F483500

General Info

Members Datasets Scaffolds Average Seq Length
852 440 811 265

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10015649|Ga0207707_100156497
Length 319
Sequence MYNFNYHQAKNVDEAAKLVTGAEEGKLMAGGMTLIPTLKQRLAKPSDIVDLGKIADLKGIKKDGNAIVIGAMTRHFDVANSDVVKSAIPALAYLASHIGDPAVRNRGTMGGSVANNDPAADYPSAVLALNATVITNKRKIAADDFFKGMFETALEDGEIITSFSYPIPEKAAYMKFPNPASRYAIVGVFVAKTGGNIRVAVTGAGPVVFRQKDMEAALAKSFTADAIKSIAQKQDGLNSDIHASAEYRAHLVGRDGAARRGGRRRLTFGQSFLRGKGALAAPFFLHRAGVYAAPRNRLVPPAKGGHPLALIRIWGERRS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
4 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
5 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
6 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
7 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
8 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
9 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
10 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
11 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
12 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
13 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
14 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
15 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
16 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
17 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
18 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
19 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
20 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
21 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
22 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
23 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
24 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
25 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
26 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
27 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
28 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
29 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
30 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
31 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
32 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
33 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
34 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
35 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
36 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
37 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
38 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
72 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
109 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
157 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
158 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
159 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
160 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
161 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
232 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
238 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
239 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
240 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
241 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
242 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
243 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
244 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
245 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
246 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
247 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
248 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
249 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
250 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
251 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
252 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
257 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
258 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
259 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
261 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
262 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
263 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
267 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
269 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
271 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
272 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
273 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
274 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
281 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
282 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
285 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
286 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
287 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
288 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
289 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
290 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
291 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
292 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
293 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
300 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
301 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
305 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
306 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
307 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
308 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
309 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
310 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
311 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
312 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
313 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
314 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
315 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
316 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
317 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
318 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
321 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
332 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
333 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
336 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
337 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
391 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
392 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
395 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
396 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
397 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
398 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
399 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
406 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
407 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
408 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
409 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
410 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
411 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
412 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
413 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
414 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
415 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
416 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
417 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
418 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
419 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
420 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
421 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
422 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
423 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
424 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
425 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
426 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
427 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
428 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
429 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
430 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
431 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
432 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
433 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
434 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
435 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
436 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
437 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
438 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
439 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
440 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 0.82
Isolates 4.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.51
Nodule 3.99
Rhizoplane 2
Rhizosphere 81.1
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000581 3300003187 Bacteria 32575
2 JGI25153J46596_10038973 3300003215 Bacteria 1490
3 JGI25160J50197_1012997 3300003354 Bacteria 2858
4 Ga0055540_1006370 3300003792 Bacteria 4699
5 Ga0055531_10000205 3300003794 Bacteria 65042
6 Ga0070658_10027472 3300005327 Bacteria 4566
7 Ga0070658_10175458 3300005327 Bacteria 1802
8 Ga0070658_10202452 3300005327 Bacteria 1675
9 Ga0070676_10174605 3300005328 Bacteria 1393
10 Ga0070676_10195709 3300005328 Bacteria 1322
11 Ga0070683_100097755 3300005329 Bacteria 2762
12 Ga0070690_100000993 3300005330 Bacteria 14445
13 Ga0070670_100078478 3300005331 Bacteria 2836
14 Ga0070670_100144274 3300005331 Bacteria 2059
15 Ga0070670_100346042 3300005331 Bacteria 1305
16 Ga0070670_100392517 3300005331 Bacteria 1224
17 Ga0068869_100003070 3300005334 Bacteria 10160
18 Ga0068869_100598493 3300005334 Bacteria 931
19 Ga0070666_10143370 3300005335 Bacteria 1664
20 Ga0070680_100002437 3300005336 Bacteria 13786
21 Ga0070680_100004645 3300005336 Bacteria 10326
22 Ga0070680_100042488 3300005336 Bacteria 3689
23 Ga0070680_100095828 3300005336 Bacteria 2460
24 Ga0070680_100119264 3300005336 Bacteria 2201
25 Ga0070680_100202239 3300005336 Bacteria 1675
26 Ga0070680_100285920 3300005336 Bacteria 1397
27 Ga0068868_100157473 3300005338 Bacteria 1874
28 Ga0068868_100523523 3300005338 Bacteria 1041
29 Ga0070660_100025112 3300005339 Bacteria 4427
30 Ga0070689_100001070 3300005340 Bacteria 17145
31 Ga0070689_100162142 3300005340 Bacteria 1808
32 Ga0070691_10000198 3300005341 Bacteria 20173
33 Ga0070691_10004632 3300005341 Bacteria 6253
34 Ga0070691_10037021 3300005341 Bacteria 2301
35 Ga0070687_100013313 3300005343 Bacteria 3662
36 Ga0070687_100035769 3300005343 Bacteria 2469
37 Ga0070661_100041839 3300005344 Bacteria 3344
38 Ga0070692_10037720 3300005345 Bacteria 2459
39 Ga0070669_100146442 3300005353 Bacteria 1825
40 Ga0070669_100173512 3300005353 Bacteria 1682
41 Ga0070669_100333787 3300005353 Bacteria 1227
42 Ga0070669_100401929 3300005353 Bacteria 1121
43 Ga0070675_100041829 3300005354 Bacteria 3743
44 Ga0070675_100042464 3300005354 Bacteria 3715
45 Ga0070675_100085634 3300005354 Bacteria 2633
46 Ga0070675_100422423 3300005354 Bacteria 1192
47 Ga0070671_100106902 3300005355 Bacteria 2349
48 Ga0070671_100109547 3300005355 Bacteria 2319
49 Ga0070671_100302212 3300005355 Bacteria 1363
50 Ga0070671_100444094 3300005355 Bacteria 1112
51 Ga0070674_100014481 3300005356 Bacteria 4903
52 Ga0070674_100071836 3300005356 Bacteria 2449
53 Ga0070673_100034415 3300005364 Bacteria 3834
54 Ga0070673_100370303 3300005364 Bacteria 1275
55 Ga0070673_100392474 3300005364 Bacteria 1239
56 Ga0070688_100160284 3300005365 Bacteria 1545
57 Ga0070659_100006542 3300005366 Bacteria 8416
58 Ga0070659_100158175 3300005366 Bacteria 1852
59 Ga0070659_100251560 3300005366 Bacteria 1464
60 Ga0070667_100012504 3300005367 Bacteria 7021
61 Ga0070667_100217006 3300005367 Bacteria 1702
62 Ga0070667_100434216 3300005367 Bacteria 1198
63 Ga0070667_100587091 3300005367 Bacteria 1026
64 Ga0070667_100681990 3300005367 Bacteria 950
65 Ga0070713_100158783 3300005436 Bacteria 2017
66 Ga0070701_10000075 3300005438 Bacteria 27473
67 Ga0070701_10034226 3300005438 Bacteria 2544
68 Ga0070711_100275835 3300005439 Bacteria 1328
69 Ga0070705_100036943 3300005440 Bacteria 2751
70 Ga0070700_100002507 3300005441 Bacteria 9355
71 Ga0070700_100057706 3300005441 Bacteria 2436
72 Ga0070700_100071135 3300005441 Bacteria 2220
73 Ga0070694_100008159 3300005444 Bacteria 6394
74 Ga0070708_100046726 3300005445 Bacteria 3820
75 Ga0070678_100060116 3300005456 Bacteria 2796
76 Ga0070662_100051128 3300005457 Bacteria 2983
77 Ga0070662_100063540 3300005457 Bacteria 2701
78 Ga0070681_10002137 3300005458 Bacteria 17962
79 Ga0070681_10002558 3300005458 Bacteria 16700
80 Ga0070681_10008342 3300005458 Bacteria 10148
81 Ga0070681_10058698 3300005458 Bacteria 3827
82 Ga0070681_10074615 3300005458 Bacteria 3353
83 Ga0070681_10116369 3300005458 Bacteria 2610
84 Ga0070681_10200092 3300005458 Bacteria 1916
85 Ga0070681_10569941 3300005458 Bacteria 1046
86 Ga0070681_10573808 3300005458 Bacteria 1042
87 Ga0068867_100000421 3300005459 Bacteria 28313
88 Ga0068867_100051934 3300005459 Bacteria 3024
89 Ga0068867_100222300 3300005459 Bacteria 1522
90 Ga0070706_100238536 3300005467 Bacteria 1698
91 Ga0070707_100383652 3300005468 Bacteria 1365
92 Ga0070698_100003981 3300005471 Bacteria 16258
93 Ga0070698_100054255 3300005471 Bacteria 4070
94 Ga0070698_100083208 3300005471 Bacteria 3190
95 Ga0070698_100303624 3300005471 Bacteria 1527
96 Ga0070698_100841274 3300005471 Bacteria 862
97 Ga0070699_100284425 3300005518 Bacteria 1482
98 Ga0070679_100003954 3300005530 Bacteria 13644
99 Ga0070679_100004261 3300005530 Bacteria 13201
100 Ga0070679_100017188 3300005530 Bacteria 6997
101 Ga0070679_100064110 3300005530 Bacteria 3662
102 Ga0070679_100102619 3300005530 Bacteria 2846
103 Ga0070679_100137729 3300005530 Bacteria 2422
104 Ga0070679_100264409 3300005530 Bacteria 1675
105 Ga0070684_100042463 3300005535 Bacteria 3925
106 Ga0070684_100505133 3300005535 Bacteria 1120
107 Ga0070697_100020296 3300005536 Bacteria 5255
108 Ga0070697_100251570 3300005536 Bacteria 1511
109 Ga0068853_100001762 3300005539 Bacteria 15900
110 Ga0070672_100065877 3300005543 Bacteria 2866
111 Ga0070672_100333142 3300005543 Bacteria 1291
112 Ga0070686_100000270 3300005544 Bacteria 35461
113 Ga0070695_100056903 3300005545 Bacteria 2525
114 Ga0070695_100446254 3300005545 Bacteria 990
115 Ga0070696_100003294 3300005546 Bacteria 10777
116 Ga0070696_100233624 3300005546 Bacteria 1384
117 Ga0070693_100001571 3300005547 Bacteria 10296
118 Ga0070665_100002531 3300005548 Bacteria 20087
119 Ga0070665_100157564 3300005548 Bacteria 2272
120 Ga0070665_100549650 3300005548 Bacteria 1167
121 Ga0070704_100066824 3300005549 Bacteria 2594
122 Ga0070704_100114552 3300005549 Bacteria 2058
123 Ga0068855_100005088 3300005563 Bacteria 16031
124 Ga0068855_100022196 3300005563 Bacteria 7606
125 Ga0068855_100121708 3300005563 Bacteria 2986
126 Ga0068855_100340451 3300005563 Bacteria 1654
127 Ga0068855_100758550 3300005563 Bacteria 1034
128 Ga0068855_100768800 3300005563 Bacteria 1026
129 Ga0070664_100033863 3300005564 Bacteria 4283
130 Ga0068857_100006255 3300005577 Bacteria 10182
131 Ga0068857_100012178 3300005577 Bacteria 7481
132 Ga0068857_100118282 3300005577 Bacteria 2385
133 Ga0068857_100227096 3300005577 Bacteria 1706
134 Ga0068854_100026505 3300005578 Bacteria 3984
135 Ga0068854_100135020 3300005578 Bacteria 1888
136 Ga0068854_100136497 3300005578 Bacteria 1878
137 Ga0070702_100000370 3300005615 Bacteria 15791
138 Ga0070702_100046626 3300005615 Bacteria 2457
139 Ga0070702_100085227 3300005615 Bacteria 1902
140 Ga0068852_100009333 3300005616 Bacteria 7281
141 Ga0068852_100194976 3300005616 Bacteria 1913
142 Ga0068859_100008372 3300005617 Bacteria 10482
143 Ga0068859_100016233 3300005617 Bacteria 7481
144 Ga0068859_100226524 3300005617 Bacteria 1957
145 Ga0068859_100281175 3300005617 Bacteria 1757
146 Ga0068859_100355715 3300005617 Bacteria 1559
147 Ga0068859_100534335 3300005617 Bacteria 1267
148 Ga0068859_100750577 3300005617 Bacteria 1065
149 Ga0068864_100109023 3300005618 Bacteria 2464
150 Ga0068866_10000249 3300005718 Bacteria 25399
151 Ga0068866_10026604 3300005718 Bacteria 2734
152 Ga0068861_100005107 3300005719 Bacteria 8849
153 Ga0068861_100459377 3300005719 Bacteria 1143
154 Ga0068851_10028875 3300005834 Bacteria 2742
155 Ga0068863_100136353 3300005841 Bacteria 2345
156 Ga0068858_100010505 3300005842 Bacteria 8771
157 Ga0068858_100243912 3300005842 Bacteria 1705
158 Ga0068858_100359363 3300005842 Bacteria 1396
159 Ga0068860_100309804 3300005843 Bacteria 1548
160 Ga0068860_100343963 3300005843 Bacteria 1467
161 Ga0068860_100750349 3300005843 Bacteria 988
162 Ga0068862_100001761 3300005844 Bacteria 19572
163 Ga0068862_100055175 3300005844 Bacteria 3403
164 Ga0068862_100107662 3300005844 Bacteria 2444
165 Ga0081455_10003323 3300005937 Bacteria 18577
166 Ga0081455_10006621 3300005937 Bacteria 12395
167 Ga0081455_10009487 3300005937 Bacteria 10005
168 Ga0081455_10400814 3300005937 Bacteria 952
169 Ga0081538_10016756 3300005981 Bacteria 5601
170 Ga0081538_10121911 3300005981 Bacteria 1250
171 Ga0081539_10004821 3300005985 Bacteria 14466
172 Ga0081539_10132688 3300005985 Bacteria 1221
173 Ga0070717_10015233 3300006028 Bacteria 5933
174 Ga0070717_10228163 3300006028 Bacteria 1639
175 Ga0070717_10519149 3300006028 Bacteria 1077
176 Ga0075365_10025403 3300006038 Bacteria 3749
177 Ga0075365_10039511 3300006038 Bacteria 3073
178 Ga0075365_10202862 3300006038 Bacteria 1389
179 Ga0075363_100053182 3300006048 Bacteria 2163
180 Ga0070716_100164613 3300006173 Bacteria 1441
181 Ga0070712_100004370 3300006175 Bacteria 8719
182 Ga0070712_100007601 3300006175 Bacteria 6773
183 Ga0075362_10003442 3300006177 Bacteria 5529
184 Ga0075362_10019652 3300006177 Bacteria 2812
185 Ga0075362_10067503 3300006177 Bacteria 1627
186 Ga0075367_10116215 3300006178 Bacteria 1645
187 Ga0075369_10006384 3300006186 Bacteria 4456
188 Ga0075369_10012486 3300006186 Bacteria 3357
189 Ga0075369_10038635 3300006186 Bacteria 2037
190 Ga0075366_10059945 3300006195 Bacteria 2261
191 Ga0075366_10076888 3300006195 Bacteria 1992
192 Ga0097621_100001920 3300006237 Bacteria 14203
193 Ga0097621_100192732 3300006237 Bacteria 1766
194 Ga0097621_100221057 3300006237 Bacteria 1650
195 Ga0075370_10009458 3300006353 Bacteria 5063
196 Ga0075370_10101359 3300006353 Bacteria 1666
197 Ga0068871_100012239 3300006358 Bacteria 6318
198 Ga0068871_100074754 3300006358 Bacteria 2796
199 Ga0075431_100006873 3300006847 Bacteria 11303
200 Ga0068865_100009147 3300006881 Bacteria 6132
201 Ga0097620_100008372 3300006931 Bacteria 10482
202 Ga0097620_100016233 3300006931 Bacteria 7481
203 Ga0097620_100226515 3300006931 Bacteria 1957
204 Ga0097620_100281175 3300006931 Bacteria 1757
205 Ga0097620_100355724 3300006931 Bacteria 1559
206 Ga0097620_100534359 3300006931 Bacteria 1267
207 Ga0097620_100750554 3300006931 Bacteria 1065
208 Ga0099795_10052608 3300007788 Bacteria 1488
209 Ga0105240_10031426 3300009093 Bacteria 6886
210 Ga0105240_10075931 3300009093 Bacteria 4144
211 Ga0105240_10609131 3300009093 Bacteria 1201
212 Ga0105240_10696607 3300009093 Bacteria 1109
213 Ga0111539_10000450 3300009094 Bacteria 51598
214 Ga0111539_10055725 3300009094 Bacteria 4700
215 Ga0111539_10188308 3300009094 Bacteria 2409
216 Ga0111539_10687992 3300009094 Bacteria 1190
217 Ga0105245_10001133 3300009098 Bacteria 24100
218 Ga0114129_10204573 3300009147 Bacteria 2672
219 Ga0105243_10000923 3300009148 Bacteria 27536
220 Ga0105243_10130178 3300009148 Bacteria 2134
221 Ga0105242_10316141 3300009176 Bacteria 1431
222 Ga0105248_10031448 3300009177 Bacteria 5933
223 Ga0105248_10117808 3300009177 Bacteria 2995
224 Ga0105248_10182969 3300009177 Bacteria 2361
225 Ga0105248_10663696 3300009177 Bacteria 1176
226 Ga0105237_10017697 3300009545 Bacteria 7387
227 Ga0105237_10035864 3300009545 Bacteria 5017
228 Ga0105238_10008348 3300009551 Bacteria 10362
229 Ga0105238_10063704 3300009551 Bacteria 3687
230 Ga0105239_10006145 3300010375 Bacteria 13970
231 Ga0157373_10114880 3300013100 Bacteria 1893
232 Ga0157371_10198788 3300013102 Bacteria 1437
233 Ga0157370_10003797 3300013104 Bacteria 17620
234 Ga0157370_10005023 3300013104 Bacteria 14942
235 Ga0157370_10040954 3300013104 Bacteria 4471
236 Ga0157370_10200945 3300013104 Bacteria 1849
237 Ga0157369_10855325 3300013105 Bacteria 933
238 Ga0157374_10102692 3300013296 Bacteria 2742
239 Ga0157378_10001174 3300013297 Bacteria 23845
240 Ga0157378_10016742 3300013297 Bacteria 6423
241 Ga0157378_10095994 3300013297 Bacteria 2701
242 Ga0157378_10684767 3300013297 Bacteria 1043
243 Ga0163162_10098077 3300013306 Bacteria 3020
244 Ga0157372_10031749 3300013307 Bacteria 5786
245 Ga0157372_10168950 3300013307 Bacteria 2530
246 Ga0157372_10181499 3300013307 Bacteria 2436
247 Ga0157372_10189287 3300013307 Bacteria 2383
248 Ga0157372_10253999 3300013307 Bacteria 2041
249 Ga0157375_10039302 3300013308 Bacteria 4553
250 Ga0157375_10076567 3300013308 Bacteria 3373
251 Ga0157375_10077872 3300013308 Bacteria 3347
252 Ga0157375_10633727 3300013308 Bacteria 1226
253 Ga0157375_10689949 3300013308 Bacteria 1175
254 Ga0163163_10288025 3300014325 Bacteria 1694
255 Ga0157380_10402116 3300014326 Bacteria 1300
256 Ga0182008_10115008 3300014497 Bacteria 1334
257 Ga0157379_10223278 3300014968 Bacteria 1707
258 Ga0157376_10161777 3300014969 Bacteria 2030
259 Ga0157376_10219194 3300014969 Bacteria 1761
260 Ga0157376_10335831 3300014969 Bacteria 1441
261 Ga0163161_10142354 3300017792 Bacteria 1816
262 Ga0163161_10193103 3300017792 Bacteria 1566
263 Ga0197907_10899973 3300020069 Bacteria 1591
264 Ga0206356_10239614 3300020070 Bacteria 2194
265 Ga0206350_10974906 3300020080 Bacteria 1387
266 Ga0206353_10048251 3300020082 Bacteria 1325
267 Ga0206353_10327856 3300020082 Bacteria 1446
268 Ga0213872_10028776 3300021361 Bacteria 2548
269 Ga0213874_10043831 3300021377 Bacteria 1349
270 Ga0213876_10001938 3300021384 Bacteria 12409
271 Ga0213876_10237830 3300021384 Bacteria 968
272 Ga0213875_10008711 3300021388 Bacteria 5177
273 Ga0213875_10148721 3300021388 Bacteria 1097
274 Ga0213871_10002128 3300021441 Bacteria 3572
275 Ga0213871_10016836 3300021441 Bacteria 1768
276 Ga0224712_10046689 3300022467 Bacteria 1663
277 Ga0224712_10197279 3300022467 Bacteria 914
278 Ga0209148_1000268 3300025254 Bacteria 81728
279 Ga0209455_1001518 3300025272 Bacteria 10379
280 Ga0209673_1050415 3300025273 Bacteria 1106
281 Ga0209130_1000502 3300025284 Bacteria 39793
282 Ga0209130_1010355 3300025284 Bacteria 2574
283 Ga0209025_1000077 3300025294 Bacteria 271958
284 Ga0207426_1000576 3300025302 Bacteria 49162
285 Ga0207426_1014765 3300025302 Bacteria 2855
286 Ga0209051_1000310 3300025303 Bacteria 76181
287 Ga0209257_1000165 3300025304 Bacteria 172773
288 Ga0207656_10026144 3300025321 Bacteria 2376
289 Ga0207682_10002243 3300025893 Bacteria 8727
290 Ga0207642_10003143 3300025899 Bacteria 5178
291 Ga0207680_10019191 3300025903 Bacteria 3652
292 Ga0207680_10032431 3300025903 Bacteria 2970
293 Ga0207680_10052566 3300025903 Bacteria 2442
294 Ga0207685_10218323 3300025905 Bacteria 905
295 Ga0207699_10053259 3300025906 Bacteria 2398
296 Ga0207699_10078691 3300025906 Bacteria 2037
297 Ga0207699_10080514 3300025906 Bacteria 2018
298 Ga0207699_10437270 3300025906 Bacteria 937
299 Ga0207705_10000714 3300025909 Bacteria 27406
300 Ga0207705_10003763 3300025909 Bacteria 11556
301 Ga0207705_10326461 3300025909 Bacteria 1180
302 Ga0207684_10149915 3300025910 Bacteria 2006
303 Ga0207707_10001526 3300025912 Bacteria 21370
304 Ga0207707_10002213 3300025912 Bacteria 17582
305 Ga0207707_10015649 3300025912 Bacteria 6607
306 Ga0207707_10016341 3300025912 Bacteria 6474
307 Ga0207707_10027081 3300025912 Bacteria 5011
308 Ga0207707_10049872 3300025912 Bacteria 3647
309 Ga0207707_10093743 3300025912 Bacteria 2623
310 Ga0207707_10417354 3300025912 Bacteria 1151
311 Ga0207707_10573626 3300025912 Bacteria 957
312 Ga0207707_10638402 3300025912 Bacteria 898
313 Ga0207695_10014722 3300025913 Bacteria 9249
314 Ga0207695_10306311 3300025913 Bacteria 1479
315 Ga0207695_10332057 3300025913 Bacteria 1409
316 Ga0207693_10003170 3300025915 Bacteria 14130
317 Ga0207693_10019311 3300025915 Bacteria 5423
318 Ga0207693_10070608 3300025915 Bacteria 2733
319 Ga0207660_10001236 3300025917 Bacteria 17105
320 Ga0207660_10007598 3300025917 Bacteria 7015
321 Ga0207660_10038214 3300025917 Bacteria 3350
322 Ga0207660_10082014 3300025917 Bacteria 2371
323 Ga0207660_10096220 3300025917 Bacteria 2204
324 Ga0207662_10027376 3300025918 Bacteria 3290
325 Ga0207657_10000554 3300025919 Bacteria 39853
326 Ga0207657_10152751 3300025919 Bacteria 1879
327 Ga0207657_10482859 3300025919 Bacteria 971
328 Ga0207652_10002084 3300025921 Bacteria 17192
329 Ga0207652_10002621 3300025921 Bacteria 15104
330 Ga0207652_10081935 3300025921 Bacteria 2823
331 Ga0207652_10358883 3300025921 Bacteria 1315
332 Ga0207652_10471214 3300025921 Bacteria 1131
333 Ga0207646_10031412 3300025922 Bacteria 4808
334 Ga0207646_10542279 3300025922 Bacteria 1046
335 Ga0207681_10147730 3300025923 Bacteria 1758
336 Ga0207681_10296968 3300025923 Bacteria 1277
337 Ga0207694_10008861 3300025924 Bacteria 7590
338 Ga0207694_10043329 3300025924 Bacteria 3473
339 Ga0207694_10482601 3300025924 Bacteria 1037
340 Ga0207650_10054109 3300025925 Bacteria 2976
341 Ga0207650_10151267 3300025925 Bacteria 1832
342 Ga0207650_10301960 3300025925 Bacteria 1308
343 Ga0207650_10458776 3300025925 Bacteria 1061
344 Ga0207659_10004576 3300025926 Bacteria 8364
345 Ga0207659_10009302 3300025926 Bacteria 6136
346 Ga0207659_10039743 3300025926 Bacteria 3284
347 Ga0207659_10415904 3300025926 Bacteria 1127
348 Ga0207687_10001219 3300025927 Bacteria 17600
349 Ga0207687_10434099 3300025927 Bacteria 1086
350 Ga0207687_10560973 3300025927 Bacteria 959
351 Ga0207700_10028357 3300025928 Bacteria 3935
352 Ga0207700_10158135 3300025928 Bacteria 1880
353 Ga0207700_10727687 3300025928 Bacteria 886
354 Ga0207664_10069875 3300025929 Bacteria 2824
355 Ga0207644_10059554 3300025931 Bacteria 2762
356 Ga0207644_10115785 3300025931 Bacteria 2033
357 Ga0207644_10325039 3300025931 Bacteria 1244
358 Ga0207690_10009385 3300025932 Bacteria 5810
359 Ga0207690_10072916 3300025932 Bacteria 2372
360 Ga0207706_10113911 3300025933 Bacteria 2379
361 Ga0207686_10137112 3300025934 Bacteria 1686
362 Ga0207709_10011909 3300025935 Bacteria 4796
363 Ga0207670_10605820 3300025936 Bacteria 900
364 Ga0207669_10153820 3300025937 Bacteria 1615
365 Ga0207669_10209518 3300025937 Bacteria 1421
366 Ga0207704_10001122 3300025938 Bacteria 11913
367 Ga0207665_10153884 3300025939 Bacteria 1649
368 Ga0207691_10002172 3300025940 Bacteria 19178
369 Ga0207691_10026903 3300025940 Bacteria 5397
370 Ga0207691_10082777 3300025940 Bacteria 2882
371 Ga0207711_10131630 3300025941 Bacteria 2243
372 Ga0207689_10001864 3300025942 Bacteria 19957
373 Ga0207689_10029957 3300025942 Bacteria 4538
374 Ga0207689_10230450 3300025942 Bacteria 1531
375 Ga0207689_10326940 3300025942 Bacteria 1273
376 Ga0207661_10557089 3300025944 Bacteria 1050
377 Ga0207679_10059987 3300025945 Bacteria 2824
378 Ga0207667_10014788 3300025949 Bacteria 8879
379 Ga0207667_10034440 3300025949 Bacteria 5437
380 Ga0207667_10106521 3300025949 Bacteria 2892
381 Ga0207651_10400543 3300025960 Bacteria 1167
382 Ga0207668_10243654 3300025972 Bacteria 1456
383 Ga0207668_10381495 3300025972 Bacteria 1187
384 Ga0207640_10051216 3300025981 Bacteria 2683
385 Ga0207640_10232307 3300025981 Bacteria 1420
386 Ga0207640_10333769 3300025981 Bacteria 1212
387 Ga0207658_10064281 3300025986 Bacteria 2752
388 Ga0207658_10317673 3300025986 Bacteria 1347
389 Ga0207658_10583269 3300025986 Bacteria 1003
390 Ga0207677_10642135 3300026023 Bacteria 936
391 Ga0207703_10026898 3300026035 Bacteria 4530
392 Ga0207703_10074623 3300026035 Bacteria 2809
393 Ga0207703_10136939 3300026035 Bacteria 2120
394 Ga0207703_10157254 3300026035 Bacteria 1987
395 Ga0207639_10002688 3300026041 Bacteria 11930
396 Ga0207639_10370068 3300026041 Bacteria 1285
397 Ga0207639_10534975 3300026041 Bacteria 1074
398 Ga0207708_10005526 3300026075 Bacteria 9326
399 Ga0207708_10007313 3300026075 Bacteria 8162
400 Ga0207708_10095815 3300026075 Bacteria 2292
401 Ga0207708_10184778 3300026075 Bacteria 1656
402 Ga0207702_10090140 3300026078 Bacteria 2683
403 Ga0207702_10390982 3300026078 Bacteria 1339
404 Ga0207641_10229358 3300026088 Bacteria 1725
405 Ga0207648_10030105 3300026089 Bacteria 4811
406 Ga0207648_10067938 3300026089 Bacteria 3106
407 Ga0207676_10145747 3300026095 Bacteria 2033
408 Ga0207676_10372504 3300026095 Bacteria 1327
409 Ga0207674_10026028 3300026116 Bacteria 6225
410 Ga0207674_10027483 3300026116 Bacteria 6017
411 Ga0207674_10032578 3300026116 Bacteria 5465
412 Ga0207674_10136898 3300026116 Bacteria 2410
413 Ga0207674_10342544 3300026116 Bacteria 1445
414 Ga0207675_100000234 3300026118 Bacteria 52634
415 Ga0207675_100043375 3300026118 Bacteria 4200
416 Ga0207683_10000189 3300026121 Bacteria 52818
417 Ga0207683_10010770 3300026121 Bacteria 7797
418 Ga0207683_10446670 3300026121 Bacteria 1192
419 Ga0207698_10059368 3300026142 Bacteria 2970
420 Ga0207698_10110170 3300026142 Bacteria 2305
421 Ga0209969_1000495 3300027360 Bacteria 5283
422 Ga0209967_1002629 3300027364 Bacteria 2337
423 Ga0209984_1014159 3300027424 Bacteria 1051
424 Ga0210000_1006363 3300027462 Bacteria 1719
425 Ga0209995_1002913 3300027471 Bacteria 2714
426 Ga0209999_1001275 3300027543 Bacteria 4327
427 Ga0209970_1015123 3300027614 Bacteria 1283
428 Ga0209813_10059801 3300027866 Bacteria 1214
429 Ga0209974_10002954 3300027876 Bacteria 6172
430 Ga0207428_10000169 3300027907 Bacteria 90667
431 Ga0207428_10221092 3300027907 Bacteria 1419
432 Ga0268266_10103680 3300028379 Bacteria 2510
433 Ga0268266_10847951 3300028379 Bacteria 883
434 Ga0268265_10334580 3300028380 Bacteria 1376
435 Ga0268265_10359675 3300028380 Bacteria 1332
436 Ga0268264_10263045 3300028381 Bacteria 1608
437 Ga0268264_10358454 3300028381 Bacteria 1390
438 Ga0268264_10423092 3300028381 Bacteria 1285
439 Ga0265326_10046553 3300028558 Bacteria 1230
440 Ga0265338_10230119 3300028800 Bacteria 1379
441 Ga0265338_10255007 3300028800 Bacteria 1292
442 Ga0307511_10018066 3300030521 Bacteria 6748
443 Ga0265330_10035395 3300031235 Bacteria 2228
444 Ga0265332_10008217 3300031238 Bacteria 4692
445 Ga0265332_10065391 3300031238 Bacteria 1553
446 Ga0265328_10003968 3300031239 Bacteria 6505
447 Ga0265329_10022657 3300031242 Bacteria 2099
448 Ga0265340_10095182 3300031247 Bacteria 1389
449 Ga0265331_10005807 3300031250 Bacteria 7394
450 Ga0265331_10015988 3300031250 Bacteria 3948
451 Ga0265327_10022910 3300031251 Bacteria 3715
452 Ga0265316_10235168 3300031344 Bacteria 1348
453 Ga0307408_100074379 3300031548 Bacteria 2521
454 Ga0265313_10019402 3300031595 Bacteria 3784
455 Ga0316575_10029533 3300031665 Bacteria 2141
456 Ga0265314_10001600 3300031711 Bacteria 24910
457 Ga0265342_10037861 3300031712 Bacteria 2939
458 Ga0307409_100472922 3300031995 Bacteria 1214
459 Ga0307416_100161965 3300032002 Bacteria 2069
460 Ga0307416_100224851 3300032002 Bacteria 1804
461 Ga0307414_10107183 3300032004 Bacteria 2117
462 Ga0307411_10266792 3300032005 Bacteria 1355
463 Ga0307510_10005450 3300033180 Bacteria 15156
464 Ga0373926_0006701 3300035083 Bacteria 3825
465 Ga0373926_0035404 3300035083 Bacteria 1771
466 Ga0373926_0083093 3300035083 Bacteria 1186
467 Ga0373923_0028341 3300035111 Bacteria 2240
468 Ga0373923_0076139 3300035111 Bacteria 1448
469 Ga0373932_0062101 3300035112 Bacteria 1138
470 Ga0373932_0119650 3300035112 Bacteria 877
471 Ga0373953_0002942 3300035117 Bacteria 5205
472 Ga0373954_0005019 3300035118 Bacteria 5712
473 Ga0373957_0026824 3300035120 Bacteria 2087
474 Ga0373946_0020214 3300035171 Bacteria 2572
475 Ga0373955_0025284 3300035172 Bacteria 3047
476 Ga0373961_0000005 3300035241 Bacteria 146538
477 Ga0373924_0067809 3300035410 Bacteria 1501
478 Ga0373931_0210651 3300035691 Bacteria 1165
479 Ga0373935_0090574 3300035692 Bacteria 2002
480 Ga0373935_0147227 3300035692 Bacteria 1595
481 Ga0373927_0090614 3300035695 Bacteria 1986
482 Ga0373927_0092990 3300035695 Bacteria 1959
483 Ga0373927_0114880 3300035695 Bacteria 1755
484 Ga0373933_0010069 3300035724 Bacteria 5175
485 Ga0373933_0038465 3300035724 Bacteria 2810
486 Ga0373933_0175211 3300035724 Bacteria 1366
487 Ga0373947_0032416 3300035725 Bacteria 3079
488 Ga0373937_0036511 3300036401 Bacteria 4478
489 Ga0373937_0037501 3300036401 Bacteria 4417
490 Ga0373937_0049639 3300036401 Bacteria 3842
491 Ga0373937_0057104 3300036401 Bacteria 3585
492 Ga0373937_0129683 3300036401 Bacteria 2355
493 Ga0373937_0377201 3300036401 Bacteria 1345
494 Ga0373937_0647004 3300036401 Bacteria 1002
495 Ga0316582_0265613 3300036647 Bacteria 1177
496 Ga0373925_0008070 3300037068 Bacteria 7669
497 Ga0373925_0038518 3300037068 Bacteria 3535
498 Ga0395899_0026633 3300037312 Bacteria 4362
499 Ga0395899_0266641 3300037312 Bacteria 1169
500 Ga0395900_0001993 3300037418 Bacteria 23054
501 Ga0395900_0013646 3300037418 Bacteria 8294
502 Ga0395900_0431173 3300037418 Bacteria 1277
503 Ga0395900_0638852 3300037418 Bacteria 1002
504 Ga0395898_0003319 3300037466 Bacteria 18072
505 Ga0395898_0047599 3300037466 Bacteria 4207
506 Ga0395905_0000043 3300037471 Bacteria 247469
507 Ga0395905_0004055 3300037471 Bacteria 15358
508 Ga0436364_0749911 3300037853 Bacteria 1993
509 Ga0436364_0891296 3300037853 Bacteria 1856
510 Ga0436364_1360422 3300037853 Bacteria 15324
511 Ga0395901_0024450 3300038443 Bacteria 6200
512 Ga0395901_0231803 3300038443 Bacteria 1927
513 Ga0395901_0381012 3300038443 Bacteria 1451
514 Ga0400483_220694 3300039062 Bacteria 6582
515 Ga0436365_0065739 3300039437 Bacteria 19976
516 Ga0436365_0202658 3300039437 Bacteria 4473
517 Ga0436365_0801734 3300039437 Bacteria 1199
518 Ga0436365_1116753 3300039437 Bacteria 5499
519 Ga0436360_0375286 3300039438 Bacteria 2491
520 Ga0436360_0401373 3300039438 Bacteria 6508
521 Ga0436360_0569429 3300039438 Bacteria 1127
522 Ga0436360_0675016 3300039438 Bacteria 2684
523 Ga0436360_0696399 3300039438 Bacteria 19859
524 Ga0436360_0734197 3300039438 Bacteria 1476
525 Ga0436360_0871428 3300039438 Bacteria 3201
526 Ga0436360_1220716 3300039438 Bacteria 3658
527 Ga0436361_0320193 3300039447 Bacteria 6759
528 Ga0436361_0446953 3300039447 Bacteria 4784
529 Ga0436361_0522153 3300039447 Bacteria 6431
530 Ga0436361_1150595 3300039447 Bacteria 1644
531 Ga0436361_1170458 3300039447 Bacteria 14146
532 Ga0436363_0199441 3300039450 Bacteria 3442
533 Ga0436363_1076006 3300039450 Bacteria 4620
534 Ga0436362_0666097 3300039453 Bacteria 1104
535 Ga0436362_1262338 3300039453 Bacteria 2015
536 Ga0439431_0018837 3300041997 Bacteria 1637
537 Ga0439446_0112096 3300042156 Bacteria 871
538 Ga0439435_0070844 3300042436 Bacteria 1032
539 Ga0450893_0003697 3300042532 Bacteria 2419
540 Ga0451577_0276173 3300042876 Bacteria 1522
541 Ga0451577_0340420 3300042876 Bacteria 1360
542 Ga0451577_0509393 3300042876 Bacteria 1093
543 Ga0453684_0582146 3300044712 Bacteria 1229
544 Ga0466957_0024982 3300044842 Bacteria 3539
545 Ga0451576_0001697 3300045051 Bacteria 36405
546 Ga0451576_0580753 3300045051 Bacteria 1178
547 Ga0466967_0324809 3300045976 Bacteria 1485
548 Ga0466967_0649096 3300045976 Bacteria 1043
549 Ga0495592_0089761 3300046454 Bacteria 2206
550 Ga0495592_0176632 3300046454 Bacteria 1458
551 Ga0495603_0128503 3300046455 Bacteria 1476
552 Ga0495591_025637 3300046458 Bacteria 1846
553 Ga0495638_0000635 3300046460 Bacteria 38563
554 Ga0495638_0002699 3300046460 Bacteria 14280
555 Ga0495641_0044532 3300046461 Bacteria 2046
556 Ga0495653_0092015 3300046463 Bacteria 2215
557 Ga0495650_0033642 3300046471 Bacteria 2279
558 Ga0495580_0038311 3300046472 Bacteria 3434
559 Ga0495580_0347028 3300046472 Bacteria 1006
560 Ga0495605_0000862 3300046474 Bacteria 21029
561 Ga0495639_0013338 3300046475 Bacteria 3547
562 Ga0495662_0018435 3300046476 Bacteria 3378
563 Ga0495664_0024843 3300046477 Bacteria 3484
564 Ga0495585_0020821 3300046492 Bacteria 3769
565 Ga0495585_0042471 3300046492 Bacteria 2546
566 Ga0495607_0024538 3300046501 Bacteria 3758
567 Ga0495608_0025250 3300046511 Bacteria 4055
568 Ga0495610_0035969 3300046512 Bacteria 2536
569 Ga0495610_0066217 3300046512 Bacteria 1702
570 Ga0495628_0016038 3300046516 Bacteria 6251
571 Ga0495630_0025383 3300046517 Bacteria 4381
572 Ga0495631_0079937 3300046518 Bacteria 1411
573 Ga0495644_0040755 3300046523 Bacteria 1750
574 Ga0495666_0014543 3300046526 Bacteria 3919
575 Ga0495642_0061605 3300046528 Bacteria 1557
576 Ga0495652_0085979 3300046529 Bacteria 2583
577 Ga0495640_0021018 3300046533 Bacteria 4797
578 Ga0495586_0099910 3300046535 Bacteria 1609
579 Ga0495586_0316325 3300046535 Bacteria 895
580 Ga0495587_0013952 3300046536 Bacteria 5045
581 Ga0495598_0031141 3300046537 Bacteria 1499
582 Ga0495609_0118166 3300046538 Bacteria 1141
583 Ga0495633_0110249 3300046558 Bacteria 1276
584 Ga0495667_0038220 3300046559 Bacteria 3196
585 Ga0495667_0079428 3300046559 Bacteria 2133
586 Ga0495668_0056547 3300046616 Bacteria 2165
587 Ga0495634_0016612 3300046642 Bacteria 5260
588 Ga0495635_0063453 3300046663 Bacteria 2537
589 Ga0495635_0089090 3300046663 Bacteria 2111
590 Ga0495661_0077924 3300046665 Bacteria 1919
591 Ga0495661_0113524 3300046665 Bacteria 1507
592 Ga0495657_0004212 3300046675 Bacteria 11512
593 Ga0495599_0005873 3300046678 Bacteria 7373
594 Ga0495599_0047278 3300046678 Bacteria 2697
595 Ga0495647_0012203 3300046681 Bacteria 2956
596 Ga0495658_0045710 3300046683 Bacteria 2458
597 Ga0495658_0070327 3300046683 Bacteria 2030
598 Ga0495669_0001975 3300046684 Bacteria 8418
599 Ga0495670_0001012 3300046691 Bacteria 13669
600 Ga0495589_0000736 3300046794 Bacteria 21110
601 Ga0495600_0037442 3300046809 Bacteria 3153
602 Ga0495600_0052340 3300046809 Bacteria 2666
603 Ga0495680_0109312 3300047322 Bacteria 2050
604 Ga0495675_0003519 3300047444 Bacteria 9440
605 Ga0495679_049887 3300047446 Bacteria 1261
606 Ga0496100_0051897 3300048903 Bacteria 2664
607 Ga0496102_0028584 3300048905 Bacteria 4981
608 Ga0496102_0203346 3300048905 Bacteria 1867
609 Ga0496103_0005688 3300048906 Bacteria 7450
610 Ga0496103_0152077 3300048906 Bacteria 1482
611 Ga0496104_0005443 3300048907 Bacteria 11145
612 Ga0496104_0174928 3300048907 Bacteria 2057
613 Ga0496106_0047743 3300048909 Bacteria 3223
614 Ga0496107_0013654 3300048910 Bacteria 5678
615 Ga0496108_0011478 3300048911 Bacteria 7201
616 Ga0496109_0561951 3300048912 Bacteria 1076
617 Ga0496110_0015076 3300048913 Bacteria 6427
618 Ga0496110_0209542 3300048913 Bacteria 1772
619 Ga0496111_0022762 3300048914 Bacteria 4391
620 Ga0496113_0448431 3300048916 Bacteria 1037
621 Ga0496113_0460851 3300048916 Bacteria 1021
622 Ga0496114_0257357 3300048917 Bacteria 1536
623 Ga0496119_0052118 3300048922 Bacteria 2509
624 Ga0496119_0104002 3300048922 Bacteria 1589
625 Ga0496120_0045785 3300048923 Bacteria 2532
626 Ga0496121_0053116 3300048924 Bacteria 3396
627 Ga0496121_0193569 3300048924 Bacteria 1456
628 Ga0496126_0113234 3300048929 Bacteria 2362
629 Ga0501031_0119705 3300049568 Bacteria 1720
630 Ga0501032_0199530 3300049569 Bacteria 1306
631 Ga0501032_0250360 3300049569 Bacteria 1150
632 Ga0501033_0224465 3300049570 Bacteria 1336
633 Ga0501034_0002928 3300049571 Bacteria 19795
634 Ga0501034_0044434 3300049571 Bacteria 4494
635 Ga0501034_0411371 3300049571 Bacteria 1275
636 Ga0501034_0656926 3300049571 Bacteria 950
637 Ga0501036_0088895 3300049572 Bacteria 2610
638 Ga0501036_0093961 3300049572 Bacteria 2534
639 Ga0501036_0123251 3300049572 Bacteria 2189
640 Ga0501036_0421246 3300049572 Bacteria 1113
641 Ga0501037_0032710 3300049573 Bacteria 3842
642 Ga0501037_0089750 3300049573 Bacteria 2224
643 Ga0501037_0107131 3300049573 Bacteria 2014
644 Ga0501037_0160141 3300049573 Bacteria 1605
645 Ga0501037_0190844 3300049573 Bacteria 1451
646 Ga0501038_0043380 3300049574 Bacteria 3911
647 Ga0501038_0077112 3300049574 Bacteria 2814
648 Ga0501038_0233394 3300049574 Bacteria 1463
649 Ga0501039_0002641 3300049575 Bacteria 13393
650 Ga0501039_0014487 3300049575 Bacteria 6037
651 Ga0501039_0069442 3300049575 Bacteria 2736
652 Ga0501039_0262018 3300049575 Bacteria 1359
653 Ga0501040_0015316 3300049576 Bacteria 5070
654 Ga0501040_0020278 3300049576 Bacteria 4430
655 Ga0501040_0315472 3300049576 Bacteria 1118
656 Ga0501041_0002700 3300049577 Bacteria 10122
657 Ga0501041_0005228 3300049577 Bacteria 7580
658 Ga0501041_0014311 3300049577 Bacteria 4709
659 Ga0501041_0024556 3300049577 Bacteria 3619
660 Ga0501042_0010930 3300049578 Bacteria 6112
661 Ga0501042_0048508 3300049578 Bacteria 3028
662 Ga0501042_0095921 3300049578 Bacteria 2131
663 Ga0501043_0028245 3300049579 Bacteria 4403
664 Ga0501043_0187052 3300049579 Bacteria 1612
665 Ga0501043_0496979 3300049579 Bacteria 912
666 Ga0501046_0023006 3300049580 Bacteria 5131
667 Ga0501046_0083389 3300049580 Bacteria 2468
668 Ga0501046_0111591 3300049580 Bacteria 2088
669 Ga0501046_0374667 3300049580 Bacteria 1031
670 Ga0501047_0051548 3300049581 Bacteria 3977
671 Ga0501047_0167250 3300049581 Bacteria 2069
672 Ga0501047_0367260 3300049581 Bacteria 1274
673 Ga0501048_0006462 3300049582 Bacteria 8910
674 Ga0501048_0083437 3300049582 Bacteria 2253
675 Ga0501048_0210730 3300049582 Bacteria 1378
676 Ga0501067_0035467 3300049583 Bacteria 2769
677 Ga0501068_0188600 3300049584 Bacteria 1305
678 Ga0501069_0121219 3300049585 Bacteria 1494
679 Ga0501070_0000033 3300049586 Bacteria 128626
680 Ga0501070_0127126 3300049586 Bacteria 2106
681 Ga0501070_0172523 3300049586 Bacteria 1781
682 Ga0501070_0407750 3300049586 Bacteria 1099
683 Ga0501071_0003718 3300049587 Bacteria 9582
684 Ga0501071_0021107 3300049587 Bacteria 4535
685 Ga0501071_0047761 3300049587 Bacteria 3075
686 Ga0501072_0003456 3300049588 Bacteria 11901
687 Ga0501072_0030407 3300049588 Bacteria 4223
688 Ga0501072_0043434 3300049588 Bacteria 3532
689 Ga0501072_0060051 3300049588 Bacteria 2998
690 Ga0501073_0039675 3300049589 Bacteria 3334
691 Ga0501073_0048482 3300049589 Bacteria 2981
692 Ga0501073_0286798 3300049589 Bacteria 1136
693 Ga0501073_0362019 3300049589 Bacteria 1002
694 Ga0501073_0484753 3300049589 Bacteria 855
695 Ga0501074_0039505 3300049590 Bacteria 3418
696 Ga0501075_0009891 3300049591 Bacteria 6683
697 Ga0501075_0053365 3300049591 Bacteria 3040
698 Ga0501075_0187531 3300049591 Bacteria 1577
699 Ga0501076_0006358 3300049592 Bacteria 8565
700 Ga0501076_0008071 3300049592 Bacteria 7693
701 Ga0501076_0018226 3300049592 Bacteria 5348
702 Ga0501076_0035381 3300049592 Bacteria 3908
703 Ga0501077_0008361 3300049593 Bacteria 6407
704 Ga0501077_0034366 3300049593 Bacteria 3227
705 Ga0501077_0090319 3300049593 Bacteria 1941
706 Ga0501077_0235766 3300049593 Bacteria 1163
707 Ga0501079_0006027 3300049741 Bacteria 9082
708 Ga0501079_0007033 3300049741 Bacteria 8489
709 Ga0501079_0011467 3300049741 Bacteria 6766
710 Ga0501080_0003821 3300049742 Bacteria 13311
711 Ga0501080_0054137 3300049742 Bacteria 3737
712 Ga0501080_0124520 3300049742 Bacteria 2387
713 Ga0501080_0192262 3300049742 Bacteria 1875
714 Ga0501080_0274094 3300049742 Bacteria 1535
715 Ga0501080_0283212 3300049742 Bacteria 1506
716 Ga0501080_0351802 3300049742 Bacteria 1330
717 Ga0501081_0014806 3300049743 Bacteria 5148
718 Ga0501081_0124456 3300049743 Bacteria 1838
719 Ga0501081_0429550 3300049743 Bacteria 980
720 Ga0501081_0447094 3300049743 Bacteria 960
721 Ga0501083_0160261 3300049744 Bacteria 1472
722 Ga0501035_0009931 3300049822 Bacteria 8838
723 Ga0501035_0041274 3300049822 Bacteria 4167
724 Ga0501035_0066532 3300049822 Bacteria 3198
725 Ga0501035_0551476 3300049822 Bacteria 944
726 Ga0501044_0000140 3300049823 Bacteria 88672
727 Ga0501044_0006810 3300049823 Bacteria 12593
728 Ga0501044_0105892 3300049823 Bacteria 2825
729 Ga0501044_0107643 3300049823 Bacteria 2799
730 Ga0501044_0109780 3300049823 Bacteria 2767
731 Ga0501044_0165715 3300049823 Bacteria 2184
732 Ga0501044_0231248 3300049823 Bacteria 1796
733 Ga0501045_0006104 3300049824 Bacteria 8344
734 Ga0501045_0011319 3300049824 Bacteria 6263
735 Ga0501045_0049915 3300049824 Bacteria 3052
736 nmdc:mga03683_28684_c1 3300050489 Bacteria 2215
737 nmdc:mga03683_9105_c1 3300050489 Bacteria 3517
738 nmdc:mga03n38_41205_c1 3300050490 Bacteria 2011
739 nmdc:mga0yw44_19567_c1 3300050492 Bacteria 3736
740 nmdc:mga0yw44_28226_c1 3300050492 Bacteria 3226
741 nmdc:mga0yw44_3416_c1 3300050492 Bacteria 7051
742 nmdc:mga0k408_17471_c2 3300050493 Bacteria 3132
743 nmdc:mga0k408_31758_c1 3300050493 Bacteria 3017
744 nmdc:mga06z11_110122_c1 3300050494 Bacteria 1524
745 nmdc:mga06z11_122457_c1 3300050494 Bacteria 1452
746 nmdc:mga04h51_30041_c1 3300050495 Bacteria 1707
747 nmdc:mga07m45_21233_c1 3300050496 Bacteria 2919
748 nmdc:mga07m45_47426_c1 3300050496 Bacteria 2415
749 nmdc:mga05p37_133005_c1 3300050507 Bacteria 3051
750 nmdc:mga08y16_14765_c1 3300050511 Bacteria 8212
751 nmdc:mga08y16_183864_c1 3300050511 Bacteria 2169
752 nmdc:mga08y16_199913_c1 3300050511 Bacteria 2071
753 nmdc:mga08y16_34_c1 3300050511 Bacteria 164092
754 nmdc:mga08x19_190523_c1 3300050514 Bacteria 1403
755 nmdc:mga0sz30_43099_c1 3300050516 Bacteria 1899
756 nmdc:mga0sz30_7389_c1 3300050516 Bacteria 4117
757 Ga0495601_0023238 3300053077 Bacteria 3809
758 Ga0495601_0062388 3300053077 Bacteria 2367
759 Ga0495601_0176906 3300053077 Bacteria 1395
760 Ga0495595_0024502 3300053084 Bacteria 2666
761 Ga0495595_0032645 3300053084 Bacteria 2345
762 Ga0495619_0006383 3300053085 Bacteria 7472
763 Ga0495619_0017391 3300053085 Bacteria 4552
764 Ga0500643_000055 3300053087 Bacteria 134904
765 Ga0500646_0001193 3300053090 Bacteria 6985
766 Ga0500646_0053058 3300053090 Bacteria 1175
767 Ga0500583_0021676 3300053092 Bacteria 2677
768 Ga0500651_0145463 3300053093 Bacteria 1426
769 Ga0500566_0000041 3300053094 Bacteria 65580
770 Ga0500640_046848 3300053095 Bacteria 1895
771 Ga0500641_0002772 3300053096 Bacteria 6198
772 Ga0500641_0051903 3300053096 Bacteria 1689
773 Ga0500650_0225184 3300053098 Bacteria 847
774 Ga0500555_002542 3300053103 Bacteria 5261
775 Ga0500557_000017 3300053105 Bacteria 96699
776 Ga0500569_001055 3300053109 Bacteria 5013
777 Ga0500572_044574 3300053111 Bacteria 1300
778 Ga0500594_0012816 3300053118 Bacteria 1984
779 Ga0500607_011787 3300053121 Bacteria 5158
780 Ga0500642_0000256 3300053130 Bacteria 19927
781 Ga0500642_0042877 3300053130 Bacteria 1963
782 Ga0500642_0078554 3300053130 Bacteria 1512
783 Ga0500652_058621 3300053131 Bacteria 1582
784 Ga0500655_003517 3300053133 Bacteria 2830
785 Ga0500655_024347 3300053133 Bacteria 1146
786 Ga0500559_0004313 3300053136 Bacteria 6791
787 Ga0500564_093418 3300053138 Bacteria 1337
788 Ga0500589_049178 3300053147 Bacteria 1959
789 Ga0500604_0004311 3300053151 Bacteria 3776
790 Ga0500616_0000757 3300053153 Bacteria 37213
791 Ga0500620_016705 3300053155 Bacteria 2103
792 Ga0500638_184640 3300053162 Bacteria 896
793 Ga0500636_0000389 3300053177 Bacteria 24251
794 Ga0500637_0046381 3300053178 Bacteria 2467
795 Ga0500625_037436 3300053729 Bacteria 2293
796 Ga0500645_074449 3300053730 Bacteria 973
797 Ga0500599_000235 3300053736 Bacteria 5232
798 Ga0500601_000091 3300053737 Bacteria 18928
799 Ga0501084_0064778 3300054114 Bacteria 3058
800 Ga0501084_0087470 3300054114 Bacteria 2616
801 Ga0501084_0091008 3300054114 Bacteria 2561
802 Ga0501084_0155953 3300054114 Bacteria 1925
803 Ga0501084_0167359 3300054114 Bacteria 1855
804 Ga0501082_0014435 3300060353 Bacteria 6798
805 Ga0501082_0041695 3300060353 Bacteria 3957
806 Ga0501082_0045391 3300060353 Bacteria 3790
807 Ga0501082_0095123 3300060353 Bacteria 2574
808 Ga0530510_0007292 3300061734 Bacteria 7693
809 Ga0530510_0008880 3300061734 Bacteria 7035
810 Ga0530510_0066403 3300061734 Bacteria 2615
811 Ga0530510_0189350 3300061734 Bacteria 1527

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035083 Ga0373926_0035404 Ga0373926_0035404_525_1322 256
2 3300035111 Ga0373923_0076139 Ga0373923_0076139_408_1205 256
3 3300035117 Ga0373953_0002942 Ga0373953_0002942_3759_4556 256
4 3300035120 Ga0373957_0026824 Ga0373957_0026824_814_1611 256
5 3300035171 Ga0373946_0020214 Ga0373946_0020214_1504_2301 256
6 3300035172 Ga0373955_0025284 Ga0373955_0025284_1944_2741 256
7 3300035724 Ga0373933_0038465 Ga0373933_0038465_1843_2640 256
8 3300036401 Ga0373937_0037501 Ga0373937_0037501_1688_2485 256
9 3300037068 Ga0373925_0008070 Ga0373925_0008070_3577_4374 256
10 3300037853 Ga0436364_0749911 Ga0436364_0749911_645_1436 256
11 3300046454 Ga0495592_0089761 Ga0495592_0089761_572_1369 256
12 3300046461 Ga0495641_0044532 Ga0495641_0044532_1119_1916 256
13 3300046463 Ga0495653_0092015 Ga0495653_0092015_200_997 256
14 3300046475 Ga0495639_0013338 Ga0495639_0013338_2168_2965 256
15 3300046476 Ga0495662_0018435 Ga0495662_0018435_1218_2015 256
16 3300046477 Ga0495664_0024843 Ga0495664_0024843_2208_3005 256
17 3300046511 Ga0495608_0025250 Ga0495608_0025250_307_1104 256
18 3300046516 Ga0495628_0016038 Ga0495628_0016038_2019_2816 256
19 3300046517 Ga0495630_0025383 Ga0495630_0025383_573_1370 256
20 3300046526 Ga0495666_0014543 Ga0495666_0014543_2010_2807 256
21 3300046529 Ga0495652_0085979 Ga0495652_0085979_1321_2118 256
22 3300046533 Ga0495640_0021018 Ga0495640_0021018_1049_1846 256
23 3300046535 Ga0495586_0099910 Ga0495586_0099910_650_1447 256
24 3300046536 Ga0495587_0013952 Ga0495587_0013952_3704_4501 256
25 3300046642 Ga0495634_0016612 Ga0495634_0016612_2111_2908 256
26 3300046663 Ga0495635_0063453 Ga0495635_0063453_1434_2231 256
27 3300046675 Ga0495657_0004212 Ga0495657_0004212_3430_4227 256
28 3300046678 Ga0495599_0005873 Ga0495599_0005873_840_1637 256
29 3300046681 Ga0495647_0012203 Ga0495647_0012203_318_1115 256
30 3300046683 Ga0495658_0070327 Ga0495658_0070327_521_1318 256
31 3300046809 Ga0495600_0037442 Ga0495600_0037442_747_1544 256
32 3300047322 Ga0495680_0109312 Ga0495680_0109312_163_960 256
33 3300047444 Ga0495675_0003519 Ga0495675_0003519_1680_2477 256
34 3300049575 Ga0501039_0262018 Ga0501039_0262018_176_970 256
35 3300053077 Ga0495601_0062388 Ga0495601_0062388_916_1713 256
36 3300053085 Ga0495619_0006383 Ga0495619_0006383_4021_4818 256
37 3300049592 Ga0501076_0035381 Ga0501076_0035381_1740_2534 257
38 iso_pu_bacteria 2897803580 2897805617 257
39 3300046665 Ga0495661_0113524 Ga0495661_0113524_16_807 258
40 iso_pu_bacteria 2883291878 2883294178 258
41 3300050516 nmdc:mga0sz30_43099_c1 nmdc:mga0sz30_43099_c1_240_1022 260
42 3300053090 Ga0500646_0001193 Ga0500646_0001193_5631_6413 260
43 3300053133 Ga0500655_003517 Ga0500655_003517_322_1104 260
44 3300053151 Ga0500604_0004311 Ga0500604_0004311_1729_2511 260
45 iso_pu_bacteria 2507262055 2507511211 260
46 iso_pu_bacteria 2508501009 2508545020 260
47 iso_pu_bacteria 2906626472 2906630756 260
48 iso_pu_bacteria 2906643746 2906645993 260
49 iso_pu_bacteria 2932828146 2932836161 260
50 iso_pu_bacteria 2935608549 2935612559 260
51 iso_pu_bacteria 2935616580 2935616905 260
52 iso_pu_bacteria 2935638405 2935641770 260
53 iso_pu_bacteria 2935665750 2935671639 260
54 iso_pu_bacteria 2935703347 2935705539 260
55 iso_pu_bacteria 2935801545 2935802522 260
56 iso_pu_bacteria 2935819856 2935824048 260
57 iso_pu_bacteria 2935827899 2935829937 260
58 iso_pu_bacteria 2935837841 2935837847 260
59 iso_pu_bacteria 2935847175 2935852805 260
60 iso_pu_bacteria 2935855204 2935855529 260
61 iso_pu_bacteria 2935864058 2935867226 260
62 iso_pu_bacteria 2935873716 2935875954 260
63 iso_pu_bacteria 2935908558 2935912044 260
64 iso_pu_bacteria 2935916978 2935922255 260
65 iso_pu_bacteria 2935926038 2935929073 260
66 iso_pu_bacteria 2935934488 2935935704 260
67 iso_pu_bacteria 2935942939 2935947270 260
68 iso_pu_bacteria 2935951376 2935953636 260
69 iso_pu_bacteria 2935959822 2935961811 260
70 iso_pu_bacteria 2935967501 2935968662 260
71 iso_pu_bacteria 2935992306 2935996623 260
72 iso_pu_bacteria 2936002035 2936003896 260
73 iso_pu_bacteria 2941538514 2941539487 260
74 iso_pu_bacteria 3005506211 3005507932 260
75 iso_pu_bacteria 8016583857 8016588874 260
76 iso_pu_bacteria 8017057580 8017063972 260
77 iso_pu_bacteria 8019687851 8019694332 260
78 3300025912 Ga0207707_10417354 Ga0207707_104173542 261
79 3300025921 Ga0207652_10081935 Ga0207652_100819352 261
80 iso_pu_bacteria 2821443989 2821449621 261
81 iso_pu_bacteria 2844533157 2844538776 261
82 3300005327 Ga0070658_10175458 Ga0070658_101754582 262
83 3300005441 Ga0070700_100071135 Ga0070700_1000711352 262
84 3300005617 Ga0068859_100008372 Ga0068859_10000837210 262
85 3300006931 Ga0097620_100008372 Ga0097620_10000837210 262
86 3300009094 Ga0111539_10055725 Ga0111539_100557252 262
87 3300009094 Ga0111539_10687992 Ga0111539_106879922 262
88 3300009147 Ga0114129_10204573 Ga0114129_102045732 262
89 3300026075 Ga0207708_10095815 Ga0207708_100958152 262
90 3300031250 Ga0265331_10015988 Ga0265331_100159885 262
91 3300031595 Ga0265313_10019402 Ga0265313_100194025 262
92 3300036401 Ga0373937_0647004 Ga0373937_0647004_134_922 262
93 3300042876 Ga0451577_0340420 Ga0451577_0340420_309_1097 262
94 3300049571 Ga0501034_0044434 Ga0501034_0044434_1815_2603 262
95 3300049572 Ga0501036_0123251 Ga0501036_0123251_1091_1879 262
96 3300049579 Ga0501043_0028245 Ga0501043_0028245_1388_2176 262
97 3300049580 Ga0501046_0374667 Ga0501046_0374667_30_818 262
98 3300049823 Ga0501044_0107643 Ga0501044_0107643_714_1502 262
99 3300050507 nmdc:mga05p37_133005_c1 nmdc:mga05p37_133005_c1_1865_2653 262
100 3300050511 nmdc:mga08y16_14765_c1 nmdc:mga08y16_14765_c1_761_1552 262
101 iso_pu_bacteria 2874590934 2874597951 262
102 iso_pu_bacteria 2876771140 2876776551 262
103 iso_pu_bacteria 2876818435 2876824859 262
104 iso_pu_bacteria 2879074833 2879081586 262
105 3300005334 Ga0068869_100598493 Ga0068869_1005984931 263
106 3300005336 Ga0070680_100042488 Ga0070680_1000424883 263
107 3300005353 Ga0070669_100333787 Ga0070669_1003337872 263
108 3300005354 Ga0070675_100042464 Ga0070675_1000424642 263
109 3300005365 Ga0070688_100160284 Ga0070688_1001602842 263
110 3300005367 Ga0070667_100681990 Ga0070667_1006819901 263
111 3300005436 Ga0070713_100158783 Ga0070713_1001587831 263
112 3300005458 Ga0070681_10116369 Ga0070681_101163692 263
113 3300005471 Ga0070698_100083208 Ga0070698_1000832082 263
114 3300005530 Ga0070679_100017188 Ga0070679_1000171882 263
115 3300005536 Ga0070697_100020296 Ga0070697_1000202968 263
116 3300005841 Ga0068863_100136353 Ga0068863_1001363532 263
117 3300005842 Ga0068858_100359363 Ga0068858_1003593632 263
118 3300005843 Ga0068860_100750349 Ga0068860_1007503491 263
119 3300005981 Ga0081538_10016756 Ga0081538_100167564 263
120 3300005981 Ga0081538_10121911 Ga0081538_101219112 263
121 3300005985 Ga0081539_10132688 Ga0081539_101326882 263
122 3300006028 Ga0070717_10228163 Ga0070717_102281632 263
123 3300006028 Ga0070717_10519149 Ga0070717_105191492 263
124 3300006186 Ga0075369_10038635 Ga0075369_100386352 263
125 3300006353 Ga0075370_10009458 Ga0075370_100094584 263
126 3300007788 Ga0099795_10052608 Ga0099795_100526082 263
127 3300009093 Ga0105240_10609131 Ga0105240_106091312 263
128 3300009093 Ga0105240_10696607 Ga0105240_106966071 263
129 3300009545 Ga0105237_10035864 Ga0105237_100358642 263
130 3300013307 Ga0157372_10253999 Ga0157372_102539992 263
131 3300014969 Ga0157376_10219194 Ga0157376_102191942 263
132 3300021388 Ga0213875_10008711 Ga0213875_100087114 263
133 3300021388 Ga0213875_10148721 Ga0213875_101487212 263
134 3300025254 Ga0209148_1000268 Ga0209148_100026840 263
135 3300025272 Ga0209455_1001518 Ga0209455_10015189 263
136 3300025913 Ga0207695_10332057 Ga0207695_103320571 263
137 3300025917 Ga0207660_10038214 Ga0207660_100382143 263
138 3300025922 Ga0207646_10031412 Ga0207646_100314122 263
139 3300025923 Ga0207681_10147730 Ga0207681_101477302 263
140 3300025925 Ga0207650_10151267 Ga0207650_101512672 263
141 3300025926 Ga0207659_10004576 Ga0207659_100045764 263
142 3300025928 Ga0207700_10028357 Ga0207700_100283574 263
143 3300025936 Ga0207670_10605820 Ga0207670_106058201 263
144 3300025939 Ga0207665_10153884 Ga0207665_101538842 263
145 3300025940 Ga0207691_10082777 Ga0207691_100827771 263
146 3300025942 Ga0207689_10230450 Ga0207689_102304502 263
147 3300025942 Ga0207689_10326940 Ga0207689_103269401 263
148 3300025986 Ga0207658_10583269 Ga0207658_105832691 263
149 3300026035 Ga0207703_10157254 Ga0207703_101572542 263
150 3300026088 Ga0207641_10229358 Ga0207641_102293581 263
151 3300026095 Ga0207676_10372504 Ga0207676_103725042 263
152 3300026142 Ga0207698_10110170 Ga0207698_101101702 263
153 3300028380 Ga0268265_10334580 Ga0268265_103345802 263
154 3300028381 Ga0268264_10263045 Ga0268264_102630452 263
155 3300028558 Ga0265326_10046553 Ga0265326_100465532 263
156 3300030521 Ga0307511_10018066 Ga0307511_100180667 263
157 3300031251 Ga0265327_10022910 Ga0265327_100229104 263
158 3300031665 Ga0316575_10029533 Ga0316575_100295331 263
159 3300035083 Ga0373926_0006701 Ga0373926_0006701_1723_2514 263
160 3300035083 Ga0373926_0083093 Ga0373926_0083093_378_1169 263
161 3300035241 Ga0373961_0000005 Ga0373961_0000005_106572_107366 263
162 3300035692 Ga0373935_0090574 Ga0373935_0090574_59_850 263
163 3300035692 Ga0373935_0147227 Ga0373935_0147227_106_897 263
164 3300035695 Ga0373927_0114880 Ga0373927_0114880_311_1102 263
165 3300035725 Ga0373947_0032416 Ga0373947_0032416_1743_2534 263
166 3300037068 Ga0373925_0038518 Ga0373925_0038518_2669_3460 263
167 3300037471 Ga0395905_0004055 Ga0395905_0004055_6918_7709 263
168 3300037853 Ga0436364_0891296 Ga0436364_0891296_936_1727 263
169 3300037853 Ga0436364_1360422 Ga0436364_1360422_13904_14695 263
170 3300039437 Ga0436365_0801734 Ga0436365_0801734_161_952 263
171 3300039447 Ga0436361_1170458 Ga0436361_1170458_12207_13001 263
172 3300039453 Ga0436362_1262338 Ga0436362_1262338_952_1743 263
173 3300042532 Ga0450893_0003697 Ga0450893_0003697_118_915 263
174 3300045051 Ga0451576_0580753 Ga0451576_0580753_133_939 263
175 3300046472 Ga0495580_0038311 Ga0495580_0038311_1642_2433 263
176 3300046535 Ga0495586_0316325 Ga0495586_0316325_40_831 263
177 3300046559 Ga0495667_0038220 Ga0495667_0038220_2388_3179 263
178 3300046663 Ga0495635_0089090 Ga0495635_0089090_1187_1978 263
179 3300046809 Ga0495600_0052340 Ga0495600_0052340_269_1060 263
180 3300048907 Ga0496104_0005443 Ga0496104_0005443_270_1082 263
181 3300048912 Ga0496109_0561951 Ga0496109_0561951_268_1059 263
182 3300048929 Ga0496126_0113234 Ga0496126_0113234_1175_1966 263
183 3300049569 Ga0501032_0250360 Ga0501032_0250360_142_933 263
184 3300049576 Ga0501040_0315472 Ga0501040_0315472_149_940 263
185 3300049589 Ga0501073_0286798 Ga0501073_0286798_294_1085 263
186 3300049823 Ga0501044_0000140 Ga0501044_0000140_26742_27539 263
187 3300050493 nmdc:mga0k408_17471_c2 nmdc:mga0k408_17471_c2_2094_2885 263
188 3300050494 nmdc:mga06z11_110122_c1 nmdc:mga06z11_110122_c1_406_1197 263
189 3300050496 nmdc:mga07m45_21233_c1 nmdc:mga07m45_21233_c1_352_1143 263
190 3300053077 Ga0495601_0023238 Ga0495601_0023238_2381_3172 263
191 3300053084 Ga0495595_0032645 Ga0495595_0032645_1493_2284 263
192 3300053085 Ga0495619_0017391 Ga0495619_0017391_1627_2418 263
193 3300053092 Ga0500583_0021676 Ga0500583_0021676_1481_2272 263
194 3300053130 Ga0500642_0078554 Ga0500642_0078554_589_1383 263
195 3300003792 Ga0055540_1006370 Ga0055540_10063703 264
196 3300003794 Ga0055531_10000205 Ga0055531_1000020520 264
197 3300005327 Ga0070658_10027472 Ga0070658_100274722 264
198 3300005327 Ga0070658_10202452 Ga0070658_102024522 264
199 3300005328 Ga0070676_10174605 Ga0070676_101746052 264
200 3300005328 Ga0070676_10195709 Ga0070676_101957092 264
201 3300005329 Ga0070683_100097755 Ga0070683_1000977552 264
202 3300005330 Ga0070690_100000993 Ga0070690_1000009933 264
203 3300005331 Ga0070670_100078478 Ga0070670_1000784782 264
204 3300005331 Ga0070670_100144274 Ga0070670_1001442742 264
205 3300005331 Ga0070670_100346042 Ga0070670_1003460422 264
206 3300005331 Ga0070670_100392517 Ga0070670_1003925171 264
207 3300005334 Ga0068869_100003070 Ga0068869_1000030706 264
208 3300005335 Ga0070666_10143370 Ga0070666_101433702 264
209 3300005336 Ga0070680_100002437 Ga0070680_1000024377 264
210 3300005336 Ga0070680_100004645 Ga0070680_1000046453 264
211 3300005336 Ga0070680_100095828 Ga0070680_1000958283 264
212 3300005336 Ga0070680_100119264 Ga0070680_1001192642 264
213 3300005336 Ga0070680_100202239 Ga0070680_1002022392 264
214 3300005336 Ga0070680_100285920 Ga0070680_1002859202 264
215 3300005338 Ga0068868_100157473 Ga0068868_1001574732 264
216 3300005338 Ga0068868_100523523 Ga0068868_1005235232 264
217 3300005339 Ga0070660_100025112 Ga0070660_1000251122 264
218 3300005340 Ga0070689_100001070 Ga0070689_1000010701 264
219 3300005340 Ga0070689_100162142 Ga0070689_1001621422 264
220 3300005341 Ga0070691_10000198 Ga0070691_1000019813 264
221 3300005341 Ga0070691_10004632 Ga0070691_100046323 264
222 3300005341 Ga0070691_10037021 Ga0070691_100370213 264
223 3300005343 Ga0070687_100013313 Ga0070687_1000133135 264
224 3300005343 Ga0070687_100035769 Ga0070687_1000357693 264
225 3300005344 Ga0070661_100041839 Ga0070661_1000418393 264
226 3300005345 Ga0070692_10037720 Ga0070692_100377202 264
227 3300005353 Ga0070669_100146442 Ga0070669_1001464422 264
228 3300005353 Ga0070669_100173512 Ga0070669_1001735121 264
229 3300005353 Ga0070669_100401929 Ga0070669_1004019292 264
230 3300005354 Ga0070675_100041829 Ga0070675_1000418295 264
231 3300005354 Ga0070675_100085634 Ga0070675_1000856343 264
232 3300005354 Ga0070675_100422423 Ga0070675_1004224232 264
233 3300005355 Ga0070671_100106902 Ga0070671_1001069024 264
234 3300005355 Ga0070671_100109547 Ga0070671_1001095472 264
235 3300005355 Ga0070671_100302212 Ga0070671_1003022123 264
236 3300005355 Ga0070671_100444094 Ga0070671_1004440942 264
237 3300005356 Ga0070674_100014481 Ga0070674_1000144813 264
238 3300005356 Ga0070674_100071836 Ga0070674_1000718362 264
239 3300005364 Ga0070673_100034415 Ga0070673_1000344152 264
240 3300005364 Ga0070673_100370303 Ga0070673_1003703032 264
241 3300005364 Ga0070673_100392474 Ga0070673_1003924742 264
242 3300005366 Ga0070659_100006542 Ga0070659_1000065424 264
243 3300005366 Ga0070659_100158175 Ga0070659_1001581752 264
244 3300005366 Ga0070659_100251560 Ga0070659_1002515601 264
245 3300005367 Ga0070667_100012504 Ga0070667_1000125042 264
246 3300005367 Ga0070667_100217006 Ga0070667_1002170062 264
247 3300005367 Ga0070667_100434216 Ga0070667_1004342162 264
248 3300005367 Ga0070667_100587091 Ga0070667_1005870911 264
249 3300005438 Ga0070701_10000075 Ga0070701_1000007516 264
250 3300005438 Ga0070701_10034226 Ga0070701_100342262 264
251 3300005439 Ga0070711_100275835 Ga0070711_1002758353 264
252 3300005440 Ga0070705_100036943 Ga0070705_1000369431 264
253 3300005441 Ga0070700_100002507 Ga0070700_1000025073 264
254 3300005441 Ga0070700_100057706 Ga0070700_1000577062 264
255 3300005444 Ga0070694_100008159 Ga0070694_1000081591 264
256 3300005445 Ga0070708_100046726 Ga0070708_1000467263 264
257 3300005456 Ga0070678_100060116 Ga0070678_1000601164 264
258 3300005457 Ga0070662_100051128 Ga0070662_1000511282 264
259 3300005457 Ga0070662_100063540 Ga0070662_1000635405 264
260 3300005458 Ga0070681_10002137 Ga0070681_1000213715 264
261 3300005458 Ga0070681_10002558 Ga0070681_100025582 264
262 3300005458 Ga0070681_10008342 Ga0070681_1000834215 264
263 3300005458 Ga0070681_10058698 Ga0070681_100586984 264
264 3300005458 Ga0070681_10074615 Ga0070681_100746152 264
265 3300005458 Ga0070681_10200092 Ga0070681_102000921 264
266 3300005458 Ga0070681_10569941 Ga0070681_105699412 264
267 3300005458 Ga0070681_10573808 Ga0070681_105738082 264
268 3300005459 Ga0068867_100000421 Ga0068867_1000004216 264
269 3300005459 Ga0068867_100051934 Ga0068867_1000519342 264
270 3300005459 Ga0068867_100222300 Ga0068867_1002223002 264
271 3300005467 Ga0070706_100238536 Ga0070706_1002385362 264
272 3300005468 Ga0070707_100383652 Ga0070707_1003836521 264
273 3300005471 Ga0070698_100003981 Ga0070698_1000039818 264
274 3300005471 Ga0070698_100054255 Ga0070698_1000542552 264
275 3300005471 Ga0070698_100303624 Ga0070698_1003036242 264
276 3300005471 Ga0070698_100841274 Ga0070698_1008412741 264
277 3300005518 Ga0070699_100284425 Ga0070699_1002844252 264
278 3300005530 Ga0070679_100003954 Ga0070679_10000395411 264
279 3300005530 Ga0070679_100004261 Ga0070679_1000042613 264
280 3300005530 Ga0070679_100064110 Ga0070679_1000641101 264
281 3300005530 Ga0070679_100102619 Ga0070679_1001026193 264
282 3300005530 Ga0070679_100137729 Ga0070679_1001377292 264
283 3300005530 Ga0070679_100264409 Ga0070679_1002644092 264
284 3300005535 Ga0070684_100042463 Ga0070684_1000424634 264
285 3300005535 Ga0070684_100505133 Ga0070684_1005051332 264
286 3300005536 Ga0070697_100251570 Ga0070697_1002515702 264
287 3300005539 Ga0068853_100001762 Ga0068853_1000017626 264
288 3300005543 Ga0070672_100065877 Ga0070672_1000658772 264
289 3300005543 Ga0070672_100333142 Ga0070672_1003331422 264
290 3300005544 Ga0070686_100000270 Ga0070686_10000027022 264
291 3300005545 Ga0070695_100056903 Ga0070695_1000569032 264
292 3300005545 Ga0070695_100446254 Ga0070695_1004462541 264
293 3300005546 Ga0070696_100003294 Ga0070696_1000032944 264
294 3300005546 Ga0070696_100233624 Ga0070696_1002336242 264
295 3300005547 Ga0070693_100001571 Ga0070693_1000015716 264
296 3300005548 Ga0070665_100002531 Ga0070665_10000253112 264
297 3300005548 Ga0070665_100157564 Ga0070665_1001575642 264
298 3300005548 Ga0070665_100549650 Ga0070665_1005496501 264
299 3300005549 Ga0070704_100066824 Ga0070704_1000668242 264
300 3300005549 Ga0070704_100114552 Ga0070704_1001145522 264
301 3300005563 Ga0068855_100005088 Ga0068855_10000508812 264
302 3300005563 Ga0068855_100022196 Ga0068855_1000221963 264
303 3300005563 Ga0068855_100121708 Ga0068855_1001217082 264
304 3300005563 Ga0068855_100340451 Ga0068855_1003404512 264
305 3300005563 Ga0068855_100758550 Ga0068855_1007585502 264
306 3300005563 Ga0068855_100768800 Ga0068855_1007688001 264
307 3300005564 Ga0070664_100033863 Ga0070664_1000338632 264
308 3300005577 Ga0068857_100006255 Ga0068857_1000062553 264
309 3300005577 Ga0068857_100012178 Ga0068857_1000121785 264
310 3300005577 Ga0068857_100118282 Ga0068857_1001182822 264
311 3300005577 Ga0068857_100227096 Ga0068857_1002270962 264
312 3300005578 Ga0068854_100026505 Ga0068854_1000265055 264
313 3300005578 Ga0068854_100135020 Ga0068854_1001350202 264
314 3300005578 Ga0068854_100136497 Ga0068854_1001364972 264
315 3300005615 Ga0070702_100000370 Ga0070702_1000003706 264
316 3300005615 Ga0070702_100046626 Ga0070702_1000466262 264
317 3300005615 Ga0070702_100085227 Ga0070702_1000852272 264
318 3300005616 Ga0068852_100009333 Ga0068852_1000093331 264
319 3300005616 Ga0068852_100194976 Ga0068852_1001949762 264
320 3300005617 Ga0068859_100016233 Ga0068859_1000162333 264
321 3300005617 Ga0068859_100226524 Ga0068859_1002265242 264
322 3300005617 Ga0068859_100281175 Ga0068859_1002811752 264
323 3300005617 Ga0068859_100355715 Ga0068859_1003557152 264
324 3300005617 Ga0068859_100534335 Ga0068859_1005343352 264
325 3300005617 Ga0068859_100750577 Ga0068859_1007505772 264
326 3300005618 Ga0068864_100109023 Ga0068864_1001090234 264
327 3300005718 Ga0068866_10000249 Ga0068866_100002498 264
328 3300005718 Ga0068866_10026604 Ga0068866_100266042 264
329 3300005719 Ga0068861_100005107 Ga0068861_1000051073 264
330 3300005719 Ga0068861_100459377 Ga0068861_1004593771 264
331 3300005834 Ga0068851_10028875 Ga0068851_100288754 264
332 3300005842 Ga0068858_100010505 Ga0068858_1000105057 264
333 3300005842 Ga0068858_100243912 Ga0068858_1002439122 264
334 3300005843 Ga0068860_100309804 Ga0068860_1003098041 264
335 3300005843 Ga0068860_100343963 Ga0068860_1003439631 264
336 3300005844 Ga0068862_100001761 Ga0068862_10000176117 264
337 3300005844 Ga0068862_100055175 Ga0068862_1000551752 264
338 3300005844 Ga0068862_100107662 Ga0068862_1001076622 264
339 3300005937 Ga0081455_10003323 Ga0081455_100033233 264
340 3300005937 Ga0081455_10006621 Ga0081455_100066213 264
341 3300005937 Ga0081455_10009487 Ga0081455_100094873 264
342 3300005937 Ga0081455_10400814 Ga0081455_104008141 264
343 3300005985 Ga0081539_10004821 Ga0081539_100048216 264
344 3300006028 Ga0070717_10015233 Ga0070717_100152332 264
345 3300006038 Ga0075365_10025403 Ga0075365_100254033 264
346 3300006038 Ga0075365_10039511 Ga0075365_100395112 264
347 3300006038 Ga0075365_10202862 Ga0075365_102028622 264
348 3300006048 Ga0075363_100053182 Ga0075363_1000531822 264
349 3300006173 Ga0070716_100164613 Ga0070716_1001646132 264
350 3300006175 Ga0070712_100004370 Ga0070712_1000043708 264
351 3300006175 Ga0070712_100007601 Ga0070712_1000076013 264
352 3300006177 Ga0075362_10003442 Ga0075362_100034426 264
353 3300006177 Ga0075362_10019652 Ga0075362_100196522 264
354 3300006177 Ga0075362_10067503 Ga0075362_100675031 264
355 3300006178 Ga0075367_10116215 Ga0075367_101162152 264
356 3300006186 Ga0075369_10006384 Ga0075369_100063843 264
357 3300006186 Ga0075369_10012486 Ga0075369_100124862 264
358 3300006195 Ga0075366_10059945 Ga0075366_100599452 264
359 3300006195 Ga0075366_10076888 Ga0075366_100768881 264
360 3300006237 Ga0097621_100001920 Ga0097621_1000019208 264
361 3300006237 Ga0097621_100192732 Ga0097621_1001927322 264
362 3300006237 Ga0097621_100221057 Ga0097621_1002210572 264
363 3300006353 Ga0075370_10101359 Ga0075370_101013591 264
364 3300006358 Ga0068871_100012239 Ga0068871_1000122396 264
365 3300006358 Ga0068871_100074754 Ga0068871_1000747542 264
366 3300006847 Ga0075431_100006873 Ga0075431_1000068734 264
367 3300006881 Ga0068865_100009147 Ga0068865_1000091472 264
368 3300006931 Ga0097620_100016233 Ga0097620_1000162333 264
369 3300006931 Ga0097620_100226515 Ga0097620_1002265152 264
370 3300006931 Ga0097620_100281175 Ga0097620_1002811752 264
371 3300006931 Ga0097620_100355724 Ga0097620_1003557241 264
372 3300006931 Ga0097620_100534359 Ga0097620_1005343591 264
373 3300006931 Ga0097620_100750554 Ga0097620_1007505542 264
374 3300009093 Ga0105240_10031426 Ga0105240_100314262 264
375 3300009093 Ga0105240_10075931 Ga0105240_100759313 264
376 3300009094 Ga0111539_10000450 Ga0111539_1000045043 264
377 3300009094 Ga0111539_10188308 Ga0111539_101883082 264
378 3300009098 Ga0105245_10001133 Ga0105245_1000113319 264
379 3300009148 Ga0105243_10000923 Ga0105243_1000092324 264
380 3300009148 Ga0105243_10130178 Ga0105243_101301783 264
381 3300009176 Ga0105242_10316141 Ga0105242_103161412 264
382 3300009177 Ga0105248_10031448 Ga0105248_100314483 264
383 3300009177 Ga0105248_10117808 Ga0105248_101178082 264
384 3300009177 Ga0105248_10182969 Ga0105248_101829692 264
385 3300009177 Ga0105248_10663696 Ga0105248_106636962 264
386 3300009545 Ga0105237_10017697 Ga0105237_100176974 264
387 3300009551 Ga0105238_10008348 Ga0105238_100083489 264
388 3300009551 Ga0105238_10063704 Ga0105238_100637042 264
389 3300010375 Ga0105239_10006145 Ga0105239_1000614510 264
390 3300013100 Ga0157373_10114880 Ga0157373_101148802 264
391 3300013102 Ga0157371_10198788 Ga0157371_101987882 264
392 3300013104 Ga0157370_10003797 Ga0157370_100037972 264
393 3300013104 Ga0157370_10005023 Ga0157370_100050233 264
394 3300013104 Ga0157370_10040954 Ga0157370_100409541 264
395 3300013104 Ga0157370_10200945 Ga0157370_102009452 264
396 3300013105 Ga0157369_10855325 Ga0157369_108553251 264
397 3300013296 Ga0157374_10102692 Ga0157374_101026922 264
398 3300013297 Ga0157378_10001174 Ga0157378_100011742 264
399 3300013297 Ga0157378_10016742 Ga0157378_100167428 264
400 3300013297 Ga0157378_10095994 Ga0157378_100959942 264
401 3300013297 Ga0157378_10684767 Ga0157378_106847671 264
402 3300013306 Ga0163162_10098077 Ga0163162_100980775 264
403 3300013307 Ga0157372_10031749 Ga0157372_100317495 264
404 3300013307 Ga0157372_10168950 Ga0157372_101689502 264
405 3300013307 Ga0157372_10181499 Ga0157372_101814993 264
406 3300013307 Ga0157372_10189287 Ga0157372_101892872 264
407 3300013308 Ga0157375_10039302 Ga0157375_100393022 264
408 3300013308 Ga0157375_10076567 Ga0157375_100765672 264
409 3300013308 Ga0157375_10077872 Ga0157375_100778722 264
410 3300013308 Ga0157375_10633727 Ga0157375_106337271 264
411 3300013308 Ga0157375_10689949 Ga0157375_106899491 264
412 3300014325 Ga0163163_10288025 Ga0163163_102880252 264
413 3300014326 Ga0157380_10402116 Ga0157380_104021162 264
414 3300014497 Ga0182008_10115008 Ga0182008_101150082 264
415 3300014968 Ga0157379_10223278 Ga0157379_102232783 264
416 3300014969 Ga0157376_10161777 Ga0157376_101617772 264
417 3300014969 Ga0157376_10335831 Ga0157376_103358313 264
418 3300017792 Ga0163161_10142354 Ga0163161_101423543 264
419 3300017792 Ga0163161_10193103 Ga0163161_101931032 264
420 3300020069 Ga0197907_10899973 Ga0197907_108999731 264
421 3300020070 Ga0206356_10239614 Ga0206356_102396143 264
422 3300020080 Ga0206350_10974906 Ga0206350_109749062 264
423 3300020082 Ga0206353_10048251 Ga0206353_100482512 264
424 3300020082 Ga0206353_10327856 Ga0206353_103278561 264
425 3300021361 Ga0213872_10028776 Ga0213872_100287762 264
426 3300021377 Ga0213874_10043831 Ga0213874_100438312 264
427 3300021384 Ga0213876_10001938 Ga0213876_100019388 264
428 3300021384 Ga0213876_10237830 Ga0213876_102378301 264
429 3300021441 Ga0213871_10002128 Ga0213871_100021284 264
430 3300021441 Ga0213871_10016836 Ga0213871_100168362 264
431 3300022467 Ga0224712_10046689 Ga0224712_100466891 264
432 3300022467 Ga0224712_10197279 Ga0224712_101972791 264
433 3300025273 Ga0209673_1050415 Ga0209673_10504152 264
434 3300025302 Ga0207426_1014765 Ga0207426_10147652 264
435 3300025303 Ga0209051_1000310 Ga0209051_100031057 264
436 3300025304 Ga0209257_1000165 Ga0209257_1000165138 264
437 3300025321 Ga0207656_10026144 Ga0207656_100261442 264
438 3300025893 Ga0207682_10002243 Ga0207682_100022434 264
439 3300025899 Ga0207642_10003143 Ga0207642_100031433 264
440 3300025903 Ga0207680_10019191 Ga0207680_100191912 264
441 3300025903 Ga0207680_10032431 Ga0207680_100324312 264
442 3300025903 Ga0207680_10052566 Ga0207680_100525664 264
443 3300025905 Ga0207685_10218323 Ga0207685_102183231 264
444 3300025906 Ga0207699_10053259 Ga0207699_100532592 264
445 3300025906 Ga0207699_10078691 Ga0207699_100786912 264
446 3300025906 Ga0207699_10080514 Ga0207699_100805142 264
447 3300025906 Ga0207699_10437270 Ga0207699_104372701 264
448 3300025909 Ga0207705_10000714 Ga0207705_1000071420 264
449 3300025909 Ga0207705_10003763 Ga0207705_100037633 264
450 3300025909 Ga0207705_10326461 Ga0207705_103264612 264
451 3300025910 Ga0207684_10149915 Ga0207684_101499153 264
452 3300025912 Ga0207707_10001526 Ga0207707_1000152624 264
453 3300025912 Ga0207707_10002213 Ga0207707_1000221313 264
454 3300025912 Ga0207707_10015649 Ga0207707_100156497 264
455 3300025912 Ga0207707_10016341 Ga0207707_100163413 264
456 3300025912 Ga0207707_10027081 Ga0207707_100270815 264
457 3300025912 Ga0207707_10049872 Ga0207707_100498724 264
458 3300025912 Ga0207707_10093743 Ga0207707_100937432 264
459 3300025912 Ga0207707_10573626 Ga0207707_105736262 264
460 3300025912 Ga0207707_10638402 Ga0207707_106384021 264
461 3300025913 Ga0207695_10014722 Ga0207695_100147224 264
462 3300025913 Ga0207695_10306311 Ga0207695_103063112 264
463 3300025915 Ga0207693_10003170 Ga0207693_1000317013 264
464 3300025915 Ga0207693_10019311 Ga0207693_100193116 264
465 3300025915 Ga0207693_10070608 Ga0207693_100706083 264
466 3300025917 Ga0207660_10001236 Ga0207660_1000123615 264
467 3300025917 Ga0207660_10007598 Ga0207660_100075982 264
468 3300025917 Ga0207660_10082014 Ga0207660_100820141 264
469 3300025917 Ga0207660_10096220 Ga0207660_100962202 264
470 3300025918 Ga0207662_10027376 Ga0207662_100273764 264
471 3300025919 Ga0207657_10000554 Ga0207657_1000055420 264
472 3300025919 Ga0207657_10152751 Ga0207657_101527512 264
473 3300025919 Ga0207657_10482859 Ga0207657_104828591 264
474 3300025921 Ga0207652_10002084 Ga0207652_100020843 264
475 3300025921 Ga0207652_10002621 Ga0207652_1000262113 264
476 3300025921 Ga0207652_10358883 Ga0207652_103588831 264
477 3300025921 Ga0207652_10471214 Ga0207652_104712141 264
478 3300025922 Ga0207646_10542279 Ga0207646_105422792 264
479 3300025923 Ga0207681_10296968 Ga0207681_102969682 264
480 3300025924 Ga0207694_10008861 Ga0207694_100088615 264
481 3300025924 Ga0207694_10043329 Ga0207694_100433292 264
482 3300025924 Ga0207694_10482601 Ga0207694_104826012 264
483 3300025925 Ga0207650_10054109 Ga0207650_100541092 264
484 3300025925 Ga0207650_10301960 Ga0207650_103019601 264
485 3300025925 Ga0207650_10458776 Ga0207650_104587761 264
486 3300025926 Ga0207659_10009302 Ga0207659_100093022 264
487 3300025926 Ga0207659_10039743 Ga0207659_100397432 264
488 3300025926 Ga0207659_10415904 Ga0207659_104159042 264
489 3300025927 Ga0207687_10001219 Ga0207687_100012193 264
490 3300025927 Ga0207687_10434099 Ga0207687_104340992 264
491 3300025927 Ga0207687_10560973 Ga0207687_105609732 264
492 3300025928 Ga0207700_10158135 Ga0207700_101581352 264
493 3300025928 Ga0207700_10727687 Ga0207700_107276871 264
494 3300025929 Ga0207664_10069875 Ga0207664_100698752 264
495 3300025931 Ga0207644_10059554 Ga0207644_100595541 264
496 3300025931 Ga0207644_10115785 Ga0207644_101157852 264
497 3300025931 Ga0207644_10325039 Ga0207644_103250392 264
498 3300025932 Ga0207690_10009385 Ga0207690_100093855 264
499 3300025932 Ga0207690_10072916 Ga0207690_100729162 264
500 3300025933 Ga0207706_10113911 Ga0207706_101139112 264
501 3300025934 Ga0207686_10137112 Ga0207686_101371122 264
502 3300025935 Ga0207709_10011909 Ga0207709_100119093 264
503 3300025937 Ga0207669_10153820 Ga0207669_101538202 264
504 3300025937 Ga0207669_10209518 Ga0207669_102095182 264
505 3300025938 Ga0207704_10001122 Ga0207704_100011228 264
506 3300025940 Ga0207691_10002172 Ga0207691_1000217218 264
507 3300025940 Ga0207691_10026903 Ga0207691_100269034 264
508 3300025941 Ga0207711_10131630 Ga0207711_101316302 264
509 3300025942 Ga0207689_10001864 Ga0207689_1000186416 264
510 3300025942 Ga0207689_10029957 Ga0207689_100299571 264
511 3300025944 Ga0207661_10557089 Ga0207661_105570892 264
512 3300025945 Ga0207679_10059987 Ga0207679_100599872 264
513 3300025949 Ga0207667_10014788 Ga0207667_100147883 264
514 3300025949 Ga0207667_10034440 Ga0207667_100344403 264
515 3300025949 Ga0207667_10106521 Ga0207667_101065212 264
516 3300025960 Ga0207651_10400543 Ga0207651_104005431 264
517 3300025972 Ga0207668_10243654 Ga0207668_102436542 264
518 3300025972 Ga0207668_10381495 Ga0207668_103814951 264
519 3300025981 Ga0207640_10051216 Ga0207640_100512162 264
520 3300025981 Ga0207640_10232307 Ga0207640_102323073 264
521 3300025981 Ga0207640_10333769 Ga0207640_103337692 264
522 3300025986 Ga0207658_10064281 Ga0207658_100642813 264
523 3300025986 Ga0207658_10317673 Ga0207658_103176732 264
524 3300026023 Ga0207677_10642135 Ga0207677_106421351 264
525 3300026035 Ga0207703_10026898 Ga0207703_100268982 264
526 3300026035 Ga0207703_10074623 Ga0207703_100746233 264
527 3300026035 Ga0207703_10136939 Ga0207703_101369392 264
528 3300026041 Ga0207639_10002688 Ga0207639_100026882 264
529 3300026041 Ga0207639_10370068 Ga0207639_103700682 264
530 3300026075 Ga0207708_10005526 Ga0207708_100055267 264
531 3300026075 Ga0207708_10007313 Ga0207708_100073135 264
532 3300026075 Ga0207708_10184778 Ga0207708_101847782 264
533 3300026078 Ga0207702_10090140 Ga0207702_100901402 264
534 3300026078 Ga0207702_10390982 Ga0207702_103909822 264
535 3300026089 Ga0207648_10030105 Ga0207648_100301057 264
536 3300026089 Ga0207648_10067938 Ga0207648_100679383 264
537 3300026095 Ga0207676_10145747 Ga0207676_101457472 264
538 3300026116 Ga0207674_10026028 Ga0207674_100260286 264
539 3300026116 Ga0207674_10027483 Ga0207674_100274836 264
540 3300026116 Ga0207674_10032578 Ga0207674_100325783 264
541 3300026116 Ga0207674_10136898 Ga0207674_101368982 264
542 3300026116 Ga0207674_10342544 Ga0207674_103425442 264
543 3300026118 Ga0207675_100000234 Ga0207675_10000023424 264
544 3300026118 Ga0207675_100043375 Ga0207675_1000433751 264
545 3300026121 Ga0207683_10000189 Ga0207683_100001892 264
546 3300026121 Ga0207683_10010770 Ga0207683_100107707 264
547 3300026121 Ga0207683_10446670 Ga0207683_104466702 264
548 3300026142 Ga0207698_10059368 Ga0207698_100593684 264
549 3300027360 Ga0209969_1000495 Ga0209969_10004952 264
550 3300027364 Ga0209967_1002629 Ga0209967_10026292 264
551 3300027424 Ga0209984_1014159 Ga0209984_10141591 264
552 3300027462 Ga0210000_1006363 Ga0210000_10063631 264
553 3300027471 Ga0209995_1002913 Ga0209995_10029132 264
554 3300027543 Ga0209999_1001275 Ga0209999_10012755 264
555 3300027614 Ga0209970_1015123 Ga0209970_10151232 264
556 3300027866 Ga0209813_10059801 Ga0209813_100598012 264
557 3300027876 Ga0209974_10002954 Ga0209974_100029542 264
558 3300027907 Ga0207428_10000169 Ga0207428_1000016914 264
559 3300027907 Ga0207428_10221092 Ga0207428_102210922 264
560 3300028379 Ga0268266_10103680 Ga0268266_101036803 264
561 3300028379 Ga0268266_10847951 Ga0268266_108479511 264
562 3300028380 Ga0268265_10359675 Ga0268265_103596752 264
563 3300028381 Ga0268264_10358454 Ga0268264_103584542 264
564 3300028381 Ga0268264_10423092 Ga0268264_104230922 264
565 3300028800 Ga0265338_10230119 Ga0265338_102301192 264
566 3300028800 Ga0265338_10255007 Ga0265338_102550071 264
567 3300031235 Ga0265330_10035395 Ga0265330_100353952 264
568 3300031238 Ga0265332_10008217 Ga0265332_100082172 264
569 3300031238 Ga0265332_10065391 Ga0265332_100653912 264
570 3300031239 Ga0265328_10003968 Ga0265328_100039682 264
571 3300031242 Ga0265329_10022657 Ga0265329_100226572 264
572 3300031247 Ga0265340_10095182 Ga0265340_100951822 264
573 3300031250 Ga0265331_10005807 Ga0265331_100058078 264
574 3300031344 Ga0265316_10235168 Ga0265316_102351681 264
575 3300031548 Ga0307408_100074379 Ga0307408_1000743792 264
576 3300031711 Ga0265314_10001600 Ga0265314_1000160016 264
577 3300031712 Ga0265342_10037861 Ga0265342_100378612 264
578 3300031995 Ga0307409_100472922 Ga0307409_1004729222 264
579 3300032002 Ga0307416_100161965 Ga0307416_1001619653 264
580 3300032002 Ga0307416_100224851 Ga0307416_1002248512 264
581 3300032004 Ga0307414_10107183 Ga0307414_101071832 264
582 3300032005 Ga0307411_10266792 Ga0307411_102667921 264
583 3300033180 Ga0307510_10005450 Ga0307510_100054504 264
584 3300035111 Ga0373923_0028341 Ga0373923_0028341_865_1659 264
585 3300035112 Ga0373932_0062101 Ga0373932_0062101_160_957 264
586 3300035112 Ga0373932_0119650 Ga0373932_0119650_38_832 264
587 3300035118 Ga0373954_0005019 Ga0373954_0005019_1168_1962 264
588 3300035410 Ga0373924_0067809 Ga0373924_0067809_68_862 264
589 3300035691 Ga0373931_0210651 Ga0373931_0210651_282_1079 264
590 3300035695 Ga0373927_0090614 Ga0373927_0090614_608_1405 264
591 3300035695 Ga0373927_0092990 Ga0373927_0092990_977_1771 264
592 3300035724 Ga0373933_0010069 Ga0373933_0010069_4245_5039 264
593 3300035724 Ga0373933_0175211 Ga0373933_0175211_132_929 264
594 3300036401 Ga0373937_0036511 Ga0373937_0036511_1762_2556 264
595 3300036401 Ga0373937_0049639 Ga0373937_0049639_1604_2398 264
596 3300036401 Ga0373937_0057104 Ga0373937_0057104_839_1633 264
597 3300036401 Ga0373937_0129683 Ga0373937_0129683_506_1303 264
598 3300036401 Ga0373937_0377201 Ga0373937_0377201_487_1299 264
599 3300036647 Ga0316582_0265613 Ga0316582_0265613_341_1135 264
600 3300037312 Ga0395899_0026633 Ga0395899_0026633_3080_3874 264
601 3300037312 Ga0395899_0266641 Ga0395899_0266641_341_1138 264
602 3300037418 Ga0395900_0001993 Ga0395900_0001993_131_928 264
603 3300037418 Ga0395900_0013646 Ga0395900_0013646_66_860 264
604 3300037418 Ga0395900_0431173 Ga0395900_0431173_350_1147 264
605 3300037418 Ga0395900_0638852 Ga0395900_0638852_142_936 264
606 3300037466 Ga0395898_0003319 Ga0395898_0003319_6581_7375 264
607 3300037466 Ga0395898_0047599 Ga0395898_0047599_3225_4022 264
608 3300037471 Ga0395905_0000043 Ga0395905_0000043_46233_47039 264
609 3300038443 Ga0395901_0024450 Ga0395901_0024450_4412_5209 264
610 3300038443 Ga0395901_0231803 Ga0395901_0231803_685_1482 264
611 3300038443 Ga0395901_0381012 Ga0395901_0381012_305_1102 264
612 3300039062 Ga0400483_220694 Ga0400483_220694_5340_6134 264
613 3300039437 Ga0436365_0065739 Ga0436365_0065739_10330_11133 264
614 3300039437 Ga0436365_0202658 Ga0436365_0202658_302_1096 264
615 3300039437 Ga0436365_1116753 Ga0436365_1116753_106_900 264
616 3300039438 Ga0436360_0375286 Ga0436360_0375286_74_925 264
617 3300039438 Ga0436360_0401373 Ga0436360_0401373_4011_4805 264
618 3300039438 Ga0436360_0569429 Ga0436360_0569429_125_919 264
619 3300039438 Ga0436360_0675016 Ga0436360_0675016_564_1358 264
620 3300039438 Ga0436360_0696399 Ga0436360_0696399_14467_15264 264
621 3300039438 Ga0436360_0734197 Ga0436360_0734197_199_993 264
622 3300039438 Ga0436360_0871428 Ga0436360_0871428_1504_2298 264
623 3300039438 Ga0436360_1220716 Ga0436360_1220716_951_1745 264
624 3300039447 Ga0436361_0320193 Ga0436361_0320193_4735_5529 264
625 3300039447 Ga0436361_0446953 Ga0436361_0446953_2186_2980 264
626 3300039447 Ga0436361_0522153 Ga0436361_0522153_2842_3639 264
627 3300039447 Ga0436361_1150595 Ga0436361_1150595_654_1451 264
628 3300039450 Ga0436363_0199441 Ga0436363_0199441_843_1640 264
629 3300039450 Ga0436363_1076006 Ga0436363_1076006_1029_1823 264
630 3300039453 Ga0436362_0666097 Ga0436362_0666097_269_1063 264
631 3300042156 Ga0439446_0112096 Ga0439446_0112096_15_827 264
632 3300042436 Ga0439435_0070844 Ga0439435_0070844_201_1004 264
633 3300042876 Ga0451577_0276173 Ga0451577_0276173_26_820 264
634 3300042876 Ga0451577_0509393 Ga0451577_0509393_94_894 264
635 3300044712 Ga0453684_0582146 Ga0453684_0582146_345_1139 264
636 3300044842 Ga0466957_0024982 Ga0466957_0024982_858_1655 264
637 3300045051 Ga0451576_0001697 Ga0451576_0001697_8680_9474 264
638 3300045976 Ga0466967_0324809 Ga0466967_0324809_477_1271 264
639 3300045976 Ga0466967_0649096 Ga0466967_0649096_32_826 264
640 3300046454 Ga0495592_0176632 Ga0495592_0176632_400_1194 264
641 3300046455 Ga0495603_0128503 Ga0495603_0128503_101_910 264
642 3300046458 Ga0495591_025637 Ga0495591_025637_18_821 264
643 3300046460 Ga0495638_0000635 Ga0495638_0000635_14836_15645 264
644 3300046460 Ga0495638_0002699 Ga0495638_0002699_5338_6135 264
645 3300046471 Ga0495650_0033642 Ga0495650_0033642_370_1179 264
646 3300046472 Ga0495580_0347028 Ga0495580_0347028_40_834 264
647 3300046474 Ga0495605_0000862 Ga0495605_0000862_10737_11546 264
648 3300046492 Ga0495585_0020821 Ga0495585_0020821_406_1218 264
649 3300046492 Ga0495585_0042471 Ga0495585_0042471_450_1259 264
650 3300046501 Ga0495607_0024538 Ga0495607_0024538_1193_2002 264
651 3300046512 Ga0495610_0066217 Ga0495610_0066217_826_1623 264
652 3300046518 Ga0495631_0079937 Ga0495631_0079937_471_1280 264
653 3300046523 Ga0495644_0040755 Ga0495644_0040755_625_1434 264
654 3300046528 Ga0495642_0061605 Ga0495642_0061605_547_1350 264
655 3300046537 Ga0495598_0031141 Ga0495598_0031141_225_1028 264
656 3300046538 Ga0495609_0118166 Ga0495609_0118166_197_994 264
657 3300046558 Ga0495633_0110249 Ga0495633_0110249_438_1241 264
658 3300046559 Ga0495667_0079428 Ga0495667_0079428_300_1094 264
659 3300046616 Ga0495668_0056547 Ga0495668_0056547_1051_1848 264
660 3300046665 Ga0495661_0077924 Ga0495661_0077924_680_1477 264
661 3300046678 Ga0495599_0047278 Ga0495599_0047278_519_1316 264
662 3300046683 Ga0495658_0045710 Ga0495658_0045710_1046_1849 264
663 3300046684 Ga0495669_0001975 Ga0495669_0001975_332_1141 264
664 3300046691 Ga0495670_0001012 Ga0495670_0001012_11055_11864 264
665 3300046794 Ga0495589_0000736 Ga0495589_0000736_4780_5589 264
666 3300047446 Ga0495679_049887 Ga0495679_049887_422_1231 264
667 3300048903 Ga0496100_0051897 Ga0496100_0051897_1045_1854 264
668 3300048905 Ga0496102_0028584 Ga0496102_0028584_2045_2854 264
669 3300048905 Ga0496102_0203346 Ga0496102_0203346_990_1802 264
670 3300048906 Ga0496103_0005688 Ga0496103_0005688_6224_7021 264
671 3300048906 Ga0496103_0152077 Ga0496103_0152077_374_1183 264
672 3300048907 Ga0496104_0174928 Ga0496104_0174928_845_1654 264
673 3300048909 Ga0496106_0047743 Ga0496106_0047743_298_1107 264
674 3300048910 Ga0496107_0013654 Ga0496107_0013654_2343_3152 264
675 3300048911 Ga0496108_0011478 Ga0496108_0011478_5334_6143 264
676 3300048913 Ga0496110_0015076 Ga0496110_0015076_2299_3108 264
677 3300048913 Ga0496110_0209542 Ga0496110_0209542_359_1162 264
678 3300048914 Ga0496111_0022762 Ga0496111_0022762_3153_3962 264
679 3300048916 Ga0496113_0448431 Ga0496113_0448431_68_865 264
680 3300048916 Ga0496113_0460851 Ga0496113_0460851_64_873 264
681 3300048917 Ga0496114_0257357 Ga0496114_0257357_485_1312 264
682 3300048922 Ga0496119_0052118 Ga0496119_0052118_902_1699 264
683 3300048922 Ga0496119_0104002 Ga0496119_0104002_366_1163 264
684 3300048923 Ga0496120_0045785 Ga0496120_0045785_37_834 264
685 3300048924 Ga0496121_0053116 Ga0496121_0053116_1017_1814 264
686 3300049568 Ga0501031_0119705 Ga0501031_0119705_573_1370 264
687 3300049569 Ga0501032_0199530 Ga0501032_0199530_362_1159 264
688 3300049570 Ga0501033_0224465 Ga0501033_0224465_398_1192 264
689 3300049571 Ga0501034_0002928 Ga0501034_0002928_16376_17173 264
690 3300049571 Ga0501034_0411371 Ga0501034_0411371_284_1084 264
691 3300049571 Ga0501034_0656926 Ga0501034_0656926_54_851 264
692 3300049572 Ga0501036_0088895 Ga0501036_0088895_197_994 264
693 3300049572 Ga0501036_0093961 Ga0501036_0093961_1543_2346 264
694 3300049572 Ga0501036_0421246 Ga0501036_0421246_140_955 264
695 3300049573 Ga0501037_0032710 Ga0501037_0032710_1814_2629 264
696 3300049573 Ga0501037_0089750 Ga0501037_0089750_489_1292 264
697 3300049573 Ga0501037_0107131 Ga0501037_0107131_508_1314 264
698 3300049573 Ga0501037_0160141 Ga0501037_0160141_315_1112 264
699 3300049573 Ga0501037_0190844 Ga0501037_0190844_489_1286 264
700 3300049574 Ga0501038_0043380 Ga0501038_0043380_789_1604 264
701 3300049574 Ga0501038_0077112 Ga0501038_0077112_31_846 264
702 3300049574 Ga0501038_0233394 Ga0501038_0233394_53_850 264
703 3300049575 Ga0501039_0002641 Ga0501039_0002641_11442_12248 264
704 3300049575 Ga0501039_0014487 Ga0501039_0014487_4076_4873 264
705 3300049575 Ga0501039_0069442 Ga0501039_0069442_1245_2042 264
706 3300049576 Ga0501040_0015316 Ga0501040_0015316_1002_1799 264
707 3300049576 Ga0501040_0020278 Ga0501040_0020278_3289_4086 264
708 3300049577 Ga0501041_0002700 Ga0501041_0002700_5515_6312 264
709 3300049577 Ga0501041_0005228 Ga0501041_0005228_6327_7130 264
710 3300049577 Ga0501041_0014311 Ga0501041_0014311_1513_2319 264
711 3300049577 Ga0501041_0024556 Ga0501041_0024556_1510_2307 264
712 3300049578 Ga0501042_0010930 Ga0501042_0010930_439_1236 264
713 3300049578 Ga0501042_0048508 Ga0501042_0048508_1350_2153 264
714 3300049578 Ga0501042_0095921 Ga0501042_0095921_608_1402 264
715 3300049579 Ga0501043_0187052 Ga0501043_0187052_478_1275 264
716 3300049579 Ga0501043_0496979 Ga0501043_0496979_17_814 264
717 3300049580 Ga0501046_0023006 Ga0501046_0023006_1260_2063 264
718 3300049580 Ga0501046_0083389 Ga0501046_0083389_1360_2166 264
719 3300049580 Ga0501046_0111591 Ga0501046_0111591_1222_2019 264
720 3300049581 Ga0501047_0051548 Ga0501047_0051548_1335_2135 264
721 3300049581 Ga0501047_0167250 Ga0501047_0167250_289_1104 264
722 3300049581 Ga0501047_0367260 Ga0501047_0367260_313_1110 264
723 3300049582 Ga0501048_0006462 Ga0501048_0006462_1471_2268 264
724 3300049582 Ga0501048_0083437 Ga0501048_0083437_1141_1938 264
725 3300049582 Ga0501048_0210730 Ga0501048_0210730_42_845 264
726 3300049583 Ga0501067_0035467 Ga0501067_0035467_100_900 264
727 3300049584 Ga0501068_0188600 Ga0501068_0188600_102_899 264
728 3300049585 Ga0501069_0121219 Ga0501069_0121219_321_1118 264
729 3300049586 Ga0501070_0000033 Ga0501070_0000033_477_1292 264
730 3300049586 Ga0501070_0127126 Ga0501070_0127126_1281_2078 264
731 3300049586 Ga0501070_0172523 Ga0501070_0172523_168_965 264
732 3300049587 Ga0501071_0003718 Ga0501071_0003718_4004_4807 264
733 3300049587 Ga0501071_0021107 Ga0501071_0021107_3158_3955 264
734 3300049587 Ga0501071_0047761 Ga0501071_0047761_1464_2261 264
735 3300049588 Ga0501072_0003456 Ga0501072_0003456_9319_10119 264
736 3300049588 Ga0501072_0030407 Ga0501072_0030407_932_1729 264
737 3300049588 Ga0501072_0043434 Ga0501072_0043434_121_924 264
738 3300049588 Ga0501072_0060051 Ga0501072_0060051_1568_2365 264
739 3300049589 Ga0501073_0039675 Ga0501073_0039675_584_1384 264
740 3300049589 Ga0501073_0048482 Ga0501073_0048482_246_1055 264
741 3300049589 Ga0501073_0362019 Ga0501073_0362019_137_934 264
742 3300049589 Ga0501073_0484753 Ga0501073_0484753_43_840 264
743 3300049590 Ga0501074_0039505 Ga0501074_0039505_968_1768 264
744 3300049591 Ga0501075_0009891 Ga0501075_0009891_1150_1953 264
745 3300049591 Ga0501075_0053365 Ga0501075_0053365_2048_2845 264
746 3300049591 Ga0501075_0187531 Ga0501075_0187531_290_1087 264
747 3300049592 Ga0501076_0006358 Ga0501076_0006358_1332_2129 264
748 3300049592 Ga0501076_0008071 Ga0501076_0008071_853_1650 264
749 3300049592 Ga0501076_0018226 Ga0501076_0018226_730_1533 264
750 3300049593 Ga0501077_0008361 Ga0501077_0008361_284_1087 264
751 3300049593 Ga0501077_0034366 Ga0501077_0034366_2340_3134 264
752 3300049593 Ga0501077_0090319 Ga0501077_0090319_296_1093 264
753 3300049593 Ga0501077_0235766 Ga0501077_0235766_297_1094 264
754 3300049741 Ga0501079_0006027 Ga0501079_0006027_2539_3345 264
755 3300049741 Ga0501079_0007033 Ga0501079_0007033_4077_4880 264
756 3300049741 Ga0501079_0011467 Ga0501079_0011467_2859_3656 264
757 3300049742 Ga0501080_0003821 Ga0501080_0003821_8543_9358 264
758 3300049742 Ga0501080_0054137 Ga0501080_0054137_2682_3491 264
759 3300049742 Ga0501080_0124520 Ga0501080_0124520_297_1097 264
760 3300049742 Ga0501080_0192262 Ga0501080_0192262_914_1720 264
761 3300049742 Ga0501080_0274094 Ga0501080_0274094_527_1324 264
762 3300049742 Ga0501080_0283212 Ga0501080_0283212_189_992 264
763 3300049742 Ga0501080_0351802 Ga0501080_0351802_356_1153 264
764 3300049743 Ga0501081_0014806 Ga0501081_0014806_3158_3955 264
765 3300049743 Ga0501081_0124456 Ga0501081_0124456_596_1393 264
766 3300049743 Ga0501081_0429550 Ga0501081_0429550_81_884 264
767 3300049743 Ga0501081_0447094 Ga0501081_0447094_127_924 264
768 3300049744 Ga0501083_0160261 Ga0501083_0160261_23_820 264
769 3300049822 Ga0501035_0009931 Ga0501035_0009931_3756_4571 264
770 3300049822 Ga0501035_0041274 Ga0501035_0041274_1765_2571 264
771 3300049822 Ga0501035_0066532 Ga0501035_0066532_1490_2287 264
772 3300049822 Ga0501035_0551476 Ga0501035_0551476_70_885 264
773 3300049823 Ga0501044_0006810 Ga0501044_0006810_4415_5230 264
774 3300049823 Ga0501044_0105892 Ga0501044_0105892_1236_2030 264
775 3300049823 Ga0501044_0109780 Ga0501044_0109780_535_1350 264
776 3300049823 Ga0501044_0165715 Ga0501044_0165715_864_1661 264
777 3300049823 Ga0501044_0231248 Ga0501044_0231248_434_1249 264
778 3300049824 Ga0501045_0006104 Ga0501045_0006104_4714_5511 264
779 3300049824 Ga0501045_0011319 Ga0501045_0011319_4212_5009 264
780 3300049824 Ga0501045_0049915 Ga0501045_0049915_1929_2732 264
781 3300050489 nmdc:mga03683_28684_c1 nmdc:mga03683_28684_c1_910_1707 264
782 3300050489 nmdc:mga03683_9105_c1 nmdc:mga03683_9105_c1_2068_2865 264
783 3300050490 nmdc:mga03n38_41205_c1 nmdc:mga03n38_41205_c1_1014_1811 264
784 3300050492 nmdc:mga0yw44_19567_c1 nmdc:mga0yw44_19567_c1_1118_1915 264
785 3300050492 nmdc:mga0yw44_28226_c1 nmdc:mga0yw44_28226_c1_383_1180 264
786 3300050492 nmdc:mga0yw44_3416_c1 nmdc:mga0yw44_3416_c1_3250_4047 264
787 3300050493 nmdc:mga0k408_31758_c1 nmdc:mga0k408_31758_c1_1054_1851 264
788 3300050494 nmdc:mga06z11_122457_c1 nmdc:mga06z11_122457_c1_116_913 264
789 3300050495 nmdc:mga04h51_30041_c1 nmdc:mga04h51_30041_c1_407_1204 264
790 3300050496 nmdc:mga07m45_47426_c1 nmdc:mga07m45_47426_c1_866_1663 264
791 3300050511 nmdc:mga08y16_183864_c1 nmdc:mga08y16_183864_c1_1285_2088 264
792 3300050511 nmdc:mga08y16_199913_c1 nmdc:mga08y16_199913_c1_402_1211 264
793 3300050511 nmdc:mga08y16_34_c1 nmdc:mga08y16_34_c1_10394_11188 264
794 3300050514 nmdc:mga08x19_190523_c1 nmdc:mga08x19_190523_c1_384_1181 264
795 3300050516 nmdc:mga0sz30_7389_c1 nmdc:mga0sz30_7389_c1_2028_2825 264
796 3300053077 Ga0495601_0176906 Ga0495601_0176906_202_999 264
797 3300053084 Ga0495595_0024502 Ga0495595_0024502_1329_2123 264
798 3300053087 Ga0500643_000055 Ga0500643_000055_100957_101754 264
799 3300053090 Ga0500646_0053058 Ga0500646_0053058_136_933 264
800 3300053093 Ga0500651_0145463 Ga0500651_0145463_413_1210 264
801 3300053094 Ga0500566_0000041 Ga0500566_0000041_61139_61936 264
802 3300053095 Ga0500640_046848 Ga0500640_046848_1055_1852 264
803 3300053096 Ga0500641_0002772 Ga0500641_0002772_3203_4000 264
804 3300053096 Ga0500641_0051903 Ga0500641_0051903_567_1364 264
805 3300053098 Ga0500650_0225184 Ga0500650_0225184_17_814 264
806 3300053103 Ga0500555_002542 Ga0500555_002542_566_1363 264
807 3300053105 Ga0500557_000017 Ga0500557_000017_22376_23173 264
808 3300053109 Ga0500569_001055 Ga0500569_001055_12_809 264
809 3300053111 Ga0500572_044574 Ga0500572_044574_40_837 264
810 3300053118 Ga0500594_0012816 Ga0500594_0012816_427_1224 264
811 3300053121 Ga0500607_011787 Ga0500607_011787_1231_2028 264
812 3300053130 Ga0500642_0000256 Ga0500642_0000256_16213_17010 264
813 3300053130 Ga0500642_0042877 Ga0500642_0042877_501_1298 264
814 3300053131 Ga0500652_058621 Ga0500652_058621_112_909 264
815 3300053133 Ga0500655_024347 Ga0500655_024347_338_1135 264
816 3300053136 Ga0500559_0004313 Ga0500559_0004313_3788_4585 264
817 3300053138 Ga0500564_093418 Ga0500564_093418_420_1217 264
818 3300053147 Ga0500589_049178 Ga0500589_049178_899_1696 264
819 3300053153 Ga0500616_0000757 Ga0500616_0000757_3391_4188 264
820 3300053155 Ga0500620_016705 Ga0500620_016705_383_1180 264
821 3300053162 Ga0500638_184640 Ga0500638_184640_49_846 264
822 3300053177 Ga0500636_0000389 Ga0500636_0000389_5996_6793 264
823 3300053178 Ga0500637_0046381 Ga0500637_0046381_264_1061 264
824 3300053729 Ga0500625_037436 Ga0500625_037436_1342_2139 264
825 3300053730 Ga0500645_074449 Ga0500645_074449_12_809 264
826 3300053736 Ga0500599_000235 Ga0500599_000235_2593_3390 264
827 3300053737 Ga0500601_000091 Ga0500601_000091_3576_4373 264
828 3300054114 Ga0501084_0064778 Ga0501084_0064778_327_1130 264
829 3300054114 Ga0501084_0087470 Ga0501084_0087470_1586_2386 264
830 3300054114 Ga0501084_0091008 Ga0501084_0091008_394_1188 264
831 3300054114 Ga0501084_0155953 Ga0501084_0155953_160_957 264
832 3300054114 Ga0501084_0167359 Ga0501084_0167359_572_1369 264
833 3300060353 Ga0501082_0014435 Ga0501082_0014435_4799_5605 264
834 3300060353 Ga0501082_0041695 Ga0501082_0041695_1175_1972 264
835 3300060353 Ga0501082_0045391 Ga0501082_0045391_2574_3368 264
836 3300060353 Ga0501082_0095123 Ga0501082_0095123_1040_1837 264
837 3300061734 Ga0530510_0007292 Ga0530510_0007292_487_1284 264
838 3300061734 Ga0530510_0008880 Ga0530510_0008880_394_1188 264
839 3300061734 Ga0530510_0066403 Ga0530510_0066403_129_926 264
840 3300061734 Ga0530510_0189350 Ga0530510_0189350_168_971 264
841 3300003187 JGI25151J46595_10000581 JGI25151J46595_1000058126 265
842 3300003215 JGI25153J46596_10038973 JGI25153J46596_100389731 265
843 3300003354 JGI25160J50197_1012997 JGI25160J50197_10129972 265
844 3300025284 Ga0209130_1000502 Ga0209130_10005029 265
845 3300025284 Ga0209130_1010355 Ga0209130_10103552 265
846 3300025294 Ga0209025_1000077 Ga0209025_1000077122 265
847 3300025302 Ga0207426_1000576 Ga0207426_100057642 265
848 3300026041 Ga0207639_10534975 Ga0207639_105349752 265
849 3300041997 Ga0439431_0018837 Ga0439431_0018837_215_1012 265
850 3300046512 Ga0495610_0035969 Ga0495610_0035969_1119_1916 265
851 3300048924 Ga0496121_0193569 Ga0496121_0193569_358_1155 265
852 3300049586 Ga0501070_0407750 Ga0501070_0407750_58_858 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

2

168

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.903 3 264
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9021 4 264
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.8952 4 264
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.8937 1 264
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.89 3 264
ID Description Score Start End Superfamily
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9475 68 166 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9463 57 166 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9434 56 168 3.30.465.10
1ffuF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9389 4 51 3.30.43.10
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9375 1 53 3.30.43.10
ID Description Score Start End GO Terms
AF-A0A431NS82-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.987 1 265 GO:0016491
GO:0071949
AF-A0A1H8YRK0-F1-model_v4 Carbon-monoxide dehydrogenase medium subunit 0.9839 168 265
AF-A0A537V8Z3-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9838 1 265 GO:0016491
GO:0071949
AF-A0A6L7YY57-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9837 1 231 GO:0016491
GO:0071949
AF-A0A6G6YVB9-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9833 1 262 GO:0016491
GO:0071949

Feature Viewer

pLDDT pTM Quality
95.43 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map