
| 855 | JGI24741J21665_1007592 | |||
| 856 | JGI24740J21852_10003203 | |||
| 857 | JGI24740J21852_10021050 | |||
| 858 | JGI24740J21852_10024635 | |||
| 859 | JGI24739J22299_10004897 | |||
| 860 | JGI24739J22299_10006120 | |||
| 861 | JGI24737J22298_10001320 | |||
| 862 | JGI24737J22298_10001643 | |||
| 863 | JGI24737J22298_10010439 | |||
| 864 | JGI24744J21845_10000004 | |||
| 865 | JGI24742J22300_10010138 | |||
| 866 | Ga0065715_10037121 | |||
| 867 | Ga0070658_10000360 | |||
| 868 | Ga0070658_10000743 | |||
| 869 | Ga0070658_10000999 | |||
| 870 | Ga0070658_10047112 | |||
| 871 | Ga0070658_10075199 | |||
| 872 | Ga0070658_10089199 | |||
| 873 | Ga0070658_10094152 | |||
| 874 | Ga0070658_10099086 | |||
| 875 | Ga0070658_10211125 | |||
| 876 | Ga0070658_10320879 | |||
| 877 | Ga0070683_100000348 | |||
| 878 | Ga0070683_100018151 | |||
| 879 | Ga0070683_100023100 | |||
| 880 | Ga0070683_100103155 | |||
| 881 | Ga0070683_100103441 | |||
| 882 | Ga0070690_100065591 | |||
| 883 | Ga0070670_100003619 | |||
| 884 | Ga0070670_100017820 | |||
| 885 | Ga0070677_10034494 | |||
| 886 | Ga0070666_10000361 | |||
| 887 | Ga0070666_10002549 | |||
| 888 | Ga0070666_10016340 | |||
| 889 | Ga0070666_10037158 | |||
| 890 | Ga0070680_100003113 | |||
| 891 | Ga0070680_100023043 | |||
| 892 | Ga0070680_100025180 | |||
| 893 | Ga0070680_100038713 | |||
| 894 | Ga0070682_100023814 | |||
| 895 | Ga0070660_100000075 | |||
| 896 | Ga0070660_100000085 | |||
| 897 | Ga0070660_100004364 | |||
| 898 | Ga0070660_100013229 | |||
| 899 | Ga0070660_100020568 | |||
| 900 | Ga0070660_100038463 | |||
| 901 | Ga0070660_100041827 | |||
| 902 | Ga0070660_100054919 | |||
| 903 | Ga0070660_100063218 | |||
| 904 | Ga0070689_100007712 | |||
| 905 | Ga0070687_100038429 | |||
| 906 | Ga0070661_100000273 | |||
| 907 | Ga0070661_100005367 | |||
| 908 | Ga0070661_100015698 | |||
| 909 | Ga0070661_100019668 | |||
| 910 | Ga0070661_100066607 | |||
| 911 | Ga0070661_100072884 | |||
| 912 | Ga0070661_100087715 | |||
| 913 | Ga0070661_100095137 | |||
| 914 | Ga0070661_100102671 | |||
| 915 | Ga0070692_10010244 | |||
| 916 | Ga0070692_10027385 | |||
| 917 | Ga0070668_100048786 | |||
| 918 | Ga0070669_100000223 | |||
| 919 | Ga0070669_100049969 | |||
| 920 | Ga0070675_100007141 | |||
| 921 | Ga0070675_100054340 | |||
| 922 | Ga0070675_100143386 | |||
| 923 | Ga0070671_100000203 | |||
| 924 | Ga0070671_100005825 | |||
| 925 | Ga0070671_100007366 | |||
| 926 | Ga0070671_100020491 | |||
| 927 | Ga0070671_100020894 | |||
| 928 | Ga0070671_100038153 | |||
| 929 | Ga0070671_100046922 | |||
| 930 | Ga0070671_100306176 | |||
| 931 | Ga0070674_100010177 | |||
| 932 | Ga0070674_100045871 | |||
| 933 | Ga0070673_100001900 | |||
| 934 | Ga0070673_100089442 | |||
| 935 | Ga0070673_100210141 | |||
| 936 | Ga0070688_100000374 | |||
| 937 | Ga0070659_100000084 | |||
| 938 | Ga0070659_100001028 | |||
| 939 | Ga0070659_100005791 | |||
| 940 | Ga0070659_100006706 | |||
| 941 | Ga0070659_100016958 | |||
| 942 | Ga0070659_100045177 | |||
| 943 | Ga0070659_100080452 | |||
| 944 | Ga0070659_100085542 | |||
| 945 | Ga0070659_100095351 | |||
| 946 | Ga0070659_100103374 | |||
| 947 | Ga0070667_100007738 | |||
| 948 | Ga0070667_100008302 | |||
| 949 | Ga0070667_100026745 | |||
| 950 | Ga0070667_100028226 | |||
| 951 | Ga0070667_100051297 | |||
| 952 | Ga0070709_10000022 | |||
| 953 | Ga0070709_10000563 | |||
| 954 | Ga0070709_10012639 | |||
| 955 | Ga0070709_10019688 | |||
| 956 | Ga0070714_100051939 | |||
| 957 | Ga0070714_100053434 | |||
| 958 | Ga0070714_100061763 | |||
| 959 | Ga0070714_100072338 | |||
| 960 | Ga0070714_100139711 | |||
| 961 | Ga0070714_100223734 | |||
| 962 | Ga0070713_100000021 | |||
| 963 | Ga0070713_100000203 | |||
| 964 | Ga0070713_100015342 | |||
| 965 | Ga0070713_100018456 | |||
| 966 | Ga0070713_100168170 | |||
| 967 | Ga0070713_100333412 | |||
| 968 | Ga0070710_10003233 | |||
| 969 | Ga0070710_10082470 | |||
| 970 | Ga0070701_10006994 | |||
| 971 | Ga0070711_100000077 | |||
| 972 | Ga0070711_100012307 | |||
| 973 | Ga0070694_100048112 | |||
| 974 | Ga0070708_100104197 | |||
| 975 | Ga0070663_100009524 | |||
| 976 | Ga0070663_100011408 | |||
| 977 | Ga0070663_100019027 | |||
| 978 | Ga0070663_100047093 | |||
| 979 | Ga0070663_100048650 | |||
| 980 | Ga0070663_100202163 | |||
| 981 | Ga0070678_100000630 | |||
| 982 | Ga0070662_100000058 | |||
| 983 | Ga0070662_100052178 | |||
| 984 | Ga0070662_100136191 | |||
| 985 | Ga0070681_10018435 | |||
| 986 | Ga0070681_10055945 | |||
| 987 | Ga0070681_10102537 | |||
| 988 | Ga0070681_10228626 | |||
| 989 | Ga0070685_10001541 | |||
| 990 | Ga0070706_100016985 | |||
| 991 | Ga0070706_100021658 | |||
| 992 | Ga0070707_100054897 | |||
| 993 | Ga0070699_100017663 | |||
| 994 | Ga0070699_100034322 | |||
| 995 | Ga0070679_100009124 | |||
| 996 | Ga0070679_100018253 | |||
| 997 | Ga0070679_100065031 | |||
| 998 | Ga0070679_100089656 | |||
| 999 | Ga0070679_100100180 | |||
| 1000 | Ga0070679_100107772 | |||
| 1001 | Ga0070679_100266376 | |||
| 1002 | Ga0070684_100002051 | |||
| 1003 | Ga0070684_100010435 | |||
| 1004 | Ga0070684_100020947 | |||
| 1005 | Ga0068853_100000039 | |||
| 1006 | Ga0068853_100000223 | |||
| 1007 | Ga0068853_100001982 | |||
| 1008 | Ga0068853_100009358 | |||
| 1009 | Ga0068853_100009546 | |||
| 1010 | Ga0068853_100023634 | |||
| 1011 | Ga0068853_100035596 | |||
| 1012 | Ga0070672_100005790 | |||
| 1013 | Ga0070672_100201127 | |||
| 1014 | Ga0070693_100002238 | |||
| 1015 | Ga0070665_100004855 | |||
| 1016 | Ga0070665_100056169 | |||
| 1017 | Ga0070665_100081333 | |||
| 1018 | Ga0070665_100314707 | |||
| 1019 | Ga0068855_100001063 | |||
| 1020 | Ga0068855_100001315 | |||
| 1021 | Ga0068855_100003197 | |||
| 1022 | Ga0068855_100005593 | |||
| 1023 | Ga0068855_100011514 | |||
| 1024 | Ga0068855_100012825 | |||
| 1025 | Ga0068855_100018966 | |||
| 1026 | Ga0068855_100026375 | |||
| 1027 | Ga0068855_100041231 | |||
| 1028 | Ga0068855_100046984 | |||
| 1029 | Ga0068855_100057892 | |||
| 1030 | Ga0068855_100165480 | |||
| 1031 | Ga0068855_100172350 | |||
| 1032 | Ga0070664_100000032 | |||
| 1033 | Ga0070664_100006415 | |||
| 1034 | Ga0070664_100012600 | |||
| 1035 | Ga0070664_100096199 | |||
| 1036 | Ga0070664_100102747 | |||
| 1037 | Ga0070664_100107599 | |||
| 1038 | Ga0070664_100185018 | |||
| 1039 | Ga0068857_100004731 | |||
| 1040 | Ga0068857_100019952 | |||
| 1041 | Ga0068857_100091760 | |||
| 1042 | Ga0068857_100098639 | |||
| 1043 | Ga0068854_100000314 | |||
| 1044 | Ga0068854_100001532 | |||
| 1045 | Ga0068854_100016199 | |||
| 1046 | Ga0068854_100020640 | |||
| 1047 | Ga0068854_100024262 | |||
| 1048 | Ga0068854_100054774 | |||
| 1049 | Ga0068854_100118287 | |||
| 1050 | Ga0068856_100000161 | |||
| 1051 | Ga0068856_100001238 | |||
| 1052 | Ga0068856_100007720 | |||
| 1053 | Ga0068856_100026871 | |||
| 1054 | Ga0068856_100076712 | |||
| 1055 | Ga0068856_100078842 | |||
| 1056 | Ga0068856_100132313 | |||
| 1057 | Ga0068856_100197811 | |||
| 1058 | Ga0068856_100257849 | |||
| 1059 | Ga0068856_100306126 | |||
| 1060 | Ga0068852_100002985 | |||
| 1061 | Ga0068852_100013842 | |||
| 1062 | Ga0068852_100018448 | |||
| 1063 | Ga0068852_100020755 | |||
| 1064 | Ga0068852_100021513 | |||
| 1065 | Ga0068852_100030605 | |||
| 1066 | Ga0068852_100308124 | |||
| 1067 | Ga0068859_100017524 | |||
| 1068 | Ga0068859_100027593 | |||
| 1069 | Ga0068859_100031437 | |||
| 1070 | Ga0068864_100002932 | |||
| 1071 | Ga0068864_100006287 | |||
| 1072 | Ga0068864_100017685 | |||
| 1073 | Ga0068864_100101547 | |||
| 1074 | Ga0068866_10041703 | |||
| 1075 | Ga0068851_10028353 | |||
| 1076 | Ga0068851_10034363 | |||
| 1077 | Ga0068863_100008593 | |||
| 1078 | Ga0068863_100032339 | |||
| 1079 | Ga0068863_100074402 | |||
| 1080 | Ga0068863_100147519 | |||
| 1081 | Ga0068863_100157624 | |||
| 1082 | Ga0068858_100001179 | |||
| 1083 | Ga0068858_100003126 | |||
| 1084 | Ga0068858_100041193 | |||
| 1085 | Ga0068858_100069930 | |||
| 1086 | Ga0068858_100308446 | |||
| 1087 | Ga0068862_100176218 | |||
| 1088 | Ga0081539_10037046 | |||
| 1089 | Ga0070717_10004377 | |||
| 1090 | Ga0070717_10005493 | |||
| 1091 | Ga0070717_10013650 | |||
| 1092 | Ga0070717_10024489 | |||
| 1093 | Ga0070717_10056548 | |||
| 1094 | Ga0070717_10058540 | |||
| 1095 | Ga0070717_10122762 | |||
| 1096 | Ga0070716_100000377 | |||
| 1097 | Ga0070716_100000838 | |||
| 1098 | Ga0070716_100015929 | |||
| 1099 | Ga0070712_100000425 | |||
| 1100 | Ga0070712_100000440 | |||
| 1101 | Ga0070712_100005709 | |||
| 1102 | Ga0070712_100021452 | |||
| 1103 | Ga0070712_100149460 | |||
| 1104 | Ga0097621_100004933 | |||
| 1105 | Ga0097621_100143394 | |||
| 1106 | Ga0068871_100008802 | |||
| 1107 | Ga0068871_100026938 | |||
| 1108 | Ga0068871_100060747 | |||
| 1109 | Ga0068871_100174763 | |||
| 1110 | Ga0075434_100195250 | |||
| 1111 | Ga0097620_100017524 | |||
| 1112 | Ga0097620_100027593 | |||
| 1113 | Ga0097620_100031437 | |||
| 1114 | Ga0075435_100042914 | |||
| 1115 | Ga0099795_10002513 | |||
| 1116 | Ga0105240_10006207 | |||
| 1117 | Ga0105240_10017834 | |||
| 1118 | Ga0105240_10029819 | |||
| 1119 | Ga0105240_10038385 | |||
| 1120 | Ga0105240_10039803 | |||
| 1121 | Ga0105240_10086501 | |||
| 1122 | Ga0105240_10103756 | |||
| 1123 | Ga0105240_10118247 | |||
| 1124 | Ga0105245_10029098 | |||
| 1125 | Ga0105243_10019943 | |||
| 1126 | Ga0105241_10157266 | |||
| 1127 | Ga0105248_10000223 | |||
| 1128 | Ga0105248_10000678 | |||
| 1129 | Ga0105248_10002629 | |||
| 1130 | Ga0105248_10018018 | |||
| 1131 | Ga0105248_10023133 | |||
| 1132 | Ga0105248_10057947 | |||
| 1133 | Ga0105248_10063204 | |||
| 1134 | Ga0105248_10069080 | |||
| 1135 | Ga0105248_10080965 | |||
| 1136 | Ga0105237_10011865 | |||
| 1137 | Ga0105237_10059585 | |||
| 1138 | Ga0105238_10014708 | |||
| 1139 | Ga0105238_10026598 | |||
| 1140 | Ga0105238_10140706 | |||
| 1141 | Ga0105238_10238552 | |||
| 1142 | Ga0105249_10222332 | |||
| 1143 | Ga0105246_10000072 | |||
| 1144 | Ga0105246_10006938 | |||
| 1145 | Ga0105246_10043671 | |||
| 1146 | Ga0157373_10008901 | |||
| 1147 | Ga0157373_10020087 | |||
| 1148 | Ga0157373_10021720 | |||
| 1149 | Ga0157373_10125616 | |||
| 1150 | Ga0157373_10141875 | |||
| 1151 | Ga0157373_10186021 | |||
| 1152 | Ga0157371_10001103 | |||
| 1153 | Ga0157371_10001297 | |||
| 1154 | Ga0157371_10003962 | |||
| 1155 | Ga0157371_10007626 | |||
| 1156 | Ga0157371_10011159 | |||
| 1157 | Ga0157371_10012119 | |||
| 1158 | Ga0157371_10021573 | |||
| 1159 | Ga0157371_10022459 | |||
| 1160 | Ga0157371_10024032 | |||
| 1161 | Ga0157371_10032066 | |||
| 1162 | Ga0157371_10043946 | |||
| 1163 | Ga0157371_10056891 | |||
| 1164 | Ga0157371_10065238 | |||
| 1165 | Ga0157370_10001094 | |||
| 1166 | Ga0157370_10004189 | |||
| 1167 | Ga0157370_10018716 | |||
| 1168 | Ga0157370_10047298 | |||
| 1169 | Ga0157370_10059417 | |||
| 1170 | Ga0157370_10172510 | |||
| 1171 | Ga0157369_10000141 | |||
| 1172 | Ga0157369_10001072 | |||
| 1173 | Ga0157369_10001999 | |||
| 1174 | Ga0157369_10004058 | |||
| 1175 | Ga0157369_10006247 | |||
| 1176 | Ga0157369_10006378 | |||
| 1177 | Ga0157369_10014521 | |||
| 1178 | Ga0157369_10015998 | |||
| 1179 | Ga0157369_10053969 | |||
| 1180 | Ga0157369_10073116 | |||
| 1181 | Ga0157374_10001508 | |||
| 1182 | Ga0157374_10049268 | |||
| 1183 | Ga0157374_10053261 | |||
| 1184 | Ga0157374_10086814 | |||
| 1185 | Ga0157374_10104402 | |||
| 1186 | Ga0157378_10063467 | |||
| 1187 | Ga0163162_10002279 | |||
| 1188 | Ga0163162_10038319 | |||
| 1189 | Ga0163162_10063884 | |||
| 1190 | Ga0157372_10002710 | |||
| 1191 | Ga0157372_10010724 | |||
| 1192 | Ga0157372_10025893 | |||
| 1193 | Ga0157372_10160985 | |||
| 1194 | Ga0157375_10001921 | |||
| 1195 | Ga0157375_10065270 | |||
| 1196 | Ga0157375_10507883 | |||
| 1197 | Ga0163163_10000567 | |||
| 1198 | Ga0163163_10002130 | |||
| 1199 | Ga0163163_10053966 | |||
| 1200 | Ga0163163_10082522 | |||
| 1201 | Ga0157380_10151404 | |||
| 1202 | Ga0182008_10016095 | |||
| 1203 | Ga0157379_10000861 | |||
| 1204 | Ga0206356_10378585 | |||
| 1205 | Ga0206354_10978830 | |||
| 1206 | Ga0213871_10011864 | |||
| 1207 | Ga0224570_100432 | |||
| 1208 | Ga0224569_100572 | |||
| 1209 | Ga0224572_1003132 | |||
| 1210 | Ga0224572_1009654 | |||
| 1211 | Ga0228598_1000866 | |||
| 1212 | Ga0228598_1005518 | |||
| 1213 | Ga0209148_1003061 | |||
| 1214 | Ga0209233_1011609 | |||
| 1215 | Ga0209455_1000626 | |||
| 1216 | Ga0207697_10005851 | |||
| 1217 | Ga0207697_10017105 | |||
| 1218 | Ga0207697_10029316 | |||
| 1219 | Ga0207656_10026293 | |||
| 1220 | Ga0207682_10013147 | |||
| 1221 | Ga0207688_10007562 | |||
| 1222 | Ga0207680_10000518 | |||
| 1223 | Ga0207680_10006417 | |||
| 1224 | Ga0207680_10096884 | |||
| 1225 | Ga0207680_10136172 | |||
| 1226 | Ga0207647_10002810 | |||
| 1227 | Ga0207647_10006908 | |||
| 1228 | Ga0207647_10008256 | |||
| 1229 | Ga0207647_10037498 | |||
| 1230 | Ga0207647_10080546 | |||
| 1231 | Ga0207699_10000011 | |||
| 1232 | Ga0207699_10000364 | |||
| 1233 | Ga0207699_10024688 | |||
| 1234 | Ga0207699_10066436 | |||
| 1235 | Ga0207643_10035252 | |||
| 1236 | Ga0207705_10000003 | |||
| 1237 | Ga0207705_10000061 | |||
| 1238 | Ga0207705_10000918 | |||
| 1239 | Ga0207705_10013814 | |||
| 1240 | Ga0207705_10016227 | |||
| 1241 | Ga0207705_10016301 | |||
| 1242 | Ga0207705_10031351 | |||
| 1243 | Ga0207705_10036402 | |||
| 1244 | Ga0207705_10075318 | |||
| 1245 | Ga0207705_10082774 | |||
| 1246 | Ga0207705_10093020 | |||
| 1247 | Ga0207705_10136713 | |||
| 1248 | Ga0207707_10006776 | |||
| 1249 | Ga0207707_10046745 | |||
| 1250 | Ga0207695_10012696 | |||
| 1251 | Ga0207695_10013178 | |||
| 1252 | Ga0207695_10036067 | |||
| 1253 | Ga0207695_10050843 | |||
| 1254 | Ga0207695_10096511 | |||
| 1255 | Ga0207695_10204029 | |||
| 1256 | Ga0207693_10000047 | |||
| 1257 | Ga0207693_10000050 | |||
| 1258 | Ga0207693_10016751 | |||
| 1259 | Ga0207693_10040192 | |||
| 1260 | Ga0207693_10253604 | |||
| 1261 | Ga0207663_10000673 | |||
| 1262 | Ga0207663_10011303 | |||
| 1263 | Ga0207660_10000772 | |||
| 1264 | Ga0207660_10026011 | |||
| 1265 | Ga0207660_10068510 | |||
| 1266 | Ga0207660_10074043 | |||
| 1267 | Ga0207662_10016373 | |||
| 1268 | Ga0207657_10000164 | |||
| 1269 | Ga0207657_10000345 | |||
| 1270 | Ga0207657_10001584 | |||
| 1271 | Ga0207657_10001711 | |||
| 1272 | Ga0207657_10004331 | |||
| 1273 | Ga0207657_10005526 | |||
| 1274 | Ga0207657_10006149 | |||
| 1275 | Ga0207657_10015537 | |||
| 1276 | Ga0207657_10017974 | |||
| 1277 | Ga0207657_10019328 | |||
| 1278 | Ga0207657_10026751 | |||
| 1279 | Ga0207657_10033505 | |||
| 1280 | Ga0207657_10056776 | |||
| 1281 | Ga0207657_10092394 | |||
| 1282 | Ga0207657_10123617 | |||
| 1283 | Ga0207649_10000580 | |||
| 1284 | Ga0207649_10004183 | |||
| 1285 | Ga0207649_10016043 | |||
| 1286 | Ga0207649_10044351 | |||
| 1287 | Ga0207649_10071578 | |||
| 1288 | Ga0207649_10096519 | |||
| 1289 | Ga0207649_10104193 | |||
| 1290 | Ga0207652_10002403 | |||
| 1291 | Ga0207652_10003472 | |||
| 1292 | Ga0207652_10007674 | |||
| 1293 | Ga0207652_10037752 | |||
| 1294 | Ga0207681_10000160 | |||
| 1295 | Ga0207694_10006089 | |||
| 1296 | Ga0207694_10052729 | |||
| 1297 | Ga0207650_10015723 | |||
| 1298 | Ga0207650_10045673 | |||
| 1299 | Ga0207659_10010230 | |||
| 1300 | Ga0207659_10168094 | |||
| 1301 | Ga0207687_10124672 | |||
| 1302 | Ga0207700_10000136 | |||
| 1303 | Ga0207700_10000316 | |||
| 1304 | Ga0207700_10012026 | |||
| 1305 | Ga0207700_10119365 | |||
| 1306 | Ga0207664_10000282 | |||
| 1307 | Ga0207664_10008717 | |||
| 1308 | Ga0207664_10077778 | |||
| 1309 | Ga0207644_10000022 | |||
| 1310 | Ga0207644_10000746 | |||
| 1311 | Ga0207644_10001457 | |||
| 1312 | Ga0207644_10005632 | |||
| 1313 | Ga0207644_10009721 | |||
| 1314 | Ga0207644_10028759 | |||
| 1315 | Ga0207644_10042270 | |||
| 1316 | Ga0207644_10046607 | |||
| 1317 | Ga0207690_10000062 | |||
| 1318 | Ga0207690_10001573 | |||
| 1319 | Ga0207690_10004364 | |||
| 1320 | Ga0207690_10009010 | |||
| 1321 | Ga0207690_10013707 | |||
| 1322 | Ga0207690_10020587 | |||
| 1323 | Ga0207690_10046394 | |||
| 1324 | Ga0207690_10072138 | |||
| 1325 | Ga0207690_10126254 | |||
| 1326 | Ga0207690_10198165 | |||
| 1327 | Ga0207706_10000196 | |||
| 1328 | Ga0207706_10000715 | |||
| 1329 | Ga0207706_10006555 | |||
| 1330 | Ga0207706_10008742 | |||
| 1331 | Ga0207706_10027550 | |||
| 1332 | Ga0207706_10035013 | |||
| 1333 | Ga0207706_10122330 | |||
| 1334 | Ga0207709_10042968 | |||
| 1335 | Ga0207669_10097743 | |||
| 1336 | Ga0207669_10111833 | |||
| 1337 | Ga0207665_10047024 | |||
| 1338 | Ga0207691_10000892 | |||
| 1339 | Ga0207691_10043242 | |||
| 1340 | Ga0207691_10059083 | |||
| 1341 | Ga0207691_10086591 | |||
| 1342 | Ga0207691_10147772 | |||
| 1343 | Ga0207711_10000123 | |||
| 1344 | Ga0207711_10000698 | |||
| 1345 | Ga0207711_10001850 | |||
| 1346 | Ga0207711_10065841 | |||
| 1347 | Ga0207711_10085407 | |||
| 1348 | Ga0207711_10153177 | |||
| 1349 | Ga0207711_10293885 | |||
| 1350 | Ga0207689_10183436 | |||
| 1351 | Ga0207661_10084618 | |||
| 1352 | Ga0207661_10110634 | |||
| 1353 | Ga0207661_10201029 | |||
| 1354 | Ga0207679_10007348 | |||
| 1355 | Ga0207679_10026300 | |||
| 1356 | Ga0207679_10043736 | |||
| 1357 | Ga0207679_10177304 | |||
| 1358 | Ga0207667_10000187 | |||
| 1359 | Ga0207667_10001975 | |||
| 1360 | Ga0207667_10003114 | |||
| 1361 | Ga0207667_10005280 | |||
| 1362 | Ga0207667_10007569 | |||
| 1363 | Ga0207667_10017505 | |||
| 1364 | Ga0207667_10018230 | |||
| 1365 | Ga0207667_10022749 | |||
| 1366 | Ga0207667_10028314 | |||
| 1367 | Ga0207667_10048874 | |||
| 1368 | Ga0207667_10076419 | |||
| 1369 | Ga0207667_10137063 | |||
| 1370 | Ga0207667_10203175 | |||
| 1371 | Ga0207651_10029989 | |||
| 1372 | Ga0207651_10220262 | |||
| 1373 | Ga0207651_10232986 | |||
| 1374 | Ga0207668_10014655 | |||
| 1375 | Ga0207640_10000001 | |||
| 1376 | Ga0207640_10000526 | |||
| 1377 | Ga0207640_10000533 | |||
| 1378 | Ga0207640_10012035 | |||
| 1379 | Ga0207640_10012482 | |||
| 1380 | Ga0207640_10096943 | |||
| 1381 | Ga0207658_10004498 | |||
| 1382 | Ga0207658_10007286 | |||
| 1383 | Ga0207658_10066381 | |||
| 1384 | Ga0207677_10051407 | |||
| 1385 | Ga0207703_10002052 | |||
| 1386 | Ga0207703_10011537 | |||
| 1387 | Ga0207703_10073623 | |||
| 1388 | Ga0207639_10000037 | |||
| 1389 | Ga0207639_10000124 | |||
| 1390 | Ga0207639_10001229 | |||
| 1391 | Ga0207639_10001939 | |||
| 1392 | Ga0207639_10005669 | |||
| 1393 | Ga0207678_10000864 | |||
| 1394 | Ga0207678_10001943 | |||
| 1395 | Ga0207678_10002554 | |||
| 1396 | Ga0207678_10012310 | |||
| 1397 | Ga0207678_10012383 | |||
| 1398 | Ga0207678_10018770 | |||
| 1399 | Ga0207678_10032354 | |||
| 1400 | Ga0207678_10044093 | |||
| 1401 | Ga0207678_10068490 | |||
| 1402 | Ga0207678_10193110 | |||
| 1403 | Ga0207678_10211756 | |||
| 1404 | Ga0207702_10000373 | |||
| 1405 | Ga0207702_10000435 | |||
| 1406 | Ga0207702_10013863 | |||
| 1407 | Ga0207702_10019792 | |||
| 1408 | Ga0207702_10048269 | |||
| 1409 | Ga0207702_10073701 | |||
| 1410 | Ga0207702_10090505 | |||
| 1411 | Ga0207702_10105008 | |||
| 1412 | Ga0207702_10129869 | |||
| 1413 | Ga0207702_10234513 | |||
| 1414 | Ga0207641_10009762 | |||
| 1415 | Ga0207641_10033481 | |||
| 1416 | Ga0207641_10084720 | |||
| 1417 | Ga0207641_10135996 | |||
| 1418 | Ga0207641_10158780 | |||
| 1419 | Ga0207648_10001874 | |||
| 1420 | Ga0207676_10001817 | |||
| 1421 | Ga0207676_10004323 | |||
| 1422 | Ga0207676_10006547 | |||
| 1423 | Ga0207674_10000756 | |||
| 1424 | Ga0207674_10001923 | |||
| 1425 | Ga0207674_10002383 | |||
| 1426 | Ga0207674_10003759 | |||
| 1427 | Ga0207674_10003802 | |||
| 1428 | Ga0207674_10007288 | |||
| 1429 | Ga0207674_10088434 | |||
| 1430 | Ga0207674_10088777 | |||
| 1431 | Ga0207674_10120191 | |||
| 1432 | Ga0207683_10006484 | |||
| 1433 | Ga0207683_10020648 | |||
| 1434 | Ga0207683_10033518 | |||
| 1435 | Ga0207698_10001156 | |||
| 1436 | Ga0207698_10002484 | |||
| 1437 | Ga0207698_10003821 | |||
| 1438 | Ga0207698_10009904 | |||
| 1439 | Ga0207698_10011478 | |||
| 1440 | Ga0207698_10016438 | |||
| 1441 | Ga0207698_10019357 | |||
| 1442 | Ga0207698_10019720 | |||
| 1443 | Ga0207698_10022284 | |||
| 1444 | Ga0268266_10169636 | |||
| 1445 | Ga0268265_10329720 | |||
| 1446 | Ga0265334_10000048 | |||
| 1447 | Ga0265338_10005486 | |||
| 1448 | Ga0265338_10010452 | |||
| 1449 | Ga0265762_1000092 | |||
| 1450 | Ga0265762_1002205 | |||
| 1451 | Ga0265762_1005058 | |||
| 1452 | Ga0265762_1006105 | |||
| 1453 | Ga0265760_10003431 | |||
| 1454 | Ga0265760_10009198 | |||
| 1455 | Ga0265760_10021466 | |||
| 1456 | Ga0265325_10015715 | |||
| 1457 | Ga0265339_10019321 | |||
| 1458 | Ga0265339_10077173 | |||
| 1459 | Ga0307411_10237080 | |||
| 1460 | Ga0373944_0024637 | |||
| 1461 | Ga0373936_0001719 | |||
| 1462 | Ga0373936_0049715 | |||
| 1463 | Ga0373945_0010225 | |||
| 1464 | Ga0373954_0017426 | |||
| 1465 | Ga0373943_0000242 | |||
| 1466 | Ga0373943_0035288 | |||
| 1467 | Ga0373924_0025739 | |||
| 1468 | Ga0373931_0024543 | |||
| 1469 | Ga0373935_0005846 | |||
| 1470 | Ga0373935_0057713 | |||
| 1471 | Ga0373927_0000484 | |||
| 1472 | Ga0373933_0176948 | |||
| 1473 | Ga0373947_0000384 | |||
| 1474 | Ga0373937_0008424 | |||
| 1475 | Ga0373937_0031002 | |||
| 1476 | Ga0373937_0258570 | |||
| 1477 | Ga0373925_0003285 | |||
| 1478 | Ga0373925_0003873 | |||
| 1479 | Ga0373925_0020614 | |||
| 1480 | Ga0373925_0100627 | |||
| 1481 | Ga0395899_0000724 | |||
| 1482 | Ga0395899_0001699 | |||
| 1483 | Ga0395899_0002780 | |||
| 1484 | Ga0395899_0004300 | |||
| 1485 | Ga0395899_0004537 | |||
| 1486 | Ga0395899_0011605 | |||
| 1487 | Ga0395899_0025764 | |||
| 1488 | Ga0395899_0033450 | |||
| 1489 | Ga0395899_0043985 | |||
| 1490 | Ga0395899_0047972 | |||
| 1491 | Ga0395899_0078352 | |||
| 1492 | Ga0395899_0119782 | |||
| 1493 | Ga0395899_0125342 | |||
| 1494 | Ga0395899_0128834 | |||
| 1495 | Ga0395899_0185374 | |||
| 1496 | Ga0395899_0219659 | |||
| 1497 | Ga0395900_0000126 | |||
| 1498 | Ga0395900_0000221 | |||
| 1499 | Ga0395900_0000968 | |||
| 1500 | Ga0395900_0008903 | |||
| 1501 | Ga0395900_0013232 | |||
| 1502 | Ga0395900_0015040 | |||
| 1503 | Ga0395900_0023546 | |||
| 1504 | Ga0395900_0031602 | |||
| 1505 | Ga0395900_0105883 | |||
| 1506 | Ga0395900_0169089 | |||
| 1507 | Ga0395900_0169607 | |||
| 1508 | Ga0395900_0203591 | |||
| 1509 | Ga0395900_0229495 | |||
| 1510 | Ga0395900_0245264 | |||
| 1511 | Ga0395900_0249623 | |||
| 1512 | Ga0395900_0270079 | |||
| 1513 | Ga0395900_0335560 | |||
| 1514 | Ga0395900_0358412 | |||
| 1515 | Ga0395900_0378501 | |||
| 1516 | Ga0395900_0395854 | |||
| 1517 | Ga0395900_0430079 | |||
| 1518 | Ga0395898_0000053 | |||
| 1519 | Ga0395898_0001961 | |||
| 1520 | Ga0395898_0002022 | |||
| 1521 | Ga0395898_0006247 | |||
| 1522 | Ga0395898_0041439 | |||
| 1523 | Ga0395898_0041970 | |||
| 1524 | Ga0395898_0042675 | |||
| 1525 | Ga0395898_0045024 | |||
| 1526 | Ga0395898_0089165 | |||
| 1527 | Ga0395898_0090674 | |||
| 1528 | Ga0395898_0105705 | |||
| 1529 | Ga0395898_0248761 | |||
| 1530 | Ga0395905_0000031 | |||
| 1531 | Ga0395905_0003036 | |||
| 1532 | Ga0395905_0003464 | |||
| 1533 | Ga0395905_0003721 | |||
| 1534 | Ga0395905_0004414 | |||
| 1535 | Ga0395905_0005686 | |||
| 1536 | Ga0395905_0006451 | |||
| 1537 | Ga0395905_0008268 | |||
| 1538 | Ga0395905_0012320 | |||
| 1539 | Ga0395905_0020308 | |||
| 1540 | Ga0395905_0020932 | |||
| 1541 | Ga0395905_0028212 | |||
| 1542 | Ga0395905_0034529 | |||
| 1543 | Ga0395905_0052206 | |||
| 1544 | Ga0395905_0061555 | |||
| 1545 | Ga0395905_0073926 | |||
| 1546 | Ga0395905_0085148 | |||
| 1547 | Ga0395905_0136342 | |||
| 1548 | Ga0395905_0157648 | |||
| 1549 | Ga0395905_0187739 | |||
| 1550 | Ga0395905_0192204 | |||
| 1551 | Ga0395905_0192496 | |||
| 1552 | Ga0395905_0193426 | |||
| 1553 | Ga0395905_0205548 | |||
| 1554 | Ga0395905_0213542 | |||
| 1555 | Ga0395901_0000147 | |||
| 1556 | Ga0395901_0000163 | |||
| 1557 | Ga0395901_0000459 | |||
| 1558 | Ga0395901_0001546 | |||
| 1559 | Ga0395901_0017880 | |||
| 1560 | Ga0395901_0018889 | |||
| 1561 | Ga0395901_0023365 | |||
| 1562 | Ga0395901_0032067 | |||
| 1563 | Ga0395901_0040231 | |||
| 1564 | Ga0395901_0051252 | |||
| 1565 | Ga0395901_0072184 | |||
| 1566 | Ga0395901_0076250 | |||
| 1567 | Ga0395901_0088753 | |||
| 1568 | Ga0395901_0130884 | |||
| 1569 | Ga0395901_0133445 | |||
| 1570 | Ga0395901_0160505 | |||
| 1571 | Ga0395901_0175640 | |||
| 1572 | Ga0395901_0187023 | |||
| 1573 | Ga0395901_0189183 | |||
| 1574 | Ga0395901_0198114 | |||
| 1575 | Ga0395901_0277284 | |||
| 1576 | Ga0436365_1629872 | |||
| 1577 | Ga0436360_0148430 | |||
| 1578 | Ga0436360_1023609 | |||
| 1579 | Ga0436361_0999815 | |||
| 1580 | Ga0466969_0010018 | |||
| 1581 | Ga0466969_0021402 | |||
| 1582 | Ga0453683_0091056 | |||
| 1583 | Ga0466966_0000001 | |||
| 1584 | Ga0466966_0005584 | |||
| 1585 | Ga0466966_0029547 | |||
| 1586 | Ga0466966_0043256 | |||
| 1587 | Ga0466966_0060094 | |||
| 1588 | Ga0466963_0026504 | |||
| 1589 | Ga0466963_0046220 | |||
| 1590 | Ga0466963_0061792 | |||
| 1591 | Ga0466963_0074312 | |||
| 1592 | Ga0466963_0081530 | |||
| 1593 | Ga0466963_0082511 | |||
| 1594 | Ga0466971_0037444 | |||
| 1595 | Ga0466971_0042528 | |||
| 1596 | Ga0466970_0024147 | |||
| 1597 | Ga0466970_0034071 | |||
| 1598 | Ga0466970_0117053 | |||
| 1599 | Ga0466957_0006995 | |||
| 1600 | Ga0466957_0026017 | |||
| 1601 | Ga0466957_0079678 | |||
| 1602 | Ga0466957_0192747 | |||
| 1603 | Ga0466960_0021110 | |||
| 1604 | Ga0466959_0000995 | |||
| 1605 | Ga0466959_0032772 | |||
| 1606 | Ga0466959_0073754 | |||
| 1607 | Ga0466959_0077014 | |||
| 1608 | Ga0451576_0105187 | |||
| 1609 | Ga0466958_0000481 | |||
| 1610 | Ga0466958_0028229 | |||
| 1611 | Ga0466958_0040300 | |||
| 1612 | Ga0466958_0047699 | |||
| 1613 | Ga0466958_0157913 | |||
| 1614 | Ga0466967_0008320 | |||
| 1615 | Ga0466967_0009496 | |||
| 1616 | Ga0466967_0012369 | |||
| 1617 | Ga0466967_0017249 | |||
| 1618 | Ga0466967_0020168 | |||
| 1619 | Ga0466967_0057444 | |||
| 1620 | Ga0466967_0065889 | |||
| 1621 | Ga0466967_0106432 | |||
| 1622 | Ga0466967_0198881 | |||
| 1623 | Ga0466967_0220614 | |||
| 1624 | Ga0466967_0234001 | |||
| 1625 | Ga0466967_0266778 | |||
| 1626 | Ga0466967_0272001 | |||
| 1627 | Ga0495629_0043955 | |||
| 1628 | Ga0495629_0083945 | |||
| 1629 | Ga0495580_0010923 | |||
| 1630 | Ga0495580_0063386 | |||
| 1631 | Ga0495582_0071854 | |||
| 1632 | Ga0495664_0015318 | |||
| 1633 | Ga0495665_0038020 | |||
| 1634 | Ga0495668_0010922 | |||
| 1635 | Ga0495658_0032672 | |||
| 1636 | Ga0495669_0000256 | |||
| 1637 | Ga0495669_0007173 | |||
| 1638 | Ga0495613_0035600 | |||
| 1639 | Ga0495624_0067753 | |||
| 1640 | Ga0495600_0110355 | |||
| 1641 | Ga0495674_0037698 | |||
| 1642 | Ga0495683_0078534 | |||
| 1643 | Ga0495602_0027686 | |||
| 1644 | Ga0496100_0151592 | |||
| 1645 | Ga0496101_0007302 | |||
| 1646 | Ga0496101_0040068 | |||
| 1647 | Ga0496101_0083522 | |||
| 1648 | Ga0496102_0035740 | |||
| 1649 | Ga0496102_0120185 | |||
| 1650 | Ga0496102_0144821 | |||
| 1651 | Ga0496104_0091458 | |||
| 1652 | Ga0496104_0117971 | |||
| 1653 | Ga0496104_0123294 | |||
| 1654 | Ga0496104_0255146 | |||
| 1655 | Ga0496105_0010687 | |||
| 1656 | Ga0496105_0015809 | |||
| 1657 | Ga0496105_0063907 | |||
| 1658 | Ga0496105_0137524 | |||
| 1659 | Ga0496105_0276572 | |||
| 1660 | Ga0496106_0000373 | |||
| 1661 | Ga0496106_0040257 | |||
| 1662 | Ga0496107_0003101 | |||
| 1663 | Ga0496107_0006471 | |||
| 1664 | Ga0496107_0033699 | |||
| 1665 | Ga0496107_0046014 | |||
| 1666 | Ga0496107_0126921 | |||
| 1667 | Ga0496108_0001090 | |||
| 1668 | Ga0496108_0001833 | |||
| 1669 | Ga0496108_0024706 | |||
| 1670 | Ga0496109_0011758 | |||
| 1671 | Ga0496109_0031747 | |||
| 1672 | Ga0496110_0000437 | |||
| 1673 | Ga0496110_0054710 | |||
| 1674 | Ga0496111_0005971 | |||
| 1675 | Ga0496111_0011295 | |||
| 1676 | Ga0496111_0032967 | |||
| 1677 | Ga0496112_0002186 | |||
| 1678 | Ga0496112_0006749 | |||
| 1679 | Ga0496112_0026425 | |||
| 1680 | Ga0496112_0135045 | |||
| 1681 | Ga0496112_0250537 | |||
| 1682 | Ga0496113_0002318 | |||
| 1683 | Ga0496113_0002609 | |||
| 1684 | Ga0496113_0005539 | |||
| 1685 | Ga0496113_0015360 | |||
| 1686 | Ga0496113_0016082 | |||
| 1687 | Ga0496114_0100831 | |||
| 1688 | Ga0496115_0001337 | |||
| 1689 | Ga0496115_0013235 | |||
| 1690 | Ga0496115_0029580 | |||
| 1691 | Ga0496121_0000789 | |||
| 1692 | Ga0496126_0012887 | |||
| 1693 | Ga0501046_0088011 | |||
| 1694 | Ga0501047_0011428 | |||
| 1695 | Ga0501047_0263728 | |||
| 1696 | Ga0501079_0268853 | |||
| 1697 | Ga0501080_0249572 | |||
| 1698 | Ga0501080_0319035 | |||
| 1699 | Ga0501035_0117685 | |||
| 1700 | Ga0501044_0095897 | |||
| 1701 | Ga0501044_0228725 | |||
| 1702 | nmdc:mga0n895_362348_c1 | |||
| 1703 | nmdc:mga0rr50_8343_c1 | |||
| 1704 | Ga0495612_0058660 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yr5-assembly1.cif.gz_A | embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state | 0.8516 | 16 | 396 |
| 6e9n-assembly2.cif.gz_B | e. coli d-galactonate:proton symporter in the inward open form | 0.8454 | 12 | 401 |
| 8ex4-assembly1.cif.gz_A | human s1p transporter spns2 in an inward-facing open conformation (state 1) | 0.839 | 12 | 395 |
| 7da5-assembly1.cif.gz_A | cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. | 0.8354 | 11 | 396 |
| 4zow-assembly1.cif.gz_A | crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol | 0.834 | 9 | 393 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07730_11_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9592 | 15 | 200 | 1.20.1250.20 |
| af_O07730_221_402_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9539 | 221 | 400 | 1.20.1250.20 |
| af_A0A1D8PLY7_278_479_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9459 | 206 | 405 | 1.20.1250.20 |
| af_P41036_15_224_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9397 | 11 | 208 | 1.20.1250.20 |
| af_O07730_221_402_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9385 | 221 | 400 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K8QG27-F1-model_v4 | Carboxylic acid transporter protein homolog | 0.9141 | 10 | 409 |
GO:0005886
GO:0046943 |
| AF-A0A358L2B6-F1-model_v4 | MFS transporter | 0.9078 | 16 | 395 |
GO:0005886
GO:0022857 |
| AF-A0A137PBB5-F1-model_v4 | MFS general substrate transporter | 0.9073 | 8 | 396 |
GO:0005886
GO:0046943 |
| AF-A0A2V5MJN3-F1-model_v4 | MFS transporter | 0.903 | 1 | 325 |
GO:0005886
GO:0046943 |
| AF-A0A5E7KTU3-F1-model_v4 | Inner membrane transport protein YnfM | 0.902 | 9 | 394 |
GO:0005886
GO:0022857 |