F483500
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 852 | 440 | 811 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300025912|Ga0207707_10015649|Ga0207707_100156497 |
| Length | 319 |
| Sequence | MYNFNYHQAKNVDEAAKLVTGAEEGKLMAGGMTLIPTLKQRLAKPSDIVDLGKIADLKGIKKDGNAIVIGAMTRHFDVANSDVVKSAIPALAYLASHIGDPAVRNRGTMGGSVANNDPAADYPSAVLALNATVITNKRKIAADDFFKGMFETALEDGEIITSFSYPIPEKAAYMKFPNPASRYAIVGVFVAKTGGNIRVAVTGAGPVVFRQKDMEAALAKSFTADAIKSIAQKQDGLNSDIHASAEYRAHLVGRDGAARRGGRRRLTFGQSFLRGKGALAAPFFLHRAGVYAAPRNRLVPPAKGGHPLALIRIWGERRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 4 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 5 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 6 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 7 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 8 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 9 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 10 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 11 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 12 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 13 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 14 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 15 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 16 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 17 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 18 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 19 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 20 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 21 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 22 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 23 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 24 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 25 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 26 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 27 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 28 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 29 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 30 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 31 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 32 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 33 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 34 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 35 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 36 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 37 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 38 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 39 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 42 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 109 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 113 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 114 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 117 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 118 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 119 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 157 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 158 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 159 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 160 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 161 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 238 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 240 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 243 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 244 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 245 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 247 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 248 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 249 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 251 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 255 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 256 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 257 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 258 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 259 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 264 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 268 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 271 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 273 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 275 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 277 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 278 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 281 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 282 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 285 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 286 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 287 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 288 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 289 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 290 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 291 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 292 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 293 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 296 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 297 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 347 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 348 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 351 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 352 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 355 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 356 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 357 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 358 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 395 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 397 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 406 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 407 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 408 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 409 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 411 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 412 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 413 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 414 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 415 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 416 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 419 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 420 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 421 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 422 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 423 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 425 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 426 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 427 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 428 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 429 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 431 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 432 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 434 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 435 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 438 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 439 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 440 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.37 |
| Metatranscriptomes | 0.82 |
| Isolates | 4.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.51 |
| Nodule | 3.99 |
| Rhizoplane | 2 |
| Rhizosphere | 81.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000581 | 3300003187 | Bacteria | 32575 |
| 2 | JGI25153J46596_10038973 | 3300003215 | Bacteria | 1490 |
| 3 | JGI25160J50197_1012997 | 3300003354 | Bacteria | 2858 |
| 4 | Ga0055540_1006370 | 3300003792 | Bacteria | 4699 |
| 5 | Ga0055531_10000205 | 3300003794 | Bacteria | 65042 |
| 6 | Ga0070658_10027472 | 3300005327 | Bacteria | 4566 |
| 7 | Ga0070658_10175458 | 3300005327 | Bacteria | 1802 |
| 8 | Ga0070658_10202452 | 3300005327 | Bacteria | 1675 |
| 9 | Ga0070676_10174605 | 3300005328 | Bacteria | 1393 |
| 10 | Ga0070676_10195709 | 3300005328 | Bacteria | 1322 |
| 11 | Ga0070683_100097755 | 3300005329 | Bacteria | 2762 |
| 12 | Ga0070690_100000993 | 3300005330 | Bacteria | 14445 |
| 13 | Ga0070670_100078478 | 3300005331 | Bacteria | 2836 |
| 14 | Ga0070670_100144274 | 3300005331 | Bacteria | 2059 |
| 15 | Ga0070670_100346042 | 3300005331 | Bacteria | 1305 |
| 16 | Ga0070670_100392517 | 3300005331 | Bacteria | 1224 |
| 17 | Ga0068869_100003070 | 3300005334 | Bacteria | 10160 |
| 18 | Ga0068869_100598493 | 3300005334 | Bacteria | 931 |
| 19 | Ga0070666_10143370 | 3300005335 | Bacteria | 1664 |
| 20 | Ga0070680_100002437 | 3300005336 | Bacteria | 13786 |
| 21 | Ga0070680_100004645 | 3300005336 | Bacteria | 10326 |
| 22 | Ga0070680_100042488 | 3300005336 | Bacteria | 3689 |
| 23 | Ga0070680_100095828 | 3300005336 | Bacteria | 2460 |
| 24 | Ga0070680_100119264 | 3300005336 | Bacteria | 2201 |
| 25 | Ga0070680_100202239 | 3300005336 | Bacteria | 1675 |
| 26 | Ga0070680_100285920 | 3300005336 | Bacteria | 1397 |
| 27 | Ga0068868_100157473 | 3300005338 | Bacteria | 1874 |
| 28 | Ga0068868_100523523 | 3300005338 | Bacteria | 1041 |
| 29 | Ga0070660_100025112 | 3300005339 | Bacteria | 4427 |
| 30 | Ga0070689_100001070 | 3300005340 | Bacteria | 17145 |
| 31 | Ga0070689_100162142 | 3300005340 | Bacteria | 1808 |
| 32 | Ga0070691_10000198 | 3300005341 | Bacteria | 20173 |
| 33 | Ga0070691_10004632 | 3300005341 | Bacteria | 6253 |
| 34 | Ga0070691_10037021 | 3300005341 | Bacteria | 2301 |
| 35 | Ga0070687_100013313 | 3300005343 | Bacteria | 3662 |
| 36 | Ga0070687_100035769 | 3300005343 | Bacteria | 2469 |
| 37 | Ga0070661_100041839 | 3300005344 | Bacteria | 3344 |
| 38 | Ga0070692_10037720 | 3300005345 | Bacteria | 2459 |
| 39 | Ga0070669_100146442 | 3300005353 | Bacteria | 1825 |
| 40 | Ga0070669_100173512 | 3300005353 | Bacteria | 1682 |
| 41 | Ga0070669_100333787 | 3300005353 | Bacteria | 1227 |
| 42 | Ga0070669_100401929 | 3300005353 | Bacteria | 1121 |
| 43 | Ga0070675_100041829 | 3300005354 | Bacteria | 3743 |
| 44 | Ga0070675_100042464 | 3300005354 | Bacteria | 3715 |
| 45 | Ga0070675_100085634 | 3300005354 | Bacteria | 2633 |
| 46 | Ga0070675_100422423 | 3300005354 | Bacteria | 1192 |
| 47 | Ga0070671_100106902 | 3300005355 | Bacteria | 2349 |
| 48 | Ga0070671_100109547 | 3300005355 | Bacteria | 2319 |
| 49 | Ga0070671_100302212 | 3300005355 | Bacteria | 1363 |
| 50 | Ga0070671_100444094 | 3300005355 | Bacteria | 1112 |
| 51 | Ga0070674_100014481 | 3300005356 | Bacteria | 4903 |
| 52 | Ga0070674_100071836 | 3300005356 | Bacteria | 2449 |
| 53 | Ga0070673_100034415 | 3300005364 | Bacteria | 3834 |
| 54 | Ga0070673_100370303 | 3300005364 | Bacteria | 1275 |
| 55 | Ga0070673_100392474 | 3300005364 | Bacteria | 1239 |
| 56 | Ga0070688_100160284 | 3300005365 | Bacteria | 1545 |
| 57 | Ga0070659_100006542 | 3300005366 | Bacteria | 8416 |
| 58 | Ga0070659_100158175 | 3300005366 | Bacteria | 1852 |
| 59 | Ga0070659_100251560 | 3300005366 | Bacteria | 1464 |
| 60 | Ga0070667_100012504 | 3300005367 | Bacteria | 7021 |
| 61 | Ga0070667_100217006 | 3300005367 | Bacteria | 1702 |
| 62 | Ga0070667_100434216 | 3300005367 | Bacteria | 1198 |
| 63 | Ga0070667_100587091 | 3300005367 | Bacteria | 1026 |
| 64 | Ga0070667_100681990 | 3300005367 | Bacteria | 950 |
| 65 | Ga0070713_100158783 | 3300005436 | Bacteria | 2017 |
| 66 | Ga0070701_10000075 | 3300005438 | Bacteria | 27473 |
| 67 | Ga0070701_10034226 | 3300005438 | Bacteria | 2544 |
| 68 | Ga0070711_100275835 | 3300005439 | Bacteria | 1328 |
| 69 | Ga0070705_100036943 | 3300005440 | Bacteria | 2751 |
| 70 | Ga0070700_100002507 | 3300005441 | Bacteria | 9355 |
| 71 | Ga0070700_100057706 | 3300005441 | Bacteria | 2436 |
| 72 | Ga0070700_100071135 | 3300005441 | Bacteria | 2220 |
| 73 | Ga0070694_100008159 | 3300005444 | Bacteria | 6394 |
| 74 | Ga0070708_100046726 | 3300005445 | Bacteria | 3820 |
| 75 | Ga0070678_100060116 | 3300005456 | Bacteria | 2796 |
| 76 | Ga0070662_100051128 | 3300005457 | Bacteria | 2983 |
| 77 | Ga0070662_100063540 | 3300005457 | Bacteria | 2701 |
| 78 | Ga0070681_10002137 | 3300005458 | Bacteria | 17962 |
| 79 | Ga0070681_10002558 | 3300005458 | Bacteria | 16700 |
| 80 | Ga0070681_10008342 | 3300005458 | Bacteria | 10148 |
| 81 | Ga0070681_10058698 | 3300005458 | Bacteria | 3827 |
| 82 | Ga0070681_10074615 | 3300005458 | Bacteria | 3353 |
| 83 | Ga0070681_10116369 | 3300005458 | Bacteria | 2610 |
| 84 | Ga0070681_10200092 | 3300005458 | Bacteria | 1916 |
| 85 | Ga0070681_10569941 | 3300005458 | Bacteria | 1046 |
| 86 | Ga0070681_10573808 | 3300005458 | Bacteria | 1042 |
| 87 | Ga0068867_100000421 | 3300005459 | Bacteria | 28313 |
| 88 | Ga0068867_100051934 | 3300005459 | Bacteria | 3024 |
| 89 | Ga0068867_100222300 | 3300005459 | Bacteria | 1522 |
| 90 | Ga0070706_100238536 | 3300005467 | Bacteria | 1698 |
| 91 | Ga0070707_100383652 | 3300005468 | Bacteria | 1365 |
| 92 | Ga0070698_100003981 | 3300005471 | Bacteria | 16258 |
| 93 | Ga0070698_100054255 | 3300005471 | Bacteria | 4070 |
| 94 | Ga0070698_100083208 | 3300005471 | Bacteria | 3190 |
| 95 | Ga0070698_100303624 | 3300005471 | Bacteria | 1527 |
| 96 | Ga0070698_100841274 | 3300005471 | Bacteria | 862 |
| 97 | Ga0070699_100284425 | 3300005518 | Bacteria | 1482 |
| 98 | Ga0070679_100003954 | 3300005530 | Bacteria | 13644 |
| 99 | Ga0070679_100004261 | 3300005530 | Bacteria | 13201 |
| 100 | Ga0070679_100017188 | 3300005530 | Bacteria | 6997 |
| 101 | Ga0070679_100064110 | 3300005530 | Bacteria | 3662 |
| 102 | Ga0070679_100102619 | 3300005530 | Bacteria | 2846 |
| 103 | Ga0070679_100137729 | 3300005530 | Bacteria | 2422 |
| 104 | Ga0070679_100264409 | 3300005530 | Bacteria | 1675 |
| 105 | Ga0070684_100042463 | 3300005535 | Bacteria | 3925 |
| 106 | Ga0070684_100505133 | 3300005535 | Bacteria | 1120 |
| 107 | Ga0070697_100020296 | 3300005536 | Bacteria | 5255 |
| 108 | Ga0070697_100251570 | 3300005536 | Bacteria | 1511 |
| 109 | Ga0068853_100001762 | 3300005539 | Bacteria | 15900 |
| 110 | Ga0070672_100065877 | 3300005543 | Bacteria | 2866 |
| 111 | Ga0070672_100333142 | 3300005543 | Bacteria | 1291 |
| 112 | Ga0070686_100000270 | 3300005544 | Bacteria | 35461 |
| 113 | Ga0070695_100056903 | 3300005545 | Bacteria | 2525 |
| 114 | Ga0070695_100446254 | 3300005545 | Bacteria | 990 |
| 115 | Ga0070696_100003294 | 3300005546 | Bacteria | 10777 |
| 116 | Ga0070696_100233624 | 3300005546 | Bacteria | 1384 |
| 117 | Ga0070693_100001571 | 3300005547 | Bacteria | 10296 |
| 118 | Ga0070665_100002531 | 3300005548 | Bacteria | 20087 |
| 119 | Ga0070665_100157564 | 3300005548 | Bacteria | 2272 |
| 120 | Ga0070665_100549650 | 3300005548 | Bacteria | 1167 |
| 121 | Ga0070704_100066824 | 3300005549 | Bacteria | 2594 |
| 122 | Ga0070704_100114552 | 3300005549 | Bacteria | 2058 |
| 123 | Ga0068855_100005088 | 3300005563 | Bacteria | 16031 |
| 124 | Ga0068855_100022196 | 3300005563 | Bacteria | 7606 |
| 125 | Ga0068855_100121708 | 3300005563 | Bacteria | 2986 |
| 126 | Ga0068855_100340451 | 3300005563 | Bacteria | 1654 |
| 127 | Ga0068855_100758550 | 3300005563 | Bacteria | 1034 |
| 128 | Ga0068855_100768800 | 3300005563 | Bacteria | 1026 |
| 129 | Ga0070664_100033863 | 3300005564 | Bacteria | 4283 |
| 130 | Ga0068857_100006255 | 3300005577 | Bacteria | 10182 |
| 131 | Ga0068857_100012178 | 3300005577 | Bacteria | 7481 |
| 132 | Ga0068857_100118282 | 3300005577 | Bacteria | 2385 |
| 133 | Ga0068857_100227096 | 3300005577 | Bacteria | 1706 |
| 134 | Ga0068854_100026505 | 3300005578 | Bacteria | 3984 |
| 135 | Ga0068854_100135020 | 3300005578 | Bacteria | 1888 |
| 136 | Ga0068854_100136497 | 3300005578 | Bacteria | 1878 |
| 137 | Ga0070702_100000370 | 3300005615 | Bacteria | 15791 |
| 138 | Ga0070702_100046626 | 3300005615 | Bacteria | 2457 |
| 139 | Ga0070702_100085227 | 3300005615 | Bacteria | 1902 |
| 140 | Ga0068852_100009333 | 3300005616 | Bacteria | 7281 |
| 141 | Ga0068852_100194976 | 3300005616 | Bacteria | 1913 |
| 142 | Ga0068859_100008372 | 3300005617 | Bacteria | 10482 |
| 143 | Ga0068859_100016233 | 3300005617 | Bacteria | 7481 |
| 144 | Ga0068859_100226524 | 3300005617 | Bacteria | 1957 |
| 145 | Ga0068859_100281175 | 3300005617 | Bacteria | 1757 |
| 146 | Ga0068859_100355715 | 3300005617 | Bacteria | 1559 |
| 147 | Ga0068859_100534335 | 3300005617 | Bacteria | 1267 |
| 148 | Ga0068859_100750577 | 3300005617 | Bacteria | 1065 |
| 149 | Ga0068864_100109023 | 3300005618 | Bacteria | 2464 |
| 150 | Ga0068866_10000249 | 3300005718 | Bacteria | 25399 |
| 151 | Ga0068866_10026604 | 3300005718 | Bacteria | 2734 |
| 152 | Ga0068861_100005107 | 3300005719 | Bacteria | 8849 |
| 153 | Ga0068861_100459377 | 3300005719 | Bacteria | 1143 |
| 154 | Ga0068851_10028875 | 3300005834 | Bacteria | 2742 |
| 155 | Ga0068863_100136353 | 3300005841 | Bacteria | 2345 |
| 156 | Ga0068858_100010505 | 3300005842 | Bacteria | 8771 |
| 157 | Ga0068858_100243912 | 3300005842 | Bacteria | 1705 |
| 158 | Ga0068858_100359363 | 3300005842 | Bacteria | 1396 |
| 159 | Ga0068860_100309804 | 3300005843 | Bacteria | 1548 |
| 160 | Ga0068860_100343963 | 3300005843 | Bacteria | 1467 |
| 161 | Ga0068860_100750349 | 3300005843 | Bacteria | 988 |
| 162 | Ga0068862_100001761 | 3300005844 | Bacteria | 19572 |
| 163 | Ga0068862_100055175 | 3300005844 | Bacteria | 3403 |
| 164 | Ga0068862_100107662 | 3300005844 | Bacteria | 2444 |
| 165 | Ga0081455_10003323 | 3300005937 | Bacteria | 18577 |
| 166 | Ga0081455_10006621 | 3300005937 | Bacteria | 12395 |
| 167 | Ga0081455_10009487 | 3300005937 | Bacteria | 10005 |
| 168 | Ga0081455_10400814 | 3300005937 | Bacteria | 952 |
| 169 | Ga0081538_10016756 | 3300005981 | Bacteria | 5601 |
| 170 | Ga0081538_10121911 | 3300005981 | Bacteria | 1250 |
| 171 | Ga0081539_10004821 | 3300005985 | Bacteria | 14466 |
| 172 | Ga0081539_10132688 | 3300005985 | Bacteria | 1221 |
| 173 | Ga0070717_10015233 | 3300006028 | Bacteria | 5933 |
| 174 | Ga0070717_10228163 | 3300006028 | Bacteria | 1639 |
| 175 | Ga0070717_10519149 | 3300006028 | Bacteria | 1077 |
| 176 | Ga0075365_10025403 | 3300006038 | Bacteria | 3749 |
| 177 | Ga0075365_10039511 | 3300006038 | Bacteria | 3073 |
| 178 | Ga0075365_10202862 | 3300006038 | Bacteria | 1389 |
| 179 | Ga0075363_100053182 | 3300006048 | Bacteria | 2163 |
| 180 | Ga0070716_100164613 | 3300006173 | Bacteria | 1441 |
| 181 | Ga0070712_100004370 | 3300006175 | Bacteria | 8719 |
| 182 | Ga0070712_100007601 | 3300006175 | Bacteria | 6773 |
| 183 | Ga0075362_10003442 | 3300006177 | Bacteria | 5529 |
| 184 | Ga0075362_10019652 | 3300006177 | Bacteria | 2812 |
| 185 | Ga0075362_10067503 | 3300006177 | Bacteria | 1627 |
| 186 | Ga0075367_10116215 | 3300006178 | Bacteria | 1645 |
| 187 | Ga0075369_10006384 | 3300006186 | Bacteria | 4456 |
| 188 | Ga0075369_10012486 | 3300006186 | Bacteria | 3357 |
| 189 | Ga0075369_10038635 | 3300006186 | Bacteria | 2037 |
| 190 | Ga0075366_10059945 | 3300006195 | Bacteria | 2261 |
| 191 | Ga0075366_10076888 | 3300006195 | Bacteria | 1992 |
| 192 | Ga0097621_100001920 | 3300006237 | Bacteria | 14203 |
| 193 | Ga0097621_100192732 | 3300006237 | Bacteria | 1766 |
| 194 | Ga0097621_100221057 | 3300006237 | Bacteria | 1650 |
| 195 | Ga0075370_10009458 | 3300006353 | Bacteria | 5063 |
| 196 | Ga0075370_10101359 | 3300006353 | Bacteria | 1666 |
| 197 | Ga0068871_100012239 | 3300006358 | Bacteria | 6318 |
| 198 | Ga0068871_100074754 | 3300006358 | Bacteria | 2796 |
| 199 | Ga0075431_100006873 | 3300006847 | Bacteria | 11303 |
| 200 | Ga0068865_100009147 | 3300006881 | Bacteria | 6132 |
| 201 | Ga0097620_100008372 | 3300006931 | Bacteria | 10482 |
| 202 | Ga0097620_100016233 | 3300006931 | Bacteria | 7481 |
| 203 | Ga0097620_100226515 | 3300006931 | Bacteria | 1957 |
| 204 | Ga0097620_100281175 | 3300006931 | Bacteria | 1757 |
| 205 | Ga0097620_100355724 | 3300006931 | Bacteria | 1559 |
| 206 | Ga0097620_100534359 | 3300006931 | Bacteria | 1267 |
| 207 | Ga0097620_100750554 | 3300006931 | Bacteria | 1065 |
| 208 | Ga0099795_10052608 | 3300007788 | Bacteria | 1488 |
| 209 | Ga0105240_10031426 | 3300009093 | Bacteria | 6886 |
| 210 | Ga0105240_10075931 | 3300009093 | Bacteria | 4144 |
| 211 | Ga0105240_10609131 | 3300009093 | Bacteria | 1201 |
| 212 | Ga0105240_10696607 | 3300009093 | Bacteria | 1109 |
| 213 | Ga0111539_10000450 | 3300009094 | Bacteria | 51598 |
| 214 | Ga0111539_10055725 | 3300009094 | Bacteria | 4700 |
| 215 | Ga0111539_10188308 | 3300009094 | Bacteria | 2409 |
| 216 | Ga0111539_10687992 | 3300009094 | Bacteria | 1190 |
| 217 | Ga0105245_10001133 | 3300009098 | Bacteria | 24100 |
| 218 | Ga0114129_10204573 | 3300009147 | Bacteria | 2672 |
| 219 | Ga0105243_10000923 | 3300009148 | Bacteria | 27536 |
| 220 | Ga0105243_10130178 | 3300009148 | Bacteria | 2134 |
| 221 | Ga0105242_10316141 | 3300009176 | Bacteria | 1431 |
| 222 | Ga0105248_10031448 | 3300009177 | Bacteria | 5933 |
| 223 | Ga0105248_10117808 | 3300009177 | Bacteria | 2995 |
| 224 | Ga0105248_10182969 | 3300009177 | Bacteria | 2361 |
| 225 | Ga0105248_10663696 | 3300009177 | Bacteria | 1176 |
| 226 | Ga0105237_10017697 | 3300009545 | Bacteria | 7387 |
| 227 | Ga0105237_10035864 | 3300009545 | Bacteria | 5017 |
| 228 | Ga0105238_10008348 | 3300009551 | Bacteria | 10362 |
| 229 | Ga0105238_10063704 | 3300009551 | Bacteria | 3687 |
| 230 | Ga0105239_10006145 | 3300010375 | Bacteria | 13970 |
| 231 | Ga0157373_10114880 | 3300013100 | Bacteria | 1893 |
| 232 | Ga0157371_10198788 | 3300013102 | Bacteria | 1437 |
| 233 | Ga0157370_10003797 | 3300013104 | Bacteria | 17620 |
| 234 | Ga0157370_10005023 | 3300013104 | Bacteria | 14942 |
| 235 | Ga0157370_10040954 | 3300013104 | Bacteria | 4471 |
| 236 | Ga0157370_10200945 | 3300013104 | Bacteria | 1849 |
| 237 | Ga0157369_10855325 | 3300013105 | Bacteria | 933 |
| 238 | Ga0157374_10102692 | 3300013296 | Bacteria | 2742 |
| 239 | Ga0157378_10001174 | 3300013297 | Bacteria | 23845 |
| 240 | Ga0157378_10016742 | 3300013297 | Bacteria | 6423 |
| 241 | Ga0157378_10095994 | 3300013297 | Bacteria | 2701 |
| 242 | Ga0157378_10684767 | 3300013297 | Bacteria | 1043 |
| 243 | Ga0163162_10098077 | 3300013306 | Bacteria | 3020 |
| 244 | Ga0157372_10031749 | 3300013307 | Bacteria | 5786 |
| 245 | Ga0157372_10168950 | 3300013307 | Bacteria | 2530 |
| 246 | Ga0157372_10181499 | 3300013307 | Bacteria | 2436 |
| 247 | Ga0157372_10189287 | 3300013307 | Bacteria | 2383 |
| 248 | Ga0157372_10253999 | 3300013307 | Bacteria | 2041 |
| 249 | Ga0157375_10039302 | 3300013308 | Bacteria | 4553 |
| 250 | Ga0157375_10076567 | 3300013308 | Bacteria | 3373 |
| 251 | Ga0157375_10077872 | 3300013308 | Bacteria | 3347 |
| 252 | Ga0157375_10633727 | 3300013308 | Bacteria | 1226 |
| 253 | Ga0157375_10689949 | 3300013308 | Bacteria | 1175 |
| 254 | Ga0163163_10288025 | 3300014325 | Bacteria | 1694 |
| 255 | Ga0157380_10402116 | 3300014326 | Bacteria | 1300 |
| 256 | Ga0182008_10115008 | 3300014497 | Bacteria | 1334 |
| 257 | Ga0157379_10223278 | 3300014968 | Bacteria | 1707 |
| 258 | Ga0157376_10161777 | 3300014969 | Bacteria | 2030 |
| 259 | Ga0157376_10219194 | 3300014969 | Bacteria | 1761 |
| 260 | Ga0157376_10335831 | 3300014969 | Bacteria | 1441 |
| 261 | Ga0163161_10142354 | 3300017792 | Bacteria | 1816 |
| 262 | Ga0163161_10193103 | 3300017792 | Bacteria | 1566 |
| 263 | Ga0197907_10899973 | 3300020069 | Bacteria | 1591 |
| 264 | Ga0206356_10239614 | 3300020070 | Bacteria | 2194 |
| 265 | Ga0206350_10974906 | 3300020080 | Bacteria | 1387 |
| 266 | Ga0206353_10048251 | 3300020082 | Bacteria | 1325 |
| 267 | Ga0206353_10327856 | 3300020082 | Bacteria | 1446 |
| 268 | Ga0213872_10028776 | 3300021361 | Bacteria | 2548 |
| 269 | Ga0213874_10043831 | 3300021377 | Bacteria | 1349 |
| 270 | Ga0213876_10001938 | 3300021384 | Bacteria | 12409 |
| 271 | Ga0213876_10237830 | 3300021384 | Bacteria | 968 |
| 272 | Ga0213875_10008711 | 3300021388 | Bacteria | 5177 |
| 273 | Ga0213875_10148721 | 3300021388 | Bacteria | 1097 |
| 274 | Ga0213871_10002128 | 3300021441 | Bacteria | 3572 |
| 275 | Ga0213871_10016836 | 3300021441 | Bacteria | 1768 |
| 276 | Ga0224712_10046689 | 3300022467 | Bacteria | 1663 |
| 277 | Ga0224712_10197279 | 3300022467 | Bacteria | 914 |
| 278 | Ga0209148_1000268 | 3300025254 | Bacteria | 81728 |
| 279 | Ga0209455_1001518 | 3300025272 | Bacteria | 10379 |
| 280 | Ga0209673_1050415 | 3300025273 | Bacteria | 1106 |
| 281 | Ga0209130_1000502 | 3300025284 | Bacteria | 39793 |
| 282 | Ga0209130_1010355 | 3300025284 | Bacteria | 2574 |
| 283 | Ga0209025_1000077 | 3300025294 | Bacteria | 271958 |
| 284 | Ga0207426_1000576 | 3300025302 | Bacteria | 49162 |
| 285 | Ga0207426_1014765 | 3300025302 | Bacteria | 2855 |
| 286 | Ga0209051_1000310 | 3300025303 | Bacteria | 76181 |
| 287 | Ga0209257_1000165 | 3300025304 | Bacteria | 172773 |
| 288 | Ga0207656_10026144 | 3300025321 | Bacteria | 2376 |
| 289 | Ga0207682_10002243 | 3300025893 | Bacteria | 8727 |
| 290 | Ga0207642_10003143 | 3300025899 | Bacteria | 5178 |
| 291 | Ga0207680_10019191 | 3300025903 | Bacteria | 3652 |
| 292 | Ga0207680_10032431 | 3300025903 | Bacteria | 2970 |
| 293 | Ga0207680_10052566 | 3300025903 | Bacteria | 2442 |
| 294 | Ga0207685_10218323 | 3300025905 | Bacteria | 905 |
| 295 | Ga0207699_10053259 | 3300025906 | Bacteria | 2398 |
| 296 | Ga0207699_10078691 | 3300025906 | Bacteria | 2037 |
| 297 | Ga0207699_10080514 | 3300025906 | Bacteria | 2018 |
| 298 | Ga0207699_10437270 | 3300025906 | Bacteria | 937 |
| 299 | Ga0207705_10000714 | 3300025909 | Bacteria | 27406 |
| 300 | Ga0207705_10003763 | 3300025909 | Bacteria | 11556 |
| 301 | Ga0207705_10326461 | 3300025909 | Bacteria | 1180 |
| 302 | Ga0207684_10149915 | 3300025910 | Bacteria | 2006 |
| 303 | Ga0207707_10001526 | 3300025912 | Bacteria | 21370 |
| 304 | Ga0207707_10002213 | 3300025912 | Bacteria | 17582 |
| 305 | Ga0207707_10015649 | 3300025912 | Bacteria | 6607 |
| 306 | Ga0207707_10016341 | 3300025912 | Bacteria | 6474 |
| 307 | Ga0207707_10027081 | 3300025912 | Bacteria | 5011 |
| 308 | Ga0207707_10049872 | 3300025912 | Bacteria | 3647 |
| 309 | Ga0207707_10093743 | 3300025912 | Bacteria | 2623 |
| 310 | Ga0207707_10417354 | 3300025912 | Bacteria | 1151 |
| 311 | Ga0207707_10573626 | 3300025912 | Bacteria | 957 |
| 312 | Ga0207707_10638402 | 3300025912 | Bacteria | 898 |
| 313 | Ga0207695_10014722 | 3300025913 | Bacteria | 9249 |
| 314 | Ga0207695_10306311 | 3300025913 | Bacteria | 1479 |
| 315 | Ga0207695_10332057 | 3300025913 | Bacteria | 1409 |
| 316 | Ga0207693_10003170 | 3300025915 | Bacteria | 14130 |
| 317 | Ga0207693_10019311 | 3300025915 | Bacteria | 5423 |
| 318 | Ga0207693_10070608 | 3300025915 | Bacteria | 2733 |
| 319 | Ga0207660_10001236 | 3300025917 | Bacteria | 17105 |
| 320 | Ga0207660_10007598 | 3300025917 | Bacteria | 7015 |
| 321 | Ga0207660_10038214 | 3300025917 | Bacteria | 3350 |
| 322 | Ga0207660_10082014 | 3300025917 | Bacteria | 2371 |
| 323 | Ga0207660_10096220 | 3300025917 | Bacteria | 2204 |
| 324 | Ga0207662_10027376 | 3300025918 | Bacteria | 3290 |
| 325 | Ga0207657_10000554 | 3300025919 | Bacteria | 39853 |
| 326 | Ga0207657_10152751 | 3300025919 | Bacteria | 1879 |
| 327 | Ga0207657_10482859 | 3300025919 | Bacteria | 971 |
| 328 | Ga0207652_10002084 | 3300025921 | Bacteria | 17192 |
| 329 | Ga0207652_10002621 | 3300025921 | Bacteria | 15104 |
| 330 | Ga0207652_10081935 | 3300025921 | Bacteria | 2823 |
| 331 | Ga0207652_10358883 | 3300025921 | Bacteria | 1315 |
| 332 | Ga0207652_10471214 | 3300025921 | Bacteria | 1131 |
| 333 | Ga0207646_10031412 | 3300025922 | Bacteria | 4808 |
| 334 | Ga0207646_10542279 | 3300025922 | Bacteria | 1046 |
| 335 | Ga0207681_10147730 | 3300025923 | Bacteria | 1758 |
| 336 | Ga0207681_10296968 | 3300025923 | Bacteria | 1277 |
| 337 | Ga0207694_10008861 | 3300025924 | Bacteria | 7590 |
| 338 | Ga0207694_10043329 | 3300025924 | Bacteria | 3473 |
| 339 | Ga0207694_10482601 | 3300025924 | Bacteria | 1037 |
| 340 | Ga0207650_10054109 | 3300025925 | Bacteria | 2976 |
| 341 | Ga0207650_10151267 | 3300025925 | Bacteria | 1832 |
| 342 | Ga0207650_10301960 | 3300025925 | Bacteria | 1308 |
| 343 | Ga0207650_10458776 | 3300025925 | Bacteria | 1061 |
| 344 | Ga0207659_10004576 | 3300025926 | Bacteria | 8364 |
| 345 | Ga0207659_10009302 | 3300025926 | Bacteria | 6136 |
| 346 | Ga0207659_10039743 | 3300025926 | Bacteria | 3284 |
| 347 | Ga0207659_10415904 | 3300025926 | Bacteria | 1127 |
| 348 | Ga0207687_10001219 | 3300025927 | Bacteria | 17600 |
| 349 | Ga0207687_10434099 | 3300025927 | Bacteria | 1086 |
| 350 | Ga0207687_10560973 | 3300025927 | Bacteria | 959 |
| 351 | Ga0207700_10028357 | 3300025928 | Bacteria | 3935 |
| 352 | Ga0207700_10158135 | 3300025928 | Bacteria | 1880 |
| 353 | Ga0207700_10727687 | 3300025928 | Bacteria | 886 |
| 354 | Ga0207664_10069875 | 3300025929 | Bacteria | 2824 |
| 355 | Ga0207644_10059554 | 3300025931 | Bacteria | 2762 |
| 356 | Ga0207644_10115785 | 3300025931 | Bacteria | 2033 |
| 357 | Ga0207644_10325039 | 3300025931 | Bacteria | 1244 |
| 358 | Ga0207690_10009385 | 3300025932 | Bacteria | 5810 |
| 359 | Ga0207690_10072916 | 3300025932 | Bacteria | 2372 |
| 360 | Ga0207706_10113911 | 3300025933 | Bacteria | 2379 |
| 361 | Ga0207686_10137112 | 3300025934 | Bacteria | 1686 |
| 362 | Ga0207709_10011909 | 3300025935 | Bacteria | 4796 |
| 363 | Ga0207670_10605820 | 3300025936 | Bacteria | 900 |
| 364 | Ga0207669_10153820 | 3300025937 | Bacteria | 1615 |
| 365 | Ga0207669_10209518 | 3300025937 | Bacteria | 1421 |
| 366 | Ga0207704_10001122 | 3300025938 | Bacteria | 11913 |
| 367 | Ga0207665_10153884 | 3300025939 | Bacteria | 1649 |
| 368 | Ga0207691_10002172 | 3300025940 | Bacteria | 19178 |
| 369 | Ga0207691_10026903 | 3300025940 | Bacteria | 5397 |
| 370 | Ga0207691_10082777 | 3300025940 | Bacteria | 2882 |
| 371 | Ga0207711_10131630 | 3300025941 | Bacteria | 2243 |
| 372 | Ga0207689_10001864 | 3300025942 | Bacteria | 19957 |
| 373 | Ga0207689_10029957 | 3300025942 | Bacteria | 4538 |
| 374 | Ga0207689_10230450 | 3300025942 | Bacteria | 1531 |
| 375 | Ga0207689_10326940 | 3300025942 | Bacteria | 1273 |
| 376 | Ga0207661_10557089 | 3300025944 | Bacteria | 1050 |
| 377 | Ga0207679_10059987 | 3300025945 | Bacteria | 2824 |
| 378 | Ga0207667_10014788 | 3300025949 | Bacteria | 8879 |
| 379 | Ga0207667_10034440 | 3300025949 | Bacteria | 5437 |
| 380 | Ga0207667_10106521 | 3300025949 | Bacteria | 2892 |
| 381 | Ga0207651_10400543 | 3300025960 | Bacteria | 1167 |
| 382 | Ga0207668_10243654 | 3300025972 | Bacteria | 1456 |
| 383 | Ga0207668_10381495 | 3300025972 | Bacteria | 1187 |
| 384 | Ga0207640_10051216 | 3300025981 | Bacteria | 2683 |
| 385 | Ga0207640_10232307 | 3300025981 | Bacteria | 1420 |
| 386 | Ga0207640_10333769 | 3300025981 | Bacteria | 1212 |
| 387 | Ga0207658_10064281 | 3300025986 | Bacteria | 2752 |
| 388 | Ga0207658_10317673 | 3300025986 | Bacteria | 1347 |
| 389 | Ga0207658_10583269 | 3300025986 | Bacteria | 1003 |
| 390 | Ga0207677_10642135 | 3300026023 | Bacteria | 936 |
| 391 | Ga0207703_10026898 | 3300026035 | Bacteria | 4530 |
| 392 | Ga0207703_10074623 | 3300026035 | Bacteria | 2809 |
| 393 | Ga0207703_10136939 | 3300026035 | Bacteria | 2120 |
| 394 | Ga0207703_10157254 | 3300026035 | Bacteria | 1987 |
| 395 | Ga0207639_10002688 | 3300026041 | Bacteria | 11930 |
| 396 | Ga0207639_10370068 | 3300026041 | Bacteria | 1285 |
| 397 | Ga0207639_10534975 | 3300026041 | Bacteria | 1074 |
| 398 | Ga0207708_10005526 | 3300026075 | Bacteria | 9326 |
| 399 | Ga0207708_10007313 | 3300026075 | Bacteria | 8162 |
| 400 | Ga0207708_10095815 | 3300026075 | Bacteria | 2292 |
| 401 | Ga0207708_10184778 | 3300026075 | Bacteria | 1656 |
| 402 | Ga0207702_10090140 | 3300026078 | Bacteria | 2683 |
| 403 | Ga0207702_10390982 | 3300026078 | Bacteria | 1339 |
| 404 | Ga0207641_10229358 | 3300026088 | Bacteria | 1725 |
| 405 | Ga0207648_10030105 | 3300026089 | Bacteria | 4811 |
| 406 | Ga0207648_10067938 | 3300026089 | Bacteria | 3106 |
| 407 | Ga0207676_10145747 | 3300026095 | Bacteria | 2033 |
| 408 | Ga0207676_10372504 | 3300026095 | Bacteria | 1327 |
| 409 | Ga0207674_10026028 | 3300026116 | Bacteria | 6225 |
| 410 | Ga0207674_10027483 | 3300026116 | Bacteria | 6017 |
| 411 | Ga0207674_10032578 | 3300026116 | Bacteria | 5465 |
| 412 | Ga0207674_10136898 | 3300026116 | Bacteria | 2410 |
| 413 | Ga0207674_10342544 | 3300026116 | Bacteria | 1445 |
| 414 | Ga0207675_100000234 | 3300026118 | Bacteria | 52634 |
| 415 | Ga0207675_100043375 | 3300026118 | Bacteria | 4200 |
| 416 | Ga0207683_10000189 | 3300026121 | Bacteria | 52818 |
| 417 | Ga0207683_10010770 | 3300026121 | Bacteria | 7797 |
| 418 | Ga0207683_10446670 | 3300026121 | Bacteria | 1192 |
| 419 | Ga0207698_10059368 | 3300026142 | Bacteria | 2970 |
| 420 | Ga0207698_10110170 | 3300026142 | Bacteria | 2305 |
| 421 | Ga0209969_1000495 | 3300027360 | Bacteria | 5283 |
| 422 | Ga0209967_1002629 | 3300027364 | Bacteria | 2337 |
| 423 | Ga0209984_1014159 | 3300027424 | Bacteria | 1051 |
| 424 | Ga0210000_1006363 | 3300027462 | Bacteria | 1719 |
| 425 | Ga0209995_1002913 | 3300027471 | Bacteria | 2714 |
| 426 | Ga0209999_1001275 | 3300027543 | Bacteria | 4327 |
| 427 | Ga0209970_1015123 | 3300027614 | Bacteria | 1283 |
| 428 | Ga0209813_10059801 | 3300027866 | Bacteria | 1214 |
| 429 | Ga0209974_10002954 | 3300027876 | Bacteria | 6172 |
| 430 | Ga0207428_10000169 | 3300027907 | Bacteria | 90667 |
| 431 | Ga0207428_10221092 | 3300027907 | Bacteria | 1419 |
| 432 | Ga0268266_10103680 | 3300028379 | Bacteria | 2510 |
| 433 | Ga0268266_10847951 | 3300028379 | Bacteria | 883 |
| 434 | Ga0268265_10334580 | 3300028380 | Bacteria | 1376 |
| 435 | Ga0268265_10359675 | 3300028380 | Bacteria | 1332 |
| 436 | Ga0268264_10263045 | 3300028381 | Bacteria | 1608 |
| 437 | Ga0268264_10358454 | 3300028381 | Bacteria | 1390 |
| 438 | Ga0268264_10423092 | 3300028381 | Bacteria | 1285 |
| 439 | Ga0265326_10046553 | 3300028558 | Bacteria | 1230 |
| 440 | Ga0265338_10230119 | 3300028800 | Bacteria | 1379 |
| 441 | Ga0265338_10255007 | 3300028800 | Bacteria | 1292 |
| 442 | Ga0307511_10018066 | 3300030521 | Bacteria | 6748 |
| 443 | Ga0265330_10035395 | 3300031235 | Bacteria | 2228 |
| 444 | Ga0265332_10008217 | 3300031238 | Bacteria | 4692 |
| 445 | Ga0265332_10065391 | 3300031238 | Bacteria | 1553 |
| 446 | Ga0265328_10003968 | 3300031239 | Bacteria | 6505 |
| 447 | Ga0265329_10022657 | 3300031242 | Bacteria | 2099 |
| 448 | Ga0265340_10095182 | 3300031247 | Bacteria | 1389 |
| 449 | Ga0265331_10005807 | 3300031250 | Bacteria | 7394 |
| 450 | Ga0265331_10015988 | 3300031250 | Bacteria | 3948 |
| 451 | Ga0265327_10022910 | 3300031251 | Bacteria | 3715 |
| 452 | Ga0265316_10235168 | 3300031344 | Bacteria | 1348 |
| 453 | Ga0307408_100074379 | 3300031548 | Bacteria | 2521 |
| 454 | Ga0265313_10019402 | 3300031595 | Bacteria | 3784 |
| 455 | Ga0316575_10029533 | 3300031665 | Bacteria | 2141 |
| 456 | Ga0265314_10001600 | 3300031711 | Bacteria | 24910 |
| 457 | Ga0265342_10037861 | 3300031712 | Bacteria | 2939 |
| 458 | Ga0307409_100472922 | 3300031995 | Bacteria | 1214 |
| 459 | Ga0307416_100161965 | 3300032002 | Bacteria | 2069 |
| 460 | Ga0307416_100224851 | 3300032002 | Bacteria | 1804 |
| 461 | Ga0307414_10107183 | 3300032004 | Bacteria | 2117 |
| 462 | Ga0307411_10266792 | 3300032005 | Bacteria | 1355 |
| 463 | Ga0307510_10005450 | 3300033180 | Bacteria | 15156 |
| 464 | Ga0373926_0006701 | 3300035083 | Bacteria | 3825 |
| 465 | Ga0373926_0035404 | 3300035083 | Bacteria | 1771 |
| 466 | Ga0373926_0083093 | 3300035083 | Bacteria | 1186 |
| 467 | Ga0373923_0028341 | 3300035111 | Bacteria | 2240 |
| 468 | Ga0373923_0076139 | 3300035111 | Bacteria | 1448 |
| 469 | Ga0373932_0062101 | 3300035112 | Bacteria | 1138 |
| 470 | Ga0373932_0119650 | 3300035112 | Bacteria | 877 |
| 471 | Ga0373953_0002942 | 3300035117 | Bacteria | 5205 |
| 472 | Ga0373954_0005019 | 3300035118 | Bacteria | 5712 |
| 473 | Ga0373957_0026824 | 3300035120 | Bacteria | 2087 |
| 474 | Ga0373946_0020214 | 3300035171 | Bacteria | 2572 |
| 475 | Ga0373955_0025284 | 3300035172 | Bacteria | 3047 |
| 476 | Ga0373961_0000005 | 3300035241 | Bacteria | 146538 |
| 477 | Ga0373924_0067809 | 3300035410 | Bacteria | 1501 |
| 478 | Ga0373931_0210651 | 3300035691 | Bacteria | 1165 |
| 479 | Ga0373935_0090574 | 3300035692 | Bacteria | 2002 |
| 480 | Ga0373935_0147227 | 3300035692 | Bacteria | 1595 |
| 481 | Ga0373927_0090614 | 3300035695 | Bacteria | 1986 |
| 482 | Ga0373927_0092990 | 3300035695 | Bacteria | 1959 |
| 483 | Ga0373927_0114880 | 3300035695 | Bacteria | 1755 |
| 484 | Ga0373933_0010069 | 3300035724 | Bacteria | 5175 |
| 485 | Ga0373933_0038465 | 3300035724 | Bacteria | 2810 |
| 486 | Ga0373933_0175211 | 3300035724 | Bacteria | 1366 |
| 487 | Ga0373947_0032416 | 3300035725 | Bacteria | 3079 |
| 488 | Ga0373937_0036511 | 3300036401 | Bacteria | 4478 |
| 489 | Ga0373937_0037501 | 3300036401 | Bacteria | 4417 |
| 490 | Ga0373937_0049639 | 3300036401 | Bacteria | 3842 |
| 491 | Ga0373937_0057104 | 3300036401 | Bacteria | 3585 |
| 492 | Ga0373937_0129683 | 3300036401 | Bacteria | 2355 |
| 493 | Ga0373937_0377201 | 3300036401 | Bacteria | 1345 |
| 494 | Ga0373937_0647004 | 3300036401 | Bacteria | 1002 |
| 495 | Ga0316582_0265613 | 3300036647 | Bacteria | 1177 |
| 496 | Ga0373925_0008070 | 3300037068 | Bacteria | 7669 |
| 497 | Ga0373925_0038518 | 3300037068 | Bacteria | 3535 |
| 498 | Ga0395899_0026633 | 3300037312 | Bacteria | 4362 |
| 499 | Ga0395899_0266641 | 3300037312 | Bacteria | 1169 |
| 500 | Ga0395900_0001993 | 3300037418 | Bacteria | 23054 |
| 501 | Ga0395900_0013646 | 3300037418 | Bacteria | 8294 |
| 502 | Ga0395900_0431173 | 3300037418 | Bacteria | 1277 |
| 503 | Ga0395900_0638852 | 3300037418 | Bacteria | 1002 |
| 504 | Ga0395898_0003319 | 3300037466 | Bacteria | 18072 |
| 505 | Ga0395898_0047599 | 3300037466 | Bacteria | 4207 |
| 506 | Ga0395905_0000043 | 3300037471 | Bacteria | 247469 |
| 507 | Ga0395905_0004055 | 3300037471 | Bacteria | 15358 |
| 508 | Ga0436364_0749911 | 3300037853 | Bacteria | 1993 |
| 509 | Ga0436364_0891296 | 3300037853 | Bacteria | 1856 |
| 510 | Ga0436364_1360422 | 3300037853 | Bacteria | 15324 |
| 511 | Ga0395901_0024450 | 3300038443 | Bacteria | 6200 |
| 512 | Ga0395901_0231803 | 3300038443 | Bacteria | 1927 |
| 513 | Ga0395901_0381012 | 3300038443 | Bacteria | 1451 |
| 514 | Ga0400483_220694 | 3300039062 | Bacteria | 6582 |
| 515 | Ga0436365_0065739 | 3300039437 | Bacteria | 19976 |
| 516 | Ga0436365_0202658 | 3300039437 | Bacteria | 4473 |
| 517 | Ga0436365_0801734 | 3300039437 | Bacteria | 1199 |
| 518 | Ga0436365_1116753 | 3300039437 | Bacteria | 5499 |
| 519 | Ga0436360_0375286 | 3300039438 | Bacteria | 2491 |
| 520 | Ga0436360_0401373 | 3300039438 | Bacteria | 6508 |
| 521 | Ga0436360_0569429 | 3300039438 | Bacteria | 1127 |
| 522 | Ga0436360_0675016 | 3300039438 | Bacteria | 2684 |
| 523 | Ga0436360_0696399 | 3300039438 | Bacteria | 19859 |
| 524 | Ga0436360_0734197 | 3300039438 | Bacteria | 1476 |
| 525 | Ga0436360_0871428 | 3300039438 | Bacteria | 3201 |
| 526 | Ga0436360_1220716 | 3300039438 | Bacteria | 3658 |
| 527 | Ga0436361_0320193 | 3300039447 | Bacteria | 6759 |
| 528 | Ga0436361_0446953 | 3300039447 | Bacteria | 4784 |
| 529 | Ga0436361_0522153 | 3300039447 | Bacteria | 6431 |
| 530 | Ga0436361_1150595 | 3300039447 | Bacteria | 1644 |
| 531 | Ga0436361_1170458 | 3300039447 | Bacteria | 14146 |
| 532 | Ga0436363_0199441 | 3300039450 | Bacteria | 3442 |
| 533 | Ga0436363_1076006 | 3300039450 | Bacteria | 4620 |
| 534 | Ga0436362_0666097 | 3300039453 | Bacteria | 1104 |
| 535 | Ga0436362_1262338 | 3300039453 | Bacteria | 2015 |
| 536 | Ga0439431_0018837 | 3300041997 | Bacteria | 1637 |
| 537 | Ga0439446_0112096 | 3300042156 | Bacteria | 871 |
| 538 | Ga0439435_0070844 | 3300042436 | Bacteria | 1032 |
| 539 | Ga0450893_0003697 | 3300042532 | Bacteria | 2419 |
| 540 | Ga0451577_0276173 | 3300042876 | Bacteria | 1522 |
| 541 | Ga0451577_0340420 | 3300042876 | Bacteria | 1360 |
| 542 | Ga0451577_0509393 | 3300042876 | Bacteria | 1093 |
| 543 | Ga0453684_0582146 | 3300044712 | Bacteria | 1229 |
| 544 | Ga0466957_0024982 | 3300044842 | Bacteria | 3539 |
| 545 | Ga0451576_0001697 | 3300045051 | Bacteria | 36405 |
| 546 | Ga0451576_0580753 | 3300045051 | Bacteria | 1178 |
| 547 | Ga0466967_0324809 | 3300045976 | Bacteria | 1485 |
| 548 | Ga0466967_0649096 | 3300045976 | Bacteria | 1043 |
| 549 | Ga0495592_0089761 | 3300046454 | Bacteria | 2206 |
| 550 | Ga0495592_0176632 | 3300046454 | Bacteria | 1458 |
| 551 | Ga0495603_0128503 | 3300046455 | Bacteria | 1476 |
| 552 | Ga0495591_025637 | 3300046458 | Bacteria | 1846 |
| 553 | Ga0495638_0000635 | 3300046460 | Bacteria | 38563 |
| 554 | Ga0495638_0002699 | 3300046460 | Bacteria | 14280 |
| 555 | Ga0495641_0044532 | 3300046461 | Bacteria | 2046 |
| 556 | Ga0495653_0092015 | 3300046463 | Bacteria | 2215 |
| 557 | Ga0495650_0033642 | 3300046471 | Bacteria | 2279 |
| 558 | Ga0495580_0038311 | 3300046472 | Bacteria | 3434 |
| 559 | Ga0495580_0347028 | 3300046472 | Bacteria | 1006 |
| 560 | Ga0495605_0000862 | 3300046474 | Bacteria | 21029 |
| 561 | Ga0495639_0013338 | 3300046475 | Bacteria | 3547 |
| 562 | Ga0495662_0018435 | 3300046476 | Bacteria | 3378 |
| 563 | Ga0495664_0024843 | 3300046477 | Bacteria | 3484 |
| 564 | Ga0495585_0020821 | 3300046492 | Bacteria | 3769 |
| 565 | Ga0495585_0042471 | 3300046492 | Bacteria | 2546 |
| 566 | Ga0495607_0024538 | 3300046501 | Bacteria | 3758 |
| 567 | Ga0495608_0025250 | 3300046511 | Bacteria | 4055 |
| 568 | Ga0495610_0035969 | 3300046512 | Bacteria | 2536 |
| 569 | Ga0495610_0066217 | 3300046512 | Bacteria | 1702 |
| 570 | Ga0495628_0016038 | 3300046516 | Bacteria | 6251 |
| 571 | Ga0495630_0025383 | 3300046517 | Bacteria | 4381 |
| 572 | Ga0495631_0079937 | 3300046518 | Bacteria | 1411 |
| 573 | Ga0495644_0040755 | 3300046523 | Bacteria | 1750 |
| 574 | Ga0495666_0014543 | 3300046526 | Bacteria | 3919 |
| 575 | Ga0495642_0061605 | 3300046528 | Bacteria | 1557 |
| 576 | Ga0495652_0085979 | 3300046529 | Bacteria | 2583 |
| 577 | Ga0495640_0021018 | 3300046533 | Bacteria | 4797 |
| 578 | Ga0495586_0099910 | 3300046535 | Bacteria | 1609 |
| 579 | Ga0495586_0316325 | 3300046535 | Bacteria | 895 |
| 580 | Ga0495587_0013952 | 3300046536 | Bacteria | 5045 |
| 581 | Ga0495598_0031141 | 3300046537 | Bacteria | 1499 |
| 582 | Ga0495609_0118166 | 3300046538 | Bacteria | 1141 |
| 583 | Ga0495633_0110249 | 3300046558 | Bacteria | 1276 |
| 584 | Ga0495667_0038220 | 3300046559 | Bacteria | 3196 |
| 585 | Ga0495667_0079428 | 3300046559 | Bacteria | 2133 |
| 586 | Ga0495668_0056547 | 3300046616 | Bacteria | 2165 |
| 587 | Ga0495634_0016612 | 3300046642 | Bacteria | 5260 |
| 588 | Ga0495635_0063453 | 3300046663 | Bacteria | 2537 |
| 589 | Ga0495635_0089090 | 3300046663 | Bacteria | 2111 |
| 590 | Ga0495661_0077924 | 3300046665 | Bacteria | 1919 |
| 591 | Ga0495661_0113524 | 3300046665 | Bacteria | 1507 |
| 592 | Ga0495657_0004212 | 3300046675 | Bacteria | 11512 |
| 593 | Ga0495599_0005873 | 3300046678 | Bacteria | 7373 |
| 594 | Ga0495599_0047278 | 3300046678 | Bacteria | 2697 |
| 595 | Ga0495647_0012203 | 3300046681 | Bacteria | 2956 |
| 596 | Ga0495658_0045710 | 3300046683 | Bacteria | 2458 |
| 597 | Ga0495658_0070327 | 3300046683 | Bacteria | 2030 |
| 598 | Ga0495669_0001975 | 3300046684 | Bacteria | 8418 |
| 599 | Ga0495670_0001012 | 3300046691 | Bacteria | 13669 |
| 600 | Ga0495589_0000736 | 3300046794 | Bacteria | 21110 |
| 601 | Ga0495600_0037442 | 3300046809 | Bacteria | 3153 |
| 602 | Ga0495600_0052340 | 3300046809 | Bacteria | 2666 |
| 603 | Ga0495680_0109312 | 3300047322 | Bacteria | 2050 |
| 604 | Ga0495675_0003519 | 3300047444 | Bacteria | 9440 |
| 605 | Ga0495679_049887 | 3300047446 | Bacteria | 1261 |
| 606 | Ga0496100_0051897 | 3300048903 | Bacteria | 2664 |
| 607 | Ga0496102_0028584 | 3300048905 | Bacteria | 4981 |
| 608 | Ga0496102_0203346 | 3300048905 | Bacteria | 1867 |
| 609 | Ga0496103_0005688 | 3300048906 | Bacteria | 7450 |
| 610 | Ga0496103_0152077 | 3300048906 | Bacteria | 1482 |
| 611 | Ga0496104_0005443 | 3300048907 | Bacteria | 11145 |
| 612 | Ga0496104_0174928 | 3300048907 | Bacteria | 2057 |
| 613 | Ga0496106_0047743 | 3300048909 | Bacteria | 3223 |
| 614 | Ga0496107_0013654 | 3300048910 | Bacteria | 5678 |
| 615 | Ga0496108_0011478 | 3300048911 | Bacteria | 7201 |
| 616 | Ga0496109_0561951 | 3300048912 | Bacteria | 1076 |
| 617 | Ga0496110_0015076 | 3300048913 | Bacteria | 6427 |
| 618 | Ga0496110_0209542 | 3300048913 | Bacteria | 1772 |
| 619 | Ga0496111_0022762 | 3300048914 | Bacteria | 4391 |
| 620 | Ga0496113_0448431 | 3300048916 | Bacteria | 1037 |
| 621 | Ga0496113_0460851 | 3300048916 | Bacteria | 1021 |
| 622 | Ga0496114_0257357 | 3300048917 | Bacteria | 1536 |
| 623 | Ga0496119_0052118 | 3300048922 | Bacteria | 2509 |
| 624 | Ga0496119_0104002 | 3300048922 | Bacteria | 1589 |
| 625 | Ga0496120_0045785 | 3300048923 | Bacteria | 2532 |
| 626 | Ga0496121_0053116 | 3300048924 | Bacteria | 3396 |
| 627 | Ga0496121_0193569 | 3300048924 | Bacteria | 1456 |
| 628 | Ga0496126_0113234 | 3300048929 | Bacteria | 2362 |
| 629 | Ga0501031_0119705 | 3300049568 | Bacteria | 1720 |
| 630 | Ga0501032_0199530 | 3300049569 | Bacteria | 1306 |
| 631 | Ga0501032_0250360 | 3300049569 | Bacteria | 1150 |
| 632 | Ga0501033_0224465 | 3300049570 | Bacteria | 1336 |
| 633 | Ga0501034_0002928 | 3300049571 | Bacteria | 19795 |
| 634 | Ga0501034_0044434 | 3300049571 | Bacteria | 4494 |
| 635 | Ga0501034_0411371 | 3300049571 | Bacteria | 1275 |
| 636 | Ga0501034_0656926 | 3300049571 | Bacteria | 950 |
| 637 | Ga0501036_0088895 | 3300049572 | Bacteria | 2610 |
| 638 | Ga0501036_0093961 | 3300049572 | Bacteria | 2534 |
| 639 | Ga0501036_0123251 | 3300049572 | Bacteria | 2189 |
| 640 | Ga0501036_0421246 | 3300049572 | Bacteria | 1113 |
| 641 | Ga0501037_0032710 | 3300049573 | Bacteria | 3842 |
| 642 | Ga0501037_0089750 | 3300049573 | Bacteria | 2224 |
| 643 | Ga0501037_0107131 | 3300049573 | Bacteria | 2014 |
| 644 | Ga0501037_0160141 | 3300049573 | Bacteria | 1605 |
| 645 | Ga0501037_0190844 | 3300049573 | Bacteria | 1451 |
| 646 | Ga0501038_0043380 | 3300049574 | Bacteria | 3911 |
| 647 | Ga0501038_0077112 | 3300049574 | Bacteria | 2814 |
| 648 | Ga0501038_0233394 | 3300049574 | Bacteria | 1463 |
| 649 | Ga0501039_0002641 | 3300049575 | Bacteria | 13393 |
| 650 | Ga0501039_0014487 | 3300049575 | Bacteria | 6037 |
| 651 | Ga0501039_0069442 | 3300049575 | Bacteria | 2736 |
| 652 | Ga0501039_0262018 | 3300049575 | Bacteria | 1359 |
| 653 | Ga0501040_0015316 | 3300049576 | Bacteria | 5070 |
| 654 | Ga0501040_0020278 | 3300049576 | Bacteria | 4430 |
| 655 | Ga0501040_0315472 | 3300049576 | Bacteria | 1118 |
| 656 | Ga0501041_0002700 | 3300049577 | Bacteria | 10122 |
| 657 | Ga0501041_0005228 | 3300049577 | Bacteria | 7580 |
| 658 | Ga0501041_0014311 | 3300049577 | Bacteria | 4709 |
| 659 | Ga0501041_0024556 | 3300049577 | Bacteria | 3619 |
| 660 | Ga0501042_0010930 | 3300049578 | Bacteria | 6112 |
| 661 | Ga0501042_0048508 | 3300049578 | Bacteria | 3028 |
| 662 | Ga0501042_0095921 | 3300049578 | Bacteria | 2131 |
| 663 | Ga0501043_0028245 | 3300049579 | Bacteria | 4403 |
| 664 | Ga0501043_0187052 | 3300049579 | Bacteria | 1612 |
| 665 | Ga0501043_0496979 | 3300049579 | Bacteria | 912 |
| 666 | Ga0501046_0023006 | 3300049580 | Bacteria | 5131 |
| 667 | Ga0501046_0083389 | 3300049580 | Bacteria | 2468 |
| 668 | Ga0501046_0111591 | 3300049580 | Bacteria | 2088 |
| 669 | Ga0501046_0374667 | 3300049580 | Bacteria | 1031 |
| 670 | Ga0501047_0051548 | 3300049581 | Bacteria | 3977 |
| 671 | Ga0501047_0167250 | 3300049581 | Bacteria | 2069 |
| 672 | Ga0501047_0367260 | 3300049581 | Bacteria | 1274 |
| 673 | Ga0501048_0006462 | 3300049582 | Bacteria | 8910 |
| 674 | Ga0501048_0083437 | 3300049582 | Bacteria | 2253 |
| 675 | Ga0501048_0210730 | 3300049582 | Bacteria | 1378 |
| 676 | Ga0501067_0035467 | 3300049583 | Bacteria | 2769 |
| 677 | Ga0501068_0188600 | 3300049584 | Bacteria | 1305 |
| 678 | Ga0501069_0121219 | 3300049585 | Bacteria | 1494 |
| 679 | Ga0501070_0000033 | 3300049586 | Bacteria | 128626 |
| 680 | Ga0501070_0127126 | 3300049586 | Bacteria | 2106 |
| 681 | Ga0501070_0172523 | 3300049586 | Bacteria | 1781 |
| 682 | Ga0501070_0407750 | 3300049586 | Bacteria | 1099 |
| 683 | Ga0501071_0003718 | 3300049587 | Bacteria | 9582 |
| 684 | Ga0501071_0021107 | 3300049587 | Bacteria | 4535 |
| 685 | Ga0501071_0047761 | 3300049587 | Bacteria | 3075 |
| 686 | Ga0501072_0003456 | 3300049588 | Bacteria | 11901 |
| 687 | Ga0501072_0030407 | 3300049588 | Bacteria | 4223 |
| 688 | Ga0501072_0043434 | 3300049588 | Bacteria | 3532 |
| 689 | Ga0501072_0060051 | 3300049588 | Bacteria | 2998 |
| 690 | Ga0501073_0039675 | 3300049589 | Bacteria | 3334 |
| 691 | Ga0501073_0048482 | 3300049589 | Bacteria | 2981 |
| 692 | Ga0501073_0286798 | 3300049589 | Bacteria | 1136 |
| 693 | Ga0501073_0362019 | 3300049589 | Bacteria | 1002 |
| 694 | Ga0501073_0484753 | 3300049589 | Bacteria | 855 |
| 695 | Ga0501074_0039505 | 3300049590 | Bacteria | 3418 |
| 696 | Ga0501075_0009891 | 3300049591 | Bacteria | 6683 |
| 697 | Ga0501075_0053365 | 3300049591 | Bacteria | 3040 |
| 698 | Ga0501075_0187531 | 3300049591 | Bacteria | 1577 |
| 699 | Ga0501076_0006358 | 3300049592 | Bacteria | 8565 |
| 700 | Ga0501076_0008071 | 3300049592 | Bacteria | 7693 |
| 701 | Ga0501076_0018226 | 3300049592 | Bacteria | 5348 |
| 702 | Ga0501076_0035381 | 3300049592 | Bacteria | 3908 |
| 703 | Ga0501077_0008361 | 3300049593 | Bacteria | 6407 |
| 704 | Ga0501077_0034366 | 3300049593 | Bacteria | 3227 |
| 705 | Ga0501077_0090319 | 3300049593 | Bacteria | 1941 |
| 706 | Ga0501077_0235766 | 3300049593 | Bacteria | 1163 |
| 707 | Ga0501079_0006027 | 3300049741 | Bacteria | 9082 |
| 708 | Ga0501079_0007033 | 3300049741 | Bacteria | 8489 |
| 709 | Ga0501079_0011467 | 3300049741 | Bacteria | 6766 |
| 710 | Ga0501080_0003821 | 3300049742 | Bacteria | 13311 |
| 711 | Ga0501080_0054137 | 3300049742 | Bacteria | 3737 |
| 712 | Ga0501080_0124520 | 3300049742 | Bacteria | 2387 |
| 713 | Ga0501080_0192262 | 3300049742 | Bacteria | 1875 |
| 714 | Ga0501080_0274094 | 3300049742 | Bacteria | 1535 |
| 715 | Ga0501080_0283212 | 3300049742 | Bacteria | 1506 |
| 716 | Ga0501080_0351802 | 3300049742 | Bacteria | 1330 |
| 717 | Ga0501081_0014806 | 3300049743 | Bacteria | 5148 |
| 718 | Ga0501081_0124456 | 3300049743 | Bacteria | 1838 |
| 719 | Ga0501081_0429550 | 3300049743 | Bacteria | 980 |
| 720 | Ga0501081_0447094 | 3300049743 | Bacteria | 960 |
| 721 | Ga0501083_0160261 | 3300049744 | Bacteria | 1472 |
| 722 | Ga0501035_0009931 | 3300049822 | Bacteria | 8838 |
| 723 | Ga0501035_0041274 | 3300049822 | Bacteria | 4167 |
| 724 | Ga0501035_0066532 | 3300049822 | Bacteria | 3198 |
| 725 | Ga0501035_0551476 | 3300049822 | Bacteria | 944 |
| 726 | Ga0501044_0000140 | 3300049823 | Bacteria | 88672 |
| 727 | Ga0501044_0006810 | 3300049823 | Bacteria | 12593 |
| 728 | Ga0501044_0105892 | 3300049823 | Bacteria | 2825 |
| 729 | Ga0501044_0107643 | 3300049823 | Bacteria | 2799 |
| 730 | Ga0501044_0109780 | 3300049823 | Bacteria | 2767 |
| 731 | Ga0501044_0165715 | 3300049823 | Bacteria | 2184 |
| 732 | Ga0501044_0231248 | 3300049823 | Bacteria | 1796 |
| 733 | Ga0501045_0006104 | 3300049824 | Bacteria | 8344 |
| 734 | Ga0501045_0011319 | 3300049824 | Bacteria | 6263 |
| 735 | Ga0501045_0049915 | 3300049824 | Bacteria | 3052 |
| 736 | nmdc:mga03683_28684_c1 | 3300050489 | Bacteria | 2215 |
| 737 | nmdc:mga03683_9105_c1 | 3300050489 | Bacteria | 3517 |
| 738 | nmdc:mga03n38_41205_c1 | 3300050490 | Bacteria | 2011 |
| 739 | nmdc:mga0yw44_19567_c1 | 3300050492 | Bacteria | 3736 |
| 740 | nmdc:mga0yw44_28226_c1 | 3300050492 | Bacteria | 3226 |
| 741 | nmdc:mga0yw44_3416_c1 | 3300050492 | Bacteria | 7051 |
| 742 | nmdc:mga0k408_17471_c2 | 3300050493 | Bacteria | 3132 |
| 743 | nmdc:mga0k408_31758_c1 | 3300050493 | Bacteria | 3017 |
| 744 | nmdc:mga06z11_110122_c1 | 3300050494 | Bacteria | 1524 |
| 745 | nmdc:mga06z11_122457_c1 | 3300050494 | Bacteria | 1452 |
| 746 | nmdc:mga04h51_30041_c1 | 3300050495 | Bacteria | 1707 |
| 747 | nmdc:mga07m45_21233_c1 | 3300050496 | Bacteria | 2919 |
| 748 | nmdc:mga07m45_47426_c1 | 3300050496 | Bacteria | 2415 |
| 749 | nmdc:mga05p37_133005_c1 | 3300050507 | Bacteria | 3051 |
| 750 | nmdc:mga08y16_14765_c1 | 3300050511 | Bacteria | 8212 |
| 751 | nmdc:mga08y16_183864_c1 | 3300050511 | Bacteria | 2169 |
| 752 | nmdc:mga08y16_199913_c1 | 3300050511 | Bacteria | 2071 |
| 753 | nmdc:mga08y16_34_c1 | 3300050511 | Bacteria | 164092 |
| 754 | nmdc:mga08x19_190523_c1 | 3300050514 | Bacteria | 1403 |
| 755 | nmdc:mga0sz30_43099_c1 | 3300050516 | Bacteria | 1899 |
| 756 | nmdc:mga0sz30_7389_c1 | 3300050516 | Bacteria | 4117 |
| 757 | Ga0495601_0023238 | 3300053077 | Bacteria | 3809 |
| 758 | Ga0495601_0062388 | 3300053077 | Bacteria | 2367 |
| 759 | Ga0495601_0176906 | 3300053077 | Bacteria | 1395 |
| 760 | Ga0495595_0024502 | 3300053084 | Bacteria | 2666 |
| 761 | Ga0495595_0032645 | 3300053084 | Bacteria | 2345 |
| 762 | Ga0495619_0006383 | 3300053085 | Bacteria | 7472 |
| 763 | Ga0495619_0017391 | 3300053085 | Bacteria | 4552 |
| 764 | Ga0500643_000055 | 3300053087 | Bacteria | 134904 |
| 765 | Ga0500646_0001193 | 3300053090 | Bacteria | 6985 |
| 766 | Ga0500646_0053058 | 3300053090 | Bacteria | 1175 |
| 767 | Ga0500583_0021676 | 3300053092 | Bacteria | 2677 |
| 768 | Ga0500651_0145463 | 3300053093 | Bacteria | 1426 |
| 769 | Ga0500566_0000041 | 3300053094 | Bacteria | 65580 |
| 770 | Ga0500640_046848 | 3300053095 | Bacteria | 1895 |
| 771 | Ga0500641_0002772 | 3300053096 | Bacteria | 6198 |
| 772 | Ga0500641_0051903 | 3300053096 | Bacteria | 1689 |
| 773 | Ga0500650_0225184 | 3300053098 | Bacteria | 847 |
| 774 | Ga0500555_002542 | 3300053103 | Bacteria | 5261 |
| 775 | Ga0500557_000017 | 3300053105 | Bacteria | 96699 |
| 776 | Ga0500569_001055 | 3300053109 | Bacteria | 5013 |
| 777 | Ga0500572_044574 | 3300053111 | Bacteria | 1300 |
| 778 | Ga0500594_0012816 | 3300053118 | Bacteria | 1984 |
| 779 | Ga0500607_011787 | 3300053121 | Bacteria | 5158 |
| 780 | Ga0500642_0000256 | 3300053130 | Bacteria | 19927 |
| 781 | Ga0500642_0042877 | 3300053130 | Bacteria | 1963 |
| 782 | Ga0500642_0078554 | 3300053130 | Bacteria | 1512 |
| 783 | Ga0500652_058621 | 3300053131 | Bacteria | 1582 |
| 784 | Ga0500655_003517 | 3300053133 | Bacteria | 2830 |
| 785 | Ga0500655_024347 | 3300053133 | Bacteria | 1146 |
| 786 | Ga0500559_0004313 | 3300053136 | Bacteria | 6791 |
| 787 | Ga0500564_093418 | 3300053138 | Bacteria | 1337 |
| 788 | Ga0500589_049178 | 3300053147 | Bacteria | 1959 |
| 789 | Ga0500604_0004311 | 3300053151 | Bacteria | 3776 |
| 790 | Ga0500616_0000757 | 3300053153 | Bacteria | 37213 |
| 791 | Ga0500620_016705 | 3300053155 | Bacteria | 2103 |
| 792 | Ga0500638_184640 | 3300053162 | Bacteria | 896 |
| 793 | Ga0500636_0000389 | 3300053177 | Bacteria | 24251 |
| 794 | Ga0500637_0046381 | 3300053178 | Bacteria | 2467 |
| 795 | Ga0500625_037436 | 3300053729 | Bacteria | 2293 |
| 796 | Ga0500645_074449 | 3300053730 | Bacteria | 973 |
| 797 | Ga0500599_000235 | 3300053736 | Bacteria | 5232 |
| 798 | Ga0500601_000091 | 3300053737 | Bacteria | 18928 |
| 799 | Ga0501084_0064778 | 3300054114 | Bacteria | 3058 |
| 800 | Ga0501084_0087470 | 3300054114 | Bacteria | 2616 |
| 801 | Ga0501084_0091008 | 3300054114 | Bacteria | 2561 |
| 802 | Ga0501084_0155953 | 3300054114 | Bacteria | 1925 |
| 803 | Ga0501084_0167359 | 3300054114 | Bacteria | 1855 |
| 804 | Ga0501082_0014435 | 3300060353 | Bacteria | 6798 |
| 805 | Ga0501082_0041695 | 3300060353 | Bacteria | 3957 |
| 806 | Ga0501082_0045391 | 3300060353 | Bacteria | 3790 |
| 807 | Ga0501082_0095123 | 3300060353 | Bacteria | 2574 |
| 808 | Ga0530510_0007292 | 3300061734 | Bacteria | 7693 |
| 809 | Ga0530510_0008880 | 3300061734 | Bacteria | 7035 |
| 810 | Ga0530510_0066403 | 3300061734 | Bacteria | 2615 |
| 811 | Ga0530510_0189350 | 3300061734 | Bacteria | 1527 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035083 | Ga0373926_0035404 | Ga0373926_0035404_525_1322 | 256 |
| 2 | 3300035111 | Ga0373923_0076139 | Ga0373923_0076139_408_1205 | 256 |
| 3 | 3300035117 | Ga0373953_0002942 | Ga0373953_0002942_3759_4556 | 256 |
| 4 | 3300035120 | Ga0373957_0026824 | Ga0373957_0026824_814_1611 | 256 |
| 5 | 3300035171 | Ga0373946_0020214 | Ga0373946_0020214_1504_2301 | 256 |
| 6 | 3300035172 | Ga0373955_0025284 | Ga0373955_0025284_1944_2741 | 256 |
| 7 | 3300035724 | Ga0373933_0038465 | Ga0373933_0038465_1843_2640 | 256 |
| 8 | 3300036401 | Ga0373937_0037501 | Ga0373937_0037501_1688_2485 | 256 |
| 9 | 3300037068 | Ga0373925_0008070 | Ga0373925_0008070_3577_4374 | 256 |
| 10 | 3300037853 | Ga0436364_0749911 | Ga0436364_0749911_645_1436 | 256 |
| 11 | 3300046454 | Ga0495592_0089761 | Ga0495592_0089761_572_1369 | 256 |
| 12 | 3300046461 | Ga0495641_0044532 | Ga0495641_0044532_1119_1916 | 256 |
| 13 | 3300046463 | Ga0495653_0092015 | Ga0495653_0092015_200_997 | 256 |
| 14 | 3300046475 | Ga0495639_0013338 | Ga0495639_0013338_2168_2965 | 256 |
| 15 | 3300046476 | Ga0495662_0018435 | Ga0495662_0018435_1218_2015 | 256 |
| 16 | 3300046477 | Ga0495664_0024843 | Ga0495664_0024843_2208_3005 | 256 |
| 17 | 3300046511 | Ga0495608_0025250 | Ga0495608_0025250_307_1104 | 256 |
| 18 | 3300046516 | Ga0495628_0016038 | Ga0495628_0016038_2019_2816 | 256 |
| 19 | 3300046517 | Ga0495630_0025383 | Ga0495630_0025383_573_1370 | 256 |
| 20 | 3300046526 | Ga0495666_0014543 | Ga0495666_0014543_2010_2807 | 256 |
| 21 | 3300046529 | Ga0495652_0085979 | Ga0495652_0085979_1321_2118 | 256 |
| 22 | 3300046533 | Ga0495640_0021018 | Ga0495640_0021018_1049_1846 | 256 |
| 23 | 3300046535 | Ga0495586_0099910 | Ga0495586_0099910_650_1447 | 256 |
| 24 | 3300046536 | Ga0495587_0013952 | Ga0495587_0013952_3704_4501 | 256 |
| 25 | 3300046642 | Ga0495634_0016612 | Ga0495634_0016612_2111_2908 | 256 |
| 26 | 3300046663 | Ga0495635_0063453 | Ga0495635_0063453_1434_2231 | 256 |
| 27 | 3300046675 | Ga0495657_0004212 | Ga0495657_0004212_3430_4227 | 256 |
| 28 | 3300046678 | Ga0495599_0005873 | Ga0495599_0005873_840_1637 | 256 |
| 29 | 3300046681 | Ga0495647_0012203 | Ga0495647_0012203_318_1115 | 256 |
| 30 | 3300046683 | Ga0495658_0070327 | Ga0495658_0070327_521_1318 | 256 |
| 31 | 3300046809 | Ga0495600_0037442 | Ga0495600_0037442_747_1544 | 256 |
| 32 | 3300047322 | Ga0495680_0109312 | Ga0495680_0109312_163_960 | 256 |
| 33 | 3300047444 | Ga0495675_0003519 | Ga0495675_0003519_1680_2477 | 256 |
| 34 | 3300049575 | Ga0501039_0262018 | Ga0501039_0262018_176_970 | 256 |
| 35 | 3300053077 | Ga0495601_0062388 | Ga0495601_0062388_916_1713 | 256 |
| 36 | 3300053085 | Ga0495619_0006383 | Ga0495619_0006383_4021_4818 | 256 |
| 37 | 3300049592 | Ga0501076_0035381 | Ga0501076_0035381_1740_2534 | 257 |
| 38 | iso_pu_bacteria | 2897803580 | 2897805617 | 257 |
| 39 | 3300046665 | Ga0495661_0113524 | Ga0495661_0113524_16_807 | 258 |
| 40 | iso_pu_bacteria | 2883291878 | 2883294178 | 258 |
| 41 | 3300050516 | nmdc:mga0sz30_43099_c1 | nmdc:mga0sz30_43099_c1_240_1022 | 260 |
| 42 | 3300053090 | Ga0500646_0001193 | Ga0500646_0001193_5631_6413 | 260 |
| 43 | 3300053133 | Ga0500655_003517 | Ga0500655_003517_322_1104 | 260 |
| 44 | 3300053151 | Ga0500604_0004311 | Ga0500604_0004311_1729_2511 | 260 |
| 45 | iso_pu_bacteria | 2507262055 | 2507511211 | 260 |
| 46 | iso_pu_bacteria | 2508501009 | 2508545020 | 260 |
| 47 | iso_pu_bacteria | 2906626472 | 2906630756 | 260 |
| 48 | iso_pu_bacteria | 2906643746 | 2906645993 | 260 |
| 49 | iso_pu_bacteria | 2932828146 | 2932836161 | 260 |
| 50 | iso_pu_bacteria | 2935608549 | 2935612559 | 260 |
| 51 | iso_pu_bacteria | 2935616580 | 2935616905 | 260 |
| 52 | iso_pu_bacteria | 2935638405 | 2935641770 | 260 |
| 53 | iso_pu_bacteria | 2935665750 | 2935671639 | 260 |
| 54 | iso_pu_bacteria | 2935703347 | 2935705539 | 260 |
| 55 | iso_pu_bacteria | 2935801545 | 2935802522 | 260 |
| 56 | iso_pu_bacteria | 2935819856 | 2935824048 | 260 |
| 57 | iso_pu_bacteria | 2935827899 | 2935829937 | 260 |
| 58 | iso_pu_bacteria | 2935837841 | 2935837847 | 260 |
| 59 | iso_pu_bacteria | 2935847175 | 2935852805 | 260 |
| 60 | iso_pu_bacteria | 2935855204 | 2935855529 | 260 |
| 61 | iso_pu_bacteria | 2935864058 | 2935867226 | 260 |
| 62 | iso_pu_bacteria | 2935873716 | 2935875954 | 260 |
| 63 | iso_pu_bacteria | 2935908558 | 2935912044 | 260 |
| 64 | iso_pu_bacteria | 2935916978 | 2935922255 | 260 |
| 65 | iso_pu_bacteria | 2935926038 | 2935929073 | 260 |
| 66 | iso_pu_bacteria | 2935934488 | 2935935704 | 260 |
| 67 | iso_pu_bacteria | 2935942939 | 2935947270 | 260 |
| 68 | iso_pu_bacteria | 2935951376 | 2935953636 | 260 |
| 69 | iso_pu_bacteria | 2935959822 | 2935961811 | 260 |
| 70 | iso_pu_bacteria | 2935967501 | 2935968662 | 260 |
| 71 | iso_pu_bacteria | 2935992306 | 2935996623 | 260 |
| 72 | iso_pu_bacteria | 2936002035 | 2936003896 | 260 |
| 73 | iso_pu_bacteria | 2941538514 | 2941539487 | 260 |
| 74 | iso_pu_bacteria | 3005506211 | 3005507932 | 260 |
| 75 | iso_pu_bacteria | 8016583857 | 8016588874 | 260 |
| 76 | iso_pu_bacteria | 8017057580 | 8017063972 | 260 |
| 77 | iso_pu_bacteria | 8019687851 | 8019694332 | 260 |
| 78 | 3300025912 | Ga0207707_10417354 | Ga0207707_104173542 | 261 |
| 79 | 3300025921 | Ga0207652_10081935 | Ga0207652_100819352 | 261 |
| 80 | iso_pu_bacteria | 2821443989 | 2821449621 | 261 |
| 81 | iso_pu_bacteria | 2844533157 | 2844538776 | 261 |
| 82 | 3300005327 | Ga0070658_10175458 | Ga0070658_101754582 | 262 |
| 83 | 3300005441 | Ga0070700_100071135 | Ga0070700_1000711352 | 262 |
| 84 | 3300005617 | Ga0068859_100008372 | Ga0068859_10000837210 | 262 |
| 85 | 3300006931 | Ga0097620_100008372 | Ga0097620_10000837210 | 262 |
| 86 | 3300009094 | Ga0111539_10055725 | Ga0111539_100557252 | 262 |
| 87 | 3300009094 | Ga0111539_10687992 | Ga0111539_106879922 | 262 |
| 88 | 3300009147 | Ga0114129_10204573 | Ga0114129_102045732 | 262 |
| 89 | 3300026075 | Ga0207708_10095815 | Ga0207708_100958152 | 262 |
| 90 | 3300031250 | Ga0265331_10015988 | Ga0265331_100159885 | 262 |
| 91 | 3300031595 | Ga0265313_10019402 | Ga0265313_100194025 | 262 |
| 92 | 3300036401 | Ga0373937_0647004 | Ga0373937_0647004_134_922 | 262 |
| 93 | 3300042876 | Ga0451577_0340420 | Ga0451577_0340420_309_1097 | 262 |
| 94 | 3300049571 | Ga0501034_0044434 | Ga0501034_0044434_1815_2603 | 262 |
| 95 | 3300049572 | Ga0501036_0123251 | Ga0501036_0123251_1091_1879 | 262 |
| 96 | 3300049579 | Ga0501043_0028245 | Ga0501043_0028245_1388_2176 | 262 |
| 97 | 3300049580 | Ga0501046_0374667 | Ga0501046_0374667_30_818 | 262 |
| 98 | 3300049823 | Ga0501044_0107643 | Ga0501044_0107643_714_1502 | 262 |
| 99 | 3300050507 | nmdc:mga05p37_133005_c1 | nmdc:mga05p37_133005_c1_1865_2653 | 262 |
| 100 | 3300050511 | nmdc:mga08y16_14765_c1 | nmdc:mga08y16_14765_c1_761_1552 | 262 |
| 101 | iso_pu_bacteria | 2874590934 | 2874597951 | 262 |
| 102 | iso_pu_bacteria | 2876771140 | 2876776551 | 262 |
| 103 | iso_pu_bacteria | 2876818435 | 2876824859 | 262 |
| 104 | iso_pu_bacteria | 2879074833 | 2879081586 | 262 |
| 105 | 3300005334 | Ga0068869_100598493 | Ga0068869_1005984931 | 263 |
| 106 | 3300005336 | Ga0070680_100042488 | Ga0070680_1000424883 | 263 |
| 107 | 3300005353 | Ga0070669_100333787 | Ga0070669_1003337872 | 263 |
| 108 | 3300005354 | Ga0070675_100042464 | Ga0070675_1000424642 | 263 |
| 109 | 3300005365 | Ga0070688_100160284 | Ga0070688_1001602842 | 263 |
| 110 | 3300005367 | Ga0070667_100681990 | Ga0070667_1006819901 | 263 |
| 111 | 3300005436 | Ga0070713_100158783 | Ga0070713_1001587831 | 263 |
| 112 | 3300005458 | Ga0070681_10116369 | Ga0070681_101163692 | 263 |
| 113 | 3300005471 | Ga0070698_100083208 | Ga0070698_1000832082 | 263 |
| 114 | 3300005530 | Ga0070679_100017188 | Ga0070679_1000171882 | 263 |
| 115 | 3300005536 | Ga0070697_100020296 | Ga0070697_1000202968 | 263 |
| 116 | 3300005841 | Ga0068863_100136353 | Ga0068863_1001363532 | 263 |
| 117 | 3300005842 | Ga0068858_100359363 | Ga0068858_1003593632 | 263 |
| 118 | 3300005843 | Ga0068860_100750349 | Ga0068860_1007503491 | 263 |
| 119 | 3300005981 | Ga0081538_10016756 | Ga0081538_100167564 | 263 |
| 120 | 3300005981 | Ga0081538_10121911 | Ga0081538_101219112 | 263 |
| 121 | 3300005985 | Ga0081539_10132688 | Ga0081539_101326882 | 263 |
| 122 | 3300006028 | Ga0070717_10228163 | Ga0070717_102281632 | 263 |
| 123 | 3300006028 | Ga0070717_10519149 | Ga0070717_105191492 | 263 |
| 124 | 3300006186 | Ga0075369_10038635 | Ga0075369_100386352 | 263 |
| 125 | 3300006353 | Ga0075370_10009458 | Ga0075370_100094584 | 263 |
| 126 | 3300007788 | Ga0099795_10052608 | Ga0099795_100526082 | 263 |
| 127 | 3300009093 | Ga0105240_10609131 | Ga0105240_106091312 | 263 |
| 128 | 3300009093 | Ga0105240_10696607 | Ga0105240_106966071 | 263 |
| 129 | 3300009545 | Ga0105237_10035864 | Ga0105237_100358642 | 263 |
| 130 | 3300013307 | Ga0157372_10253999 | Ga0157372_102539992 | 263 |
| 131 | 3300014969 | Ga0157376_10219194 | Ga0157376_102191942 | 263 |
| 132 | 3300021388 | Ga0213875_10008711 | Ga0213875_100087114 | 263 |
| 133 | 3300021388 | Ga0213875_10148721 | Ga0213875_101487212 | 263 |
| 134 | 3300025254 | Ga0209148_1000268 | Ga0209148_100026840 | 263 |
| 135 | 3300025272 | Ga0209455_1001518 | Ga0209455_10015189 | 263 |
| 136 | 3300025913 | Ga0207695_10332057 | Ga0207695_103320571 | 263 |
| 137 | 3300025917 | Ga0207660_10038214 | Ga0207660_100382143 | 263 |
| 138 | 3300025922 | Ga0207646_10031412 | Ga0207646_100314122 | 263 |
| 139 | 3300025923 | Ga0207681_10147730 | Ga0207681_101477302 | 263 |
| 140 | 3300025925 | Ga0207650_10151267 | Ga0207650_101512672 | 263 |
| 141 | 3300025926 | Ga0207659_10004576 | Ga0207659_100045764 | 263 |
| 142 | 3300025928 | Ga0207700_10028357 | Ga0207700_100283574 | 263 |
| 143 | 3300025936 | Ga0207670_10605820 | Ga0207670_106058201 | 263 |
| 144 | 3300025939 | Ga0207665_10153884 | Ga0207665_101538842 | 263 |
| 145 | 3300025940 | Ga0207691_10082777 | Ga0207691_100827771 | 263 |
| 146 | 3300025942 | Ga0207689_10230450 | Ga0207689_102304502 | 263 |
| 147 | 3300025942 | Ga0207689_10326940 | Ga0207689_103269401 | 263 |
| 148 | 3300025986 | Ga0207658_10583269 | Ga0207658_105832691 | 263 |
| 149 | 3300026035 | Ga0207703_10157254 | Ga0207703_101572542 | 263 |
| 150 | 3300026088 | Ga0207641_10229358 | Ga0207641_102293581 | 263 |
| 151 | 3300026095 | Ga0207676_10372504 | Ga0207676_103725042 | 263 |
| 152 | 3300026142 | Ga0207698_10110170 | Ga0207698_101101702 | 263 |
| 153 | 3300028380 | Ga0268265_10334580 | Ga0268265_103345802 | 263 |
| 154 | 3300028381 | Ga0268264_10263045 | Ga0268264_102630452 | 263 |
| 155 | 3300028558 | Ga0265326_10046553 | Ga0265326_100465532 | 263 |
| 156 | 3300030521 | Ga0307511_10018066 | Ga0307511_100180667 | 263 |
| 157 | 3300031251 | Ga0265327_10022910 | Ga0265327_100229104 | 263 |
| 158 | 3300031665 | Ga0316575_10029533 | Ga0316575_100295331 | 263 |
| 159 | 3300035083 | Ga0373926_0006701 | Ga0373926_0006701_1723_2514 | 263 |
| 160 | 3300035083 | Ga0373926_0083093 | Ga0373926_0083093_378_1169 | 263 |
| 161 | 3300035241 | Ga0373961_0000005 | Ga0373961_0000005_106572_107366 | 263 |
| 162 | 3300035692 | Ga0373935_0090574 | Ga0373935_0090574_59_850 | 263 |
| 163 | 3300035692 | Ga0373935_0147227 | Ga0373935_0147227_106_897 | 263 |
| 164 | 3300035695 | Ga0373927_0114880 | Ga0373927_0114880_311_1102 | 263 |
| 165 | 3300035725 | Ga0373947_0032416 | Ga0373947_0032416_1743_2534 | 263 |
| 166 | 3300037068 | Ga0373925_0038518 | Ga0373925_0038518_2669_3460 | 263 |
| 167 | 3300037471 | Ga0395905_0004055 | Ga0395905_0004055_6918_7709 | 263 |
| 168 | 3300037853 | Ga0436364_0891296 | Ga0436364_0891296_936_1727 | 263 |
| 169 | 3300037853 | Ga0436364_1360422 | Ga0436364_1360422_13904_14695 | 263 |
| 170 | 3300039437 | Ga0436365_0801734 | Ga0436365_0801734_161_952 | 263 |
| 171 | 3300039447 | Ga0436361_1170458 | Ga0436361_1170458_12207_13001 | 263 |
| 172 | 3300039453 | Ga0436362_1262338 | Ga0436362_1262338_952_1743 | 263 |
| 173 | 3300042532 | Ga0450893_0003697 | Ga0450893_0003697_118_915 | 263 |
| 174 | 3300045051 | Ga0451576_0580753 | Ga0451576_0580753_133_939 | 263 |
| 175 | 3300046472 | Ga0495580_0038311 | Ga0495580_0038311_1642_2433 | 263 |
| 176 | 3300046535 | Ga0495586_0316325 | Ga0495586_0316325_40_831 | 263 |
| 177 | 3300046559 | Ga0495667_0038220 | Ga0495667_0038220_2388_3179 | 263 |
| 178 | 3300046663 | Ga0495635_0089090 | Ga0495635_0089090_1187_1978 | 263 |
| 179 | 3300046809 | Ga0495600_0052340 | Ga0495600_0052340_269_1060 | 263 |
| 180 | 3300048907 | Ga0496104_0005443 | Ga0496104_0005443_270_1082 | 263 |
| 181 | 3300048912 | Ga0496109_0561951 | Ga0496109_0561951_268_1059 | 263 |
| 182 | 3300048929 | Ga0496126_0113234 | Ga0496126_0113234_1175_1966 | 263 |
| 183 | 3300049569 | Ga0501032_0250360 | Ga0501032_0250360_142_933 | 263 |
| 184 | 3300049576 | Ga0501040_0315472 | Ga0501040_0315472_149_940 | 263 |
| 185 | 3300049589 | Ga0501073_0286798 | Ga0501073_0286798_294_1085 | 263 |
| 186 | 3300049823 | Ga0501044_0000140 | Ga0501044_0000140_26742_27539 | 263 |
| 187 | 3300050493 | nmdc:mga0k408_17471_c2 | nmdc:mga0k408_17471_c2_2094_2885 | 263 |
| 188 | 3300050494 | nmdc:mga06z11_110122_c1 | nmdc:mga06z11_110122_c1_406_1197 | 263 |
| 189 | 3300050496 | nmdc:mga07m45_21233_c1 | nmdc:mga07m45_21233_c1_352_1143 | 263 |
| 190 | 3300053077 | Ga0495601_0023238 | Ga0495601_0023238_2381_3172 | 263 |
| 191 | 3300053084 | Ga0495595_0032645 | Ga0495595_0032645_1493_2284 | 263 |
| 192 | 3300053085 | Ga0495619_0017391 | Ga0495619_0017391_1627_2418 | 263 |
| 193 | 3300053092 | Ga0500583_0021676 | Ga0500583_0021676_1481_2272 | 263 |
| 194 | 3300053130 | Ga0500642_0078554 | Ga0500642_0078554_589_1383 | 263 |
| 195 | 3300003792 | Ga0055540_1006370 | Ga0055540_10063703 | 264 |
| 196 | 3300003794 | Ga0055531_10000205 | Ga0055531_1000020520 | 264 |
| 197 | 3300005327 | Ga0070658_10027472 | Ga0070658_100274722 | 264 |
| 198 | 3300005327 | Ga0070658_10202452 | Ga0070658_102024522 | 264 |
| 199 | 3300005328 | Ga0070676_10174605 | Ga0070676_101746052 | 264 |
| 200 | 3300005328 | Ga0070676_10195709 | Ga0070676_101957092 | 264 |
| 201 | 3300005329 | Ga0070683_100097755 | Ga0070683_1000977552 | 264 |
| 202 | 3300005330 | Ga0070690_100000993 | Ga0070690_1000009933 | 264 |
| 203 | 3300005331 | Ga0070670_100078478 | Ga0070670_1000784782 | 264 |
| 204 | 3300005331 | Ga0070670_100144274 | Ga0070670_1001442742 | 264 |
| 205 | 3300005331 | Ga0070670_100346042 | Ga0070670_1003460422 | 264 |
| 206 | 3300005331 | Ga0070670_100392517 | Ga0070670_1003925171 | 264 |
| 207 | 3300005334 | Ga0068869_100003070 | Ga0068869_1000030706 | 264 |
| 208 | 3300005335 | Ga0070666_10143370 | Ga0070666_101433702 | 264 |
| 209 | 3300005336 | Ga0070680_100002437 | Ga0070680_1000024377 | 264 |
| 210 | 3300005336 | Ga0070680_100004645 | Ga0070680_1000046453 | 264 |
| 211 | 3300005336 | Ga0070680_100095828 | Ga0070680_1000958283 | 264 |
| 212 | 3300005336 | Ga0070680_100119264 | Ga0070680_1001192642 | 264 |
| 213 | 3300005336 | Ga0070680_100202239 | Ga0070680_1002022392 | 264 |
| 214 | 3300005336 | Ga0070680_100285920 | Ga0070680_1002859202 | 264 |
| 215 | 3300005338 | Ga0068868_100157473 | Ga0068868_1001574732 | 264 |
| 216 | 3300005338 | Ga0068868_100523523 | Ga0068868_1005235232 | 264 |
| 217 | 3300005339 | Ga0070660_100025112 | Ga0070660_1000251122 | 264 |
| 218 | 3300005340 | Ga0070689_100001070 | Ga0070689_1000010701 | 264 |
| 219 | 3300005340 | Ga0070689_100162142 | Ga0070689_1001621422 | 264 |
| 220 | 3300005341 | Ga0070691_10000198 | Ga0070691_1000019813 | 264 |
| 221 | 3300005341 | Ga0070691_10004632 | Ga0070691_100046323 | 264 |
| 222 | 3300005341 | Ga0070691_10037021 | Ga0070691_100370213 | 264 |
| 223 | 3300005343 | Ga0070687_100013313 | Ga0070687_1000133135 | 264 |
| 224 | 3300005343 | Ga0070687_100035769 | Ga0070687_1000357693 | 264 |
| 225 | 3300005344 | Ga0070661_100041839 | Ga0070661_1000418393 | 264 |
| 226 | 3300005345 | Ga0070692_10037720 | Ga0070692_100377202 | 264 |
| 227 | 3300005353 | Ga0070669_100146442 | Ga0070669_1001464422 | 264 |
| 228 | 3300005353 | Ga0070669_100173512 | Ga0070669_1001735121 | 264 |
| 229 | 3300005353 | Ga0070669_100401929 | Ga0070669_1004019292 | 264 |
| 230 | 3300005354 | Ga0070675_100041829 | Ga0070675_1000418295 | 264 |
| 231 | 3300005354 | Ga0070675_100085634 | Ga0070675_1000856343 | 264 |
| 232 | 3300005354 | Ga0070675_100422423 | Ga0070675_1004224232 | 264 |
| 233 | 3300005355 | Ga0070671_100106902 | Ga0070671_1001069024 | 264 |
| 234 | 3300005355 | Ga0070671_100109547 | Ga0070671_1001095472 | 264 |
| 235 | 3300005355 | Ga0070671_100302212 | Ga0070671_1003022123 | 264 |
| 236 | 3300005355 | Ga0070671_100444094 | Ga0070671_1004440942 | 264 |
| 237 | 3300005356 | Ga0070674_100014481 | Ga0070674_1000144813 | 264 |
| 238 | 3300005356 | Ga0070674_100071836 | Ga0070674_1000718362 | 264 |
| 239 | 3300005364 | Ga0070673_100034415 | Ga0070673_1000344152 | 264 |
| 240 | 3300005364 | Ga0070673_100370303 | Ga0070673_1003703032 | 264 |
| 241 | 3300005364 | Ga0070673_100392474 | Ga0070673_1003924742 | 264 |
| 242 | 3300005366 | Ga0070659_100006542 | Ga0070659_1000065424 | 264 |
| 243 | 3300005366 | Ga0070659_100158175 | Ga0070659_1001581752 | 264 |
| 244 | 3300005366 | Ga0070659_100251560 | Ga0070659_1002515601 | 264 |
| 245 | 3300005367 | Ga0070667_100012504 | Ga0070667_1000125042 | 264 |
| 246 | 3300005367 | Ga0070667_100217006 | Ga0070667_1002170062 | 264 |
| 247 | 3300005367 | Ga0070667_100434216 | Ga0070667_1004342162 | 264 |
| 248 | 3300005367 | Ga0070667_100587091 | Ga0070667_1005870911 | 264 |
| 249 | 3300005438 | Ga0070701_10000075 | Ga0070701_1000007516 | 264 |
| 250 | 3300005438 | Ga0070701_10034226 | Ga0070701_100342262 | 264 |
| 251 | 3300005439 | Ga0070711_100275835 | Ga0070711_1002758353 | 264 |
| 252 | 3300005440 | Ga0070705_100036943 | Ga0070705_1000369431 | 264 |
| 253 | 3300005441 | Ga0070700_100002507 | Ga0070700_1000025073 | 264 |
| 254 | 3300005441 | Ga0070700_100057706 | Ga0070700_1000577062 | 264 |
| 255 | 3300005444 | Ga0070694_100008159 | Ga0070694_1000081591 | 264 |
| 256 | 3300005445 | Ga0070708_100046726 | Ga0070708_1000467263 | 264 |
| 257 | 3300005456 | Ga0070678_100060116 | Ga0070678_1000601164 | 264 |
| 258 | 3300005457 | Ga0070662_100051128 | Ga0070662_1000511282 | 264 |
| 259 | 3300005457 | Ga0070662_100063540 | Ga0070662_1000635405 | 264 |
| 260 | 3300005458 | Ga0070681_10002137 | Ga0070681_1000213715 | 264 |
| 261 | 3300005458 | Ga0070681_10002558 | Ga0070681_100025582 | 264 |
| 262 | 3300005458 | Ga0070681_10008342 | Ga0070681_1000834215 | 264 |
| 263 | 3300005458 | Ga0070681_10058698 | Ga0070681_100586984 | 264 |
| 264 | 3300005458 | Ga0070681_10074615 | Ga0070681_100746152 | 264 |
| 265 | 3300005458 | Ga0070681_10200092 | Ga0070681_102000921 | 264 |
| 266 | 3300005458 | Ga0070681_10569941 | Ga0070681_105699412 | 264 |
| 267 | 3300005458 | Ga0070681_10573808 | Ga0070681_105738082 | 264 |
| 268 | 3300005459 | Ga0068867_100000421 | Ga0068867_1000004216 | 264 |
| 269 | 3300005459 | Ga0068867_100051934 | Ga0068867_1000519342 | 264 |
| 270 | 3300005459 | Ga0068867_100222300 | Ga0068867_1002223002 | 264 |
| 271 | 3300005467 | Ga0070706_100238536 | Ga0070706_1002385362 | 264 |
| 272 | 3300005468 | Ga0070707_100383652 | Ga0070707_1003836521 | 264 |
| 273 | 3300005471 | Ga0070698_100003981 | Ga0070698_1000039818 | 264 |
| 274 | 3300005471 | Ga0070698_100054255 | Ga0070698_1000542552 | 264 |
| 275 | 3300005471 | Ga0070698_100303624 | Ga0070698_1003036242 | 264 |
| 276 | 3300005471 | Ga0070698_100841274 | Ga0070698_1008412741 | 264 |
| 277 | 3300005518 | Ga0070699_100284425 | Ga0070699_1002844252 | 264 |
| 278 | 3300005530 | Ga0070679_100003954 | Ga0070679_10000395411 | 264 |
| 279 | 3300005530 | Ga0070679_100004261 | Ga0070679_1000042613 | 264 |
| 280 | 3300005530 | Ga0070679_100064110 | Ga0070679_1000641101 | 264 |
| 281 | 3300005530 | Ga0070679_100102619 | Ga0070679_1001026193 | 264 |
| 282 | 3300005530 | Ga0070679_100137729 | Ga0070679_1001377292 | 264 |
| 283 | 3300005530 | Ga0070679_100264409 | Ga0070679_1002644092 | 264 |
| 284 | 3300005535 | Ga0070684_100042463 | Ga0070684_1000424634 | 264 |
| 285 | 3300005535 | Ga0070684_100505133 | Ga0070684_1005051332 | 264 |
| 286 | 3300005536 | Ga0070697_100251570 | Ga0070697_1002515702 | 264 |
| 287 | 3300005539 | Ga0068853_100001762 | Ga0068853_1000017626 | 264 |
| 288 | 3300005543 | Ga0070672_100065877 | Ga0070672_1000658772 | 264 |
| 289 | 3300005543 | Ga0070672_100333142 | Ga0070672_1003331422 | 264 |
| 290 | 3300005544 | Ga0070686_100000270 | Ga0070686_10000027022 | 264 |
| 291 | 3300005545 | Ga0070695_100056903 | Ga0070695_1000569032 | 264 |
| 292 | 3300005545 | Ga0070695_100446254 | Ga0070695_1004462541 | 264 |
| 293 | 3300005546 | Ga0070696_100003294 | Ga0070696_1000032944 | 264 |
| 294 | 3300005546 | Ga0070696_100233624 | Ga0070696_1002336242 | 264 |
| 295 | 3300005547 | Ga0070693_100001571 | Ga0070693_1000015716 | 264 |
| 296 | 3300005548 | Ga0070665_100002531 | Ga0070665_10000253112 | 264 |
| 297 | 3300005548 | Ga0070665_100157564 | Ga0070665_1001575642 | 264 |
| 298 | 3300005548 | Ga0070665_100549650 | Ga0070665_1005496501 | 264 |
| 299 | 3300005549 | Ga0070704_100066824 | Ga0070704_1000668242 | 264 |
| 300 | 3300005549 | Ga0070704_100114552 | Ga0070704_1001145522 | 264 |
| 301 | 3300005563 | Ga0068855_100005088 | Ga0068855_10000508812 | 264 |
| 302 | 3300005563 | Ga0068855_100022196 | Ga0068855_1000221963 | 264 |
| 303 | 3300005563 | Ga0068855_100121708 | Ga0068855_1001217082 | 264 |
| 304 | 3300005563 | Ga0068855_100340451 | Ga0068855_1003404512 | 264 |
| 305 | 3300005563 | Ga0068855_100758550 | Ga0068855_1007585502 | 264 |
| 306 | 3300005563 | Ga0068855_100768800 | Ga0068855_1007688001 | 264 |
| 307 | 3300005564 | Ga0070664_100033863 | Ga0070664_1000338632 | 264 |
| 308 | 3300005577 | Ga0068857_100006255 | Ga0068857_1000062553 | 264 |
| 309 | 3300005577 | Ga0068857_100012178 | Ga0068857_1000121785 | 264 |
| 310 | 3300005577 | Ga0068857_100118282 | Ga0068857_1001182822 | 264 |
| 311 | 3300005577 | Ga0068857_100227096 | Ga0068857_1002270962 | 264 |
| 312 | 3300005578 | Ga0068854_100026505 | Ga0068854_1000265055 | 264 |
| 313 | 3300005578 | Ga0068854_100135020 | Ga0068854_1001350202 | 264 |
| 314 | 3300005578 | Ga0068854_100136497 | Ga0068854_1001364972 | 264 |
| 315 | 3300005615 | Ga0070702_100000370 | Ga0070702_1000003706 | 264 |
| 316 | 3300005615 | Ga0070702_100046626 | Ga0070702_1000466262 | 264 |
| 317 | 3300005615 | Ga0070702_100085227 | Ga0070702_1000852272 | 264 |
| 318 | 3300005616 | Ga0068852_100009333 | Ga0068852_1000093331 | 264 |
| 319 | 3300005616 | Ga0068852_100194976 | Ga0068852_1001949762 | 264 |
| 320 | 3300005617 | Ga0068859_100016233 | Ga0068859_1000162333 | 264 |
| 321 | 3300005617 | Ga0068859_100226524 | Ga0068859_1002265242 | 264 |
| 322 | 3300005617 | Ga0068859_100281175 | Ga0068859_1002811752 | 264 |
| 323 | 3300005617 | Ga0068859_100355715 | Ga0068859_1003557152 | 264 |
| 324 | 3300005617 | Ga0068859_100534335 | Ga0068859_1005343352 | 264 |
| 325 | 3300005617 | Ga0068859_100750577 | Ga0068859_1007505772 | 264 |
| 326 | 3300005618 | Ga0068864_100109023 | Ga0068864_1001090234 | 264 |
| 327 | 3300005718 | Ga0068866_10000249 | Ga0068866_100002498 | 264 |
| 328 | 3300005718 | Ga0068866_10026604 | Ga0068866_100266042 | 264 |
| 329 | 3300005719 | Ga0068861_100005107 | Ga0068861_1000051073 | 264 |
| 330 | 3300005719 | Ga0068861_100459377 | Ga0068861_1004593771 | 264 |
| 331 | 3300005834 | Ga0068851_10028875 | Ga0068851_100288754 | 264 |
| 332 | 3300005842 | Ga0068858_100010505 | Ga0068858_1000105057 | 264 |
| 333 | 3300005842 | Ga0068858_100243912 | Ga0068858_1002439122 | 264 |
| 334 | 3300005843 | Ga0068860_100309804 | Ga0068860_1003098041 | 264 |
| 335 | 3300005843 | Ga0068860_100343963 | Ga0068860_1003439631 | 264 |
| 336 | 3300005844 | Ga0068862_100001761 | Ga0068862_10000176117 | 264 |
| 337 | 3300005844 | Ga0068862_100055175 | Ga0068862_1000551752 | 264 |
| 338 | 3300005844 | Ga0068862_100107662 | Ga0068862_1001076622 | 264 |
| 339 | 3300005937 | Ga0081455_10003323 | Ga0081455_100033233 | 264 |
| 340 | 3300005937 | Ga0081455_10006621 | Ga0081455_100066213 | 264 |
| 341 | 3300005937 | Ga0081455_10009487 | Ga0081455_100094873 | 264 |
| 342 | 3300005937 | Ga0081455_10400814 | Ga0081455_104008141 | 264 |
| 343 | 3300005985 | Ga0081539_10004821 | Ga0081539_100048216 | 264 |
| 344 | 3300006028 | Ga0070717_10015233 | Ga0070717_100152332 | 264 |
| 345 | 3300006038 | Ga0075365_10025403 | Ga0075365_100254033 | 264 |
| 346 | 3300006038 | Ga0075365_10039511 | Ga0075365_100395112 | 264 |
| 347 | 3300006038 | Ga0075365_10202862 | Ga0075365_102028622 | 264 |
| 348 | 3300006048 | Ga0075363_100053182 | Ga0075363_1000531822 | 264 |
| 349 | 3300006173 | Ga0070716_100164613 | Ga0070716_1001646132 | 264 |
| 350 | 3300006175 | Ga0070712_100004370 | Ga0070712_1000043708 | 264 |
| 351 | 3300006175 | Ga0070712_100007601 | Ga0070712_1000076013 | 264 |
| 352 | 3300006177 | Ga0075362_10003442 | Ga0075362_100034426 | 264 |
| 353 | 3300006177 | Ga0075362_10019652 | Ga0075362_100196522 | 264 |
| 354 | 3300006177 | Ga0075362_10067503 | Ga0075362_100675031 | 264 |
| 355 | 3300006178 | Ga0075367_10116215 | Ga0075367_101162152 | 264 |
| 356 | 3300006186 | Ga0075369_10006384 | Ga0075369_100063843 | 264 |
| 357 | 3300006186 | Ga0075369_10012486 | Ga0075369_100124862 | 264 |
| 358 | 3300006195 | Ga0075366_10059945 | Ga0075366_100599452 | 264 |
| 359 | 3300006195 | Ga0075366_10076888 | Ga0075366_100768881 | 264 |
| 360 | 3300006237 | Ga0097621_100001920 | Ga0097621_1000019208 | 264 |
| 361 | 3300006237 | Ga0097621_100192732 | Ga0097621_1001927322 | 264 |
| 362 | 3300006237 | Ga0097621_100221057 | Ga0097621_1002210572 | 264 |
| 363 | 3300006353 | Ga0075370_10101359 | Ga0075370_101013591 | 264 |
| 364 | 3300006358 | Ga0068871_100012239 | Ga0068871_1000122396 | 264 |
| 365 | 3300006358 | Ga0068871_100074754 | Ga0068871_1000747542 | 264 |
| 366 | 3300006847 | Ga0075431_100006873 | Ga0075431_1000068734 | 264 |
| 367 | 3300006881 | Ga0068865_100009147 | Ga0068865_1000091472 | 264 |
| 368 | 3300006931 | Ga0097620_100016233 | Ga0097620_1000162333 | 264 |
| 369 | 3300006931 | Ga0097620_100226515 | Ga0097620_1002265152 | 264 |
| 370 | 3300006931 | Ga0097620_100281175 | Ga0097620_1002811752 | 264 |
| 371 | 3300006931 | Ga0097620_100355724 | Ga0097620_1003557241 | 264 |
| 372 | 3300006931 | Ga0097620_100534359 | Ga0097620_1005343591 | 264 |
| 373 | 3300006931 | Ga0097620_100750554 | Ga0097620_1007505542 | 264 |
| 374 | 3300009093 | Ga0105240_10031426 | Ga0105240_100314262 | 264 |
| 375 | 3300009093 | Ga0105240_10075931 | Ga0105240_100759313 | 264 |
| 376 | 3300009094 | Ga0111539_10000450 | Ga0111539_1000045043 | 264 |
| 377 | 3300009094 | Ga0111539_10188308 | Ga0111539_101883082 | 264 |
| 378 | 3300009098 | Ga0105245_10001133 | Ga0105245_1000113319 | 264 |
| 379 | 3300009148 | Ga0105243_10000923 | Ga0105243_1000092324 | 264 |
| 380 | 3300009148 | Ga0105243_10130178 | Ga0105243_101301783 | 264 |
| 381 | 3300009176 | Ga0105242_10316141 | Ga0105242_103161412 | 264 |
| 382 | 3300009177 | Ga0105248_10031448 | Ga0105248_100314483 | 264 |
| 383 | 3300009177 | Ga0105248_10117808 | Ga0105248_101178082 | 264 |
| 384 | 3300009177 | Ga0105248_10182969 | Ga0105248_101829692 | 264 |
| 385 | 3300009177 | Ga0105248_10663696 | Ga0105248_106636962 | 264 |
| 386 | 3300009545 | Ga0105237_10017697 | Ga0105237_100176974 | 264 |
| 387 | 3300009551 | Ga0105238_10008348 | Ga0105238_100083489 | 264 |
| 388 | 3300009551 | Ga0105238_10063704 | Ga0105238_100637042 | 264 |
| 389 | 3300010375 | Ga0105239_10006145 | Ga0105239_1000614510 | 264 |
| 390 | 3300013100 | Ga0157373_10114880 | Ga0157373_101148802 | 264 |
| 391 | 3300013102 | Ga0157371_10198788 | Ga0157371_101987882 | 264 |
| 392 | 3300013104 | Ga0157370_10003797 | Ga0157370_100037972 | 264 |
| 393 | 3300013104 | Ga0157370_10005023 | Ga0157370_100050233 | 264 |
| 394 | 3300013104 | Ga0157370_10040954 | Ga0157370_100409541 | 264 |
| 395 | 3300013104 | Ga0157370_10200945 | Ga0157370_102009452 | 264 |
| 396 | 3300013105 | Ga0157369_10855325 | Ga0157369_108553251 | 264 |
| 397 | 3300013296 | Ga0157374_10102692 | Ga0157374_101026922 | 264 |
| 398 | 3300013297 | Ga0157378_10001174 | Ga0157378_100011742 | 264 |
| 399 | 3300013297 | Ga0157378_10016742 | Ga0157378_100167428 | 264 |
| 400 | 3300013297 | Ga0157378_10095994 | Ga0157378_100959942 | 264 |
| 401 | 3300013297 | Ga0157378_10684767 | Ga0157378_106847671 | 264 |
| 402 | 3300013306 | Ga0163162_10098077 | Ga0163162_100980775 | 264 |
| 403 | 3300013307 | Ga0157372_10031749 | Ga0157372_100317495 | 264 |
| 404 | 3300013307 | Ga0157372_10168950 | Ga0157372_101689502 | 264 |
| 405 | 3300013307 | Ga0157372_10181499 | Ga0157372_101814993 | 264 |
| 406 | 3300013307 | Ga0157372_10189287 | Ga0157372_101892872 | 264 |
| 407 | 3300013308 | Ga0157375_10039302 | Ga0157375_100393022 | 264 |
| 408 | 3300013308 | Ga0157375_10076567 | Ga0157375_100765672 | 264 |
| 409 | 3300013308 | Ga0157375_10077872 | Ga0157375_100778722 | 264 |
| 410 | 3300013308 | Ga0157375_10633727 | Ga0157375_106337271 | 264 |
| 411 | 3300013308 | Ga0157375_10689949 | Ga0157375_106899491 | 264 |
| 412 | 3300014325 | Ga0163163_10288025 | Ga0163163_102880252 | 264 |
| 413 | 3300014326 | Ga0157380_10402116 | Ga0157380_104021162 | 264 |
| 414 | 3300014497 | Ga0182008_10115008 | Ga0182008_101150082 | 264 |
| 415 | 3300014968 | Ga0157379_10223278 | Ga0157379_102232783 | 264 |
| 416 | 3300014969 | Ga0157376_10161777 | Ga0157376_101617772 | 264 |
| 417 | 3300014969 | Ga0157376_10335831 | Ga0157376_103358313 | 264 |
| 418 | 3300017792 | Ga0163161_10142354 | Ga0163161_101423543 | 264 |
| 419 | 3300017792 | Ga0163161_10193103 | Ga0163161_101931032 | 264 |
| 420 | 3300020069 | Ga0197907_10899973 | Ga0197907_108999731 | 264 |
| 421 | 3300020070 | Ga0206356_10239614 | Ga0206356_102396143 | 264 |
| 422 | 3300020080 | Ga0206350_10974906 | Ga0206350_109749062 | 264 |
| 423 | 3300020082 | Ga0206353_10048251 | Ga0206353_100482512 | 264 |
| 424 | 3300020082 | Ga0206353_10327856 | Ga0206353_103278561 | 264 |
| 425 | 3300021361 | Ga0213872_10028776 | Ga0213872_100287762 | 264 |
| 426 | 3300021377 | Ga0213874_10043831 | Ga0213874_100438312 | 264 |
| 427 | 3300021384 | Ga0213876_10001938 | Ga0213876_100019388 | 264 |
| 428 | 3300021384 | Ga0213876_10237830 | Ga0213876_102378301 | 264 |
| 429 | 3300021441 | Ga0213871_10002128 | Ga0213871_100021284 | 264 |
| 430 | 3300021441 | Ga0213871_10016836 | Ga0213871_100168362 | 264 |
| 431 | 3300022467 | Ga0224712_10046689 | Ga0224712_100466891 | 264 |
| 432 | 3300022467 | Ga0224712_10197279 | Ga0224712_101972791 | 264 |
| 433 | 3300025273 | Ga0209673_1050415 | Ga0209673_10504152 | 264 |
| 434 | 3300025302 | Ga0207426_1014765 | Ga0207426_10147652 | 264 |
| 435 | 3300025303 | Ga0209051_1000310 | Ga0209051_100031057 | 264 |
| 436 | 3300025304 | Ga0209257_1000165 | Ga0209257_1000165138 | 264 |
| 437 | 3300025321 | Ga0207656_10026144 | Ga0207656_100261442 | 264 |
| 438 | 3300025893 | Ga0207682_10002243 | Ga0207682_100022434 | 264 |
| 439 | 3300025899 | Ga0207642_10003143 | Ga0207642_100031433 | 264 |
| 440 | 3300025903 | Ga0207680_10019191 | Ga0207680_100191912 | 264 |
| 441 | 3300025903 | Ga0207680_10032431 | Ga0207680_100324312 | 264 |
| 442 | 3300025903 | Ga0207680_10052566 | Ga0207680_100525664 | 264 |
| 443 | 3300025905 | Ga0207685_10218323 | Ga0207685_102183231 | 264 |
| 444 | 3300025906 | Ga0207699_10053259 | Ga0207699_100532592 | 264 |
| 445 | 3300025906 | Ga0207699_10078691 | Ga0207699_100786912 | 264 |
| 446 | 3300025906 | Ga0207699_10080514 | Ga0207699_100805142 | 264 |
| 447 | 3300025906 | Ga0207699_10437270 | Ga0207699_104372701 | 264 |
| 448 | 3300025909 | Ga0207705_10000714 | Ga0207705_1000071420 | 264 |
| 449 | 3300025909 | Ga0207705_10003763 | Ga0207705_100037633 | 264 |
| 450 | 3300025909 | Ga0207705_10326461 | Ga0207705_103264612 | 264 |
| 451 | 3300025910 | Ga0207684_10149915 | Ga0207684_101499153 | 264 |
| 452 | 3300025912 | Ga0207707_10001526 | Ga0207707_1000152624 | 264 |
| 453 | 3300025912 | Ga0207707_10002213 | Ga0207707_1000221313 | 264 |
| 454 | 3300025912 | Ga0207707_10015649 | Ga0207707_100156497 | 264 |
| 455 | 3300025912 | Ga0207707_10016341 | Ga0207707_100163413 | 264 |
| 456 | 3300025912 | Ga0207707_10027081 | Ga0207707_100270815 | 264 |
| 457 | 3300025912 | Ga0207707_10049872 | Ga0207707_100498724 | 264 |
| 458 | 3300025912 | Ga0207707_10093743 | Ga0207707_100937432 | 264 |
| 459 | 3300025912 | Ga0207707_10573626 | Ga0207707_105736262 | 264 |
| 460 | 3300025912 | Ga0207707_10638402 | Ga0207707_106384021 | 264 |
| 461 | 3300025913 | Ga0207695_10014722 | Ga0207695_100147224 | 264 |
| 462 | 3300025913 | Ga0207695_10306311 | Ga0207695_103063112 | 264 |
| 463 | 3300025915 | Ga0207693_10003170 | Ga0207693_1000317013 | 264 |
| 464 | 3300025915 | Ga0207693_10019311 | Ga0207693_100193116 | 264 |
| 465 | 3300025915 | Ga0207693_10070608 | Ga0207693_100706083 | 264 |
| 466 | 3300025917 | Ga0207660_10001236 | Ga0207660_1000123615 | 264 |
| 467 | 3300025917 | Ga0207660_10007598 | Ga0207660_100075982 | 264 |
| 468 | 3300025917 | Ga0207660_10082014 | Ga0207660_100820141 | 264 |
| 469 | 3300025917 | Ga0207660_10096220 | Ga0207660_100962202 | 264 |
| 470 | 3300025918 | Ga0207662_10027376 | Ga0207662_100273764 | 264 |
| 471 | 3300025919 | Ga0207657_10000554 | Ga0207657_1000055420 | 264 |
| 472 | 3300025919 | Ga0207657_10152751 | Ga0207657_101527512 | 264 |
| 473 | 3300025919 | Ga0207657_10482859 | Ga0207657_104828591 | 264 |
| 474 | 3300025921 | Ga0207652_10002084 | Ga0207652_100020843 | 264 |
| 475 | 3300025921 | Ga0207652_10002621 | Ga0207652_1000262113 | 264 |
| 476 | 3300025921 | Ga0207652_10358883 | Ga0207652_103588831 | 264 |
| 477 | 3300025921 | Ga0207652_10471214 | Ga0207652_104712141 | 264 |
| 478 | 3300025922 | Ga0207646_10542279 | Ga0207646_105422792 | 264 |
| 479 | 3300025923 | Ga0207681_10296968 | Ga0207681_102969682 | 264 |
| 480 | 3300025924 | Ga0207694_10008861 | Ga0207694_100088615 | 264 |
| 481 | 3300025924 | Ga0207694_10043329 | Ga0207694_100433292 | 264 |
| 482 | 3300025924 | Ga0207694_10482601 | Ga0207694_104826012 | 264 |
| 483 | 3300025925 | Ga0207650_10054109 | Ga0207650_100541092 | 264 |
| 484 | 3300025925 | Ga0207650_10301960 | Ga0207650_103019601 | 264 |
| 485 | 3300025925 | Ga0207650_10458776 | Ga0207650_104587761 | 264 |
| 486 | 3300025926 | Ga0207659_10009302 | Ga0207659_100093022 | 264 |
| 487 | 3300025926 | Ga0207659_10039743 | Ga0207659_100397432 | 264 |
| 488 | 3300025926 | Ga0207659_10415904 | Ga0207659_104159042 | 264 |
| 489 | 3300025927 | Ga0207687_10001219 | Ga0207687_100012193 | 264 |
| 490 | 3300025927 | Ga0207687_10434099 | Ga0207687_104340992 | 264 |
| 491 | 3300025927 | Ga0207687_10560973 | Ga0207687_105609732 | 264 |
| 492 | 3300025928 | Ga0207700_10158135 | Ga0207700_101581352 | 264 |
| 493 | 3300025928 | Ga0207700_10727687 | Ga0207700_107276871 | 264 |
| 494 | 3300025929 | Ga0207664_10069875 | Ga0207664_100698752 | 264 |
| 495 | 3300025931 | Ga0207644_10059554 | Ga0207644_100595541 | 264 |
| 496 | 3300025931 | Ga0207644_10115785 | Ga0207644_101157852 | 264 |
| 497 | 3300025931 | Ga0207644_10325039 | Ga0207644_103250392 | 264 |
| 498 | 3300025932 | Ga0207690_10009385 | Ga0207690_100093855 | 264 |
| 499 | 3300025932 | Ga0207690_10072916 | Ga0207690_100729162 | 264 |
| 500 | 3300025933 | Ga0207706_10113911 | Ga0207706_101139112 | 264 |
| 501 | 3300025934 | Ga0207686_10137112 | Ga0207686_101371122 | 264 |
| 502 | 3300025935 | Ga0207709_10011909 | Ga0207709_100119093 | 264 |
| 503 | 3300025937 | Ga0207669_10153820 | Ga0207669_101538202 | 264 |
| 504 | 3300025937 | Ga0207669_10209518 | Ga0207669_102095182 | 264 |
| 505 | 3300025938 | Ga0207704_10001122 | Ga0207704_100011228 | 264 |
| 506 | 3300025940 | Ga0207691_10002172 | Ga0207691_1000217218 | 264 |
| 507 | 3300025940 | Ga0207691_10026903 | Ga0207691_100269034 | 264 |
| 508 | 3300025941 | Ga0207711_10131630 | Ga0207711_101316302 | 264 |
| 509 | 3300025942 | Ga0207689_10001864 | Ga0207689_1000186416 | 264 |
| 510 | 3300025942 | Ga0207689_10029957 | Ga0207689_100299571 | 264 |
| 511 | 3300025944 | Ga0207661_10557089 | Ga0207661_105570892 | 264 |
| 512 | 3300025945 | Ga0207679_10059987 | Ga0207679_100599872 | 264 |
| 513 | 3300025949 | Ga0207667_10014788 | Ga0207667_100147883 | 264 |
| 514 | 3300025949 | Ga0207667_10034440 | Ga0207667_100344403 | 264 |
| 515 | 3300025949 | Ga0207667_10106521 | Ga0207667_101065212 | 264 |
| 516 | 3300025960 | Ga0207651_10400543 | Ga0207651_104005431 | 264 |
| 517 | 3300025972 | Ga0207668_10243654 | Ga0207668_102436542 | 264 |
| 518 | 3300025972 | Ga0207668_10381495 | Ga0207668_103814951 | 264 |
| 519 | 3300025981 | Ga0207640_10051216 | Ga0207640_100512162 | 264 |
| 520 | 3300025981 | Ga0207640_10232307 | Ga0207640_102323073 | 264 |
| 521 | 3300025981 | Ga0207640_10333769 | Ga0207640_103337692 | 264 |
| 522 | 3300025986 | Ga0207658_10064281 | Ga0207658_100642813 | 264 |
| 523 | 3300025986 | Ga0207658_10317673 | Ga0207658_103176732 | 264 |
| 524 | 3300026023 | Ga0207677_10642135 | Ga0207677_106421351 | 264 |
| 525 | 3300026035 | Ga0207703_10026898 | Ga0207703_100268982 | 264 |
| 526 | 3300026035 | Ga0207703_10074623 | Ga0207703_100746233 | 264 |
| 527 | 3300026035 | Ga0207703_10136939 | Ga0207703_101369392 | 264 |
| 528 | 3300026041 | Ga0207639_10002688 | Ga0207639_100026882 | 264 |
| 529 | 3300026041 | Ga0207639_10370068 | Ga0207639_103700682 | 264 |
| 530 | 3300026075 | Ga0207708_10005526 | Ga0207708_100055267 | 264 |
| 531 | 3300026075 | Ga0207708_10007313 | Ga0207708_100073135 | 264 |
| 532 | 3300026075 | Ga0207708_10184778 | Ga0207708_101847782 | 264 |
| 533 | 3300026078 | Ga0207702_10090140 | Ga0207702_100901402 | 264 |
| 534 | 3300026078 | Ga0207702_10390982 | Ga0207702_103909822 | 264 |
| 535 | 3300026089 | Ga0207648_10030105 | Ga0207648_100301057 | 264 |
| 536 | 3300026089 | Ga0207648_10067938 | Ga0207648_100679383 | 264 |
| 537 | 3300026095 | Ga0207676_10145747 | Ga0207676_101457472 | 264 |
| 538 | 3300026116 | Ga0207674_10026028 | Ga0207674_100260286 | 264 |
| 539 | 3300026116 | Ga0207674_10027483 | Ga0207674_100274836 | 264 |
| 540 | 3300026116 | Ga0207674_10032578 | Ga0207674_100325783 | 264 |
| 541 | 3300026116 | Ga0207674_10136898 | Ga0207674_101368982 | 264 |
| 542 | 3300026116 | Ga0207674_10342544 | Ga0207674_103425442 | 264 |
| 543 | 3300026118 | Ga0207675_100000234 | Ga0207675_10000023424 | 264 |
| 544 | 3300026118 | Ga0207675_100043375 | Ga0207675_1000433751 | 264 |
| 545 | 3300026121 | Ga0207683_10000189 | Ga0207683_100001892 | 264 |
| 546 | 3300026121 | Ga0207683_10010770 | Ga0207683_100107707 | 264 |
| 547 | 3300026121 | Ga0207683_10446670 | Ga0207683_104466702 | 264 |
| 548 | 3300026142 | Ga0207698_10059368 | Ga0207698_100593684 | 264 |
| 549 | 3300027360 | Ga0209969_1000495 | Ga0209969_10004952 | 264 |
| 550 | 3300027364 | Ga0209967_1002629 | Ga0209967_10026292 | 264 |
| 551 | 3300027424 | Ga0209984_1014159 | Ga0209984_10141591 | 264 |
| 552 | 3300027462 | Ga0210000_1006363 | Ga0210000_10063631 | 264 |
| 553 | 3300027471 | Ga0209995_1002913 | Ga0209995_10029132 | 264 |
| 554 | 3300027543 | Ga0209999_1001275 | Ga0209999_10012755 | 264 |
| 555 | 3300027614 | Ga0209970_1015123 | Ga0209970_10151232 | 264 |
| 556 | 3300027866 | Ga0209813_10059801 | Ga0209813_100598012 | 264 |
| 557 | 3300027876 | Ga0209974_10002954 | Ga0209974_100029542 | 264 |
| 558 | 3300027907 | Ga0207428_10000169 | Ga0207428_1000016914 | 264 |
| 559 | 3300027907 | Ga0207428_10221092 | Ga0207428_102210922 | 264 |
| 560 | 3300028379 | Ga0268266_10103680 | Ga0268266_101036803 | 264 |
| 561 | 3300028379 | Ga0268266_10847951 | Ga0268266_108479511 | 264 |
| 562 | 3300028380 | Ga0268265_10359675 | Ga0268265_103596752 | 264 |
| 563 | 3300028381 | Ga0268264_10358454 | Ga0268264_103584542 | 264 |
| 564 | 3300028381 | Ga0268264_10423092 | Ga0268264_104230922 | 264 |
| 565 | 3300028800 | Ga0265338_10230119 | Ga0265338_102301192 | 264 |
| 566 | 3300028800 | Ga0265338_10255007 | Ga0265338_102550071 | 264 |
| 567 | 3300031235 | Ga0265330_10035395 | Ga0265330_100353952 | 264 |
| 568 | 3300031238 | Ga0265332_10008217 | Ga0265332_100082172 | 264 |
| 569 | 3300031238 | Ga0265332_10065391 | Ga0265332_100653912 | 264 |
| 570 | 3300031239 | Ga0265328_10003968 | Ga0265328_100039682 | 264 |
| 571 | 3300031242 | Ga0265329_10022657 | Ga0265329_100226572 | 264 |
| 572 | 3300031247 | Ga0265340_10095182 | Ga0265340_100951822 | 264 |
| 573 | 3300031250 | Ga0265331_10005807 | Ga0265331_100058078 | 264 |
| 574 | 3300031344 | Ga0265316_10235168 | Ga0265316_102351681 | 264 |
| 575 | 3300031548 | Ga0307408_100074379 | Ga0307408_1000743792 | 264 |
| 576 | 3300031711 | Ga0265314_10001600 | Ga0265314_1000160016 | 264 |
| 577 | 3300031712 | Ga0265342_10037861 | Ga0265342_100378612 | 264 |
| 578 | 3300031995 | Ga0307409_100472922 | Ga0307409_1004729222 | 264 |
| 579 | 3300032002 | Ga0307416_100161965 | Ga0307416_1001619653 | 264 |
| 580 | 3300032002 | Ga0307416_100224851 | Ga0307416_1002248512 | 264 |
| 581 | 3300032004 | Ga0307414_10107183 | Ga0307414_101071832 | 264 |
| 582 | 3300032005 | Ga0307411_10266792 | Ga0307411_102667921 | 264 |
| 583 | 3300033180 | Ga0307510_10005450 | Ga0307510_100054504 | 264 |
| 584 | 3300035111 | Ga0373923_0028341 | Ga0373923_0028341_865_1659 | 264 |
| 585 | 3300035112 | Ga0373932_0062101 | Ga0373932_0062101_160_957 | 264 |
| 586 | 3300035112 | Ga0373932_0119650 | Ga0373932_0119650_38_832 | 264 |
| 587 | 3300035118 | Ga0373954_0005019 | Ga0373954_0005019_1168_1962 | 264 |
| 588 | 3300035410 | Ga0373924_0067809 | Ga0373924_0067809_68_862 | 264 |
| 589 | 3300035691 | Ga0373931_0210651 | Ga0373931_0210651_282_1079 | 264 |
| 590 | 3300035695 | Ga0373927_0090614 | Ga0373927_0090614_608_1405 | 264 |
| 591 | 3300035695 | Ga0373927_0092990 | Ga0373927_0092990_977_1771 | 264 |
| 592 | 3300035724 | Ga0373933_0010069 | Ga0373933_0010069_4245_5039 | 264 |
| 593 | 3300035724 | Ga0373933_0175211 | Ga0373933_0175211_132_929 | 264 |
| 594 | 3300036401 | Ga0373937_0036511 | Ga0373937_0036511_1762_2556 | 264 |
| 595 | 3300036401 | Ga0373937_0049639 | Ga0373937_0049639_1604_2398 | 264 |
| 596 | 3300036401 | Ga0373937_0057104 | Ga0373937_0057104_839_1633 | 264 |
| 597 | 3300036401 | Ga0373937_0129683 | Ga0373937_0129683_506_1303 | 264 |
| 598 | 3300036401 | Ga0373937_0377201 | Ga0373937_0377201_487_1299 | 264 |
| 599 | 3300036647 | Ga0316582_0265613 | Ga0316582_0265613_341_1135 | 264 |
| 600 | 3300037312 | Ga0395899_0026633 | Ga0395899_0026633_3080_3874 | 264 |
| 601 | 3300037312 | Ga0395899_0266641 | Ga0395899_0266641_341_1138 | 264 |
| 602 | 3300037418 | Ga0395900_0001993 | Ga0395900_0001993_131_928 | 264 |
| 603 | 3300037418 | Ga0395900_0013646 | Ga0395900_0013646_66_860 | 264 |
| 604 | 3300037418 | Ga0395900_0431173 | Ga0395900_0431173_350_1147 | 264 |
| 605 | 3300037418 | Ga0395900_0638852 | Ga0395900_0638852_142_936 | 264 |
| 606 | 3300037466 | Ga0395898_0003319 | Ga0395898_0003319_6581_7375 | 264 |
| 607 | 3300037466 | Ga0395898_0047599 | Ga0395898_0047599_3225_4022 | 264 |
| 608 | 3300037471 | Ga0395905_0000043 | Ga0395905_0000043_46233_47039 | 264 |
| 609 | 3300038443 | Ga0395901_0024450 | Ga0395901_0024450_4412_5209 | 264 |
| 610 | 3300038443 | Ga0395901_0231803 | Ga0395901_0231803_685_1482 | 264 |
| 611 | 3300038443 | Ga0395901_0381012 | Ga0395901_0381012_305_1102 | 264 |
| 612 | 3300039062 | Ga0400483_220694 | Ga0400483_220694_5340_6134 | 264 |
| 613 | 3300039437 | Ga0436365_0065739 | Ga0436365_0065739_10330_11133 | 264 |
| 614 | 3300039437 | Ga0436365_0202658 | Ga0436365_0202658_302_1096 | 264 |
| 615 | 3300039437 | Ga0436365_1116753 | Ga0436365_1116753_106_900 | 264 |
| 616 | 3300039438 | Ga0436360_0375286 | Ga0436360_0375286_74_925 | 264 |
| 617 | 3300039438 | Ga0436360_0401373 | Ga0436360_0401373_4011_4805 | 264 |
| 618 | 3300039438 | Ga0436360_0569429 | Ga0436360_0569429_125_919 | 264 |
| 619 | 3300039438 | Ga0436360_0675016 | Ga0436360_0675016_564_1358 | 264 |
| 620 | 3300039438 | Ga0436360_0696399 | Ga0436360_0696399_14467_15264 | 264 |
| 621 | 3300039438 | Ga0436360_0734197 | Ga0436360_0734197_199_993 | 264 |
| 622 | 3300039438 | Ga0436360_0871428 | Ga0436360_0871428_1504_2298 | 264 |
| 623 | 3300039438 | Ga0436360_1220716 | Ga0436360_1220716_951_1745 | 264 |
| 624 | 3300039447 | Ga0436361_0320193 | Ga0436361_0320193_4735_5529 | 264 |
| 625 | 3300039447 | Ga0436361_0446953 | Ga0436361_0446953_2186_2980 | 264 |
| 626 | 3300039447 | Ga0436361_0522153 | Ga0436361_0522153_2842_3639 | 264 |
| 627 | 3300039447 | Ga0436361_1150595 | Ga0436361_1150595_654_1451 | 264 |
| 628 | 3300039450 | Ga0436363_0199441 | Ga0436363_0199441_843_1640 | 264 |
| 629 | 3300039450 | Ga0436363_1076006 | Ga0436363_1076006_1029_1823 | 264 |
| 630 | 3300039453 | Ga0436362_0666097 | Ga0436362_0666097_269_1063 | 264 |
| 631 | 3300042156 | Ga0439446_0112096 | Ga0439446_0112096_15_827 | 264 |
| 632 | 3300042436 | Ga0439435_0070844 | Ga0439435_0070844_201_1004 | 264 |
| 633 | 3300042876 | Ga0451577_0276173 | Ga0451577_0276173_26_820 | 264 |
| 634 | 3300042876 | Ga0451577_0509393 | Ga0451577_0509393_94_894 | 264 |
| 635 | 3300044712 | Ga0453684_0582146 | Ga0453684_0582146_345_1139 | 264 |
| 636 | 3300044842 | Ga0466957_0024982 | Ga0466957_0024982_858_1655 | 264 |
| 637 | 3300045051 | Ga0451576_0001697 | Ga0451576_0001697_8680_9474 | 264 |
| 638 | 3300045976 | Ga0466967_0324809 | Ga0466967_0324809_477_1271 | 264 |
| 639 | 3300045976 | Ga0466967_0649096 | Ga0466967_0649096_32_826 | 264 |
| 640 | 3300046454 | Ga0495592_0176632 | Ga0495592_0176632_400_1194 | 264 |
| 641 | 3300046455 | Ga0495603_0128503 | Ga0495603_0128503_101_910 | 264 |
| 642 | 3300046458 | Ga0495591_025637 | Ga0495591_025637_18_821 | 264 |
| 643 | 3300046460 | Ga0495638_0000635 | Ga0495638_0000635_14836_15645 | 264 |
| 644 | 3300046460 | Ga0495638_0002699 | Ga0495638_0002699_5338_6135 | 264 |
| 645 | 3300046471 | Ga0495650_0033642 | Ga0495650_0033642_370_1179 | 264 |
| 646 | 3300046472 | Ga0495580_0347028 | Ga0495580_0347028_40_834 | 264 |
| 647 | 3300046474 | Ga0495605_0000862 | Ga0495605_0000862_10737_11546 | 264 |
| 648 | 3300046492 | Ga0495585_0020821 | Ga0495585_0020821_406_1218 | 264 |
| 649 | 3300046492 | Ga0495585_0042471 | Ga0495585_0042471_450_1259 | 264 |
| 650 | 3300046501 | Ga0495607_0024538 | Ga0495607_0024538_1193_2002 | 264 |
| 651 | 3300046512 | Ga0495610_0066217 | Ga0495610_0066217_826_1623 | 264 |
| 652 | 3300046518 | Ga0495631_0079937 | Ga0495631_0079937_471_1280 | 264 |
| 653 | 3300046523 | Ga0495644_0040755 | Ga0495644_0040755_625_1434 | 264 |
| 654 | 3300046528 | Ga0495642_0061605 | Ga0495642_0061605_547_1350 | 264 |
| 655 | 3300046537 | Ga0495598_0031141 | Ga0495598_0031141_225_1028 | 264 |
| 656 | 3300046538 | Ga0495609_0118166 | Ga0495609_0118166_197_994 | 264 |
| 657 | 3300046558 | Ga0495633_0110249 | Ga0495633_0110249_438_1241 | 264 |
| 658 | 3300046559 | Ga0495667_0079428 | Ga0495667_0079428_300_1094 | 264 |
| 659 | 3300046616 | Ga0495668_0056547 | Ga0495668_0056547_1051_1848 | 264 |
| 660 | 3300046665 | Ga0495661_0077924 | Ga0495661_0077924_680_1477 | 264 |
| 661 | 3300046678 | Ga0495599_0047278 | Ga0495599_0047278_519_1316 | 264 |
| 662 | 3300046683 | Ga0495658_0045710 | Ga0495658_0045710_1046_1849 | 264 |
| 663 | 3300046684 | Ga0495669_0001975 | Ga0495669_0001975_332_1141 | 264 |
| 664 | 3300046691 | Ga0495670_0001012 | Ga0495670_0001012_11055_11864 | 264 |
| 665 | 3300046794 | Ga0495589_0000736 | Ga0495589_0000736_4780_5589 | 264 |
| 666 | 3300047446 | Ga0495679_049887 | Ga0495679_049887_422_1231 | 264 |
| 667 | 3300048903 | Ga0496100_0051897 | Ga0496100_0051897_1045_1854 | 264 |
| 668 | 3300048905 | Ga0496102_0028584 | Ga0496102_0028584_2045_2854 | 264 |
| 669 | 3300048905 | Ga0496102_0203346 | Ga0496102_0203346_990_1802 | 264 |
| 670 | 3300048906 | Ga0496103_0005688 | Ga0496103_0005688_6224_7021 | 264 |
| 671 | 3300048906 | Ga0496103_0152077 | Ga0496103_0152077_374_1183 | 264 |
| 672 | 3300048907 | Ga0496104_0174928 | Ga0496104_0174928_845_1654 | 264 |
| 673 | 3300048909 | Ga0496106_0047743 | Ga0496106_0047743_298_1107 | 264 |
| 674 | 3300048910 | Ga0496107_0013654 | Ga0496107_0013654_2343_3152 | 264 |
| 675 | 3300048911 | Ga0496108_0011478 | Ga0496108_0011478_5334_6143 | 264 |
| 676 | 3300048913 | Ga0496110_0015076 | Ga0496110_0015076_2299_3108 | 264 |
| 677 | 3300048913 | Ga0496110_0209542 | Ga0496110_0209542_359_1162 | 264 |
| 678 | 3300048914 | Ga0496111_0022762 | Ga0496111_0022762_3153_3962 | 264 |
| 679 | 3300048916 | Ga0496113_0448431 | Ga0496113_0448431_68_865 | 264 |
| 680 | 3300048916 | Ga0496113_0460851 | Ga0496113_0460851_64_873 | 264 |
| 681 | 3300048917 | Ga0496114_0257357 | Ga0496114_0257357_485_1312 | 264 |
| 682 | 3300048922 | Ga0496119_0052118 | Ga0496119_0052118_902_1699 | 264 |
| 683 | 3300048922 | Ga0496119_0104002 | Ga0496119_0104002_366_1163 | 264 |
| 684 | 3300048923 | Ga0496120_0045785 | Ga0496120_0045785_37_834 | 264 |
| 685 | 3300048924 | Ga0496121_0053116 | Ga0496121_0053116_1017_1814 | 264 |
| 686 | 3300049568 | Ga0501031_0119705 | Ga0501031_0119705_573_1370 | 264 |
| 687 | 3300049569 | Ga0501032_0199530 | Ga0501032_0199530_362_1159 | 264 |
| 688 | 3300049570 | Ga0501033_0224465 | Ga0501033_0224465_398_1192 | 264 |
| 689 | 3300049571 | Ga0501034_0002928 | Ga0501034_0002928_16376_17173 | 264 |
| 690 | 3300049571 | Ga0501034_0411371 | Ga0501034_0411371_284_1084 | 264 |
| 691 | 3300049571 | Ga0501034_0656926 | Ga0501034_0656926_54_851 | 264 |
| 692 | 3300049572 | Ga0501036_0088895 | Ga0501036_0088895_197_994 | 264 |
| 693 | 3300049572 | Ga0501036_0093961 | Ga0501036_0093961_1543_2346 | 264 |
| 694 | 3300049572 | Ga0501036_0421246 | Ga0501036_0421246_140_955 | 264 |
| 695 | 3300049573 | Ga0501037_0032710 | Ga0501037_0032710_1814_2629 | 264 |
| 696 | 3300049573 | Ga0501037_0089750 | Ga0501037_0089750_489_1292 | 264 |
| 697 | 3300049573 | Ga0501037_0107131 | Ga0501037_0107131_508_1314 | 264 |
| 698 | 3300049573 | Ga0501037_0160141 | Ga0501037_0160141_315_1112 | 264 |
| 699 | 3300049573 | Ga0501037_0190844 | Ga0501037_0190844_489_1286 | 264 |
| 700 | 3300049574 | Ga0501038_0043380 | Ga0501038_0043380_789_1604 | 264 |
| 701 | 3300049574 | Ga0501038_0077112 | Ga0501038_0077112_31_846 | 264 |
| 702 | 3300049574 | Ga0501038_0233394 | Ga0501038_0233394_53_850 | 264 |
| 703 | 3300049575 | Ga0501039_0002641 | Ga0501039_0002641_11442_12248 | 264 |
| 704 | 3300049575 | Ga0501039_0014487 | Ga0501039_0014487_4076_4873 | 264 |
| 705 | 3300049575 | Ga0501039_0069442 | Ga0501039_0069442_1245_2042 | 264 |
| 706 | 3300049576 | Ga0501040_0015316 | Ga0501040_0015316_1002_1799 | 264 |
| 707 | 3300049576 | Ga0501040_0020278 | Ga0501040_0020278_3289_4086 | 264 |
| 708 | 3300049577 | Ga0501041_0002700 | Ga0501041_0002700_5515_6312 | 264 |
| 709 | 3300049577 | Ga0501041_0005228 | Ga0501041_0005228_6327_7130 | 264 |
| 710 | 3300049577 | Ga0501041_0014311 | Ga0501041_0014311_1513_2319 | 264 |
| 711 | 3300049577 | Ga0501041_0024556 | Ga0501041_0024556_1510_2307 | 264 |
| 712 | 3300049578 | Ga0501042_0010930 | Ga0501042_0010930_439_1236 | 264 |
| 713 | 3300049578 | Ga0501042_0048508 | Ga0501042_0048508_1350_2153 | 264 |
| 714 | 3300049578 | Ga0501042_0095921 | Ga0501042_0095921_608_1402 | 264 |
| 715 | 3300049579 | Ga0501043_0187052 | Ga0501043_0187052_478_1275 | 264 |
| 716 | 3300049579 | Ga0501043_0496979 | Ga0501043_0496979_17_814 | 264 |
| 717 | 3300049580 | Ga0501046_0023006 | Ga0501046_0023006_1260_2063 | 264 |
| 718 | 3300049580 | Ga0501046_0083389 | Ga0501046_0083389_1360_2166 | 264 |
| 719 | 3300049580 | Ga0501046_0111591 | Ga0501046_0111591_1222_2019 | 264 |
| 720 | 3300049581 | Ga0501047_0051548 | Ga0501047_0051548_1335_2135 | 264 |
| 721 | 3300049581 | Ga0501047_0167250 | Ga0501047_0167250_289_1104 | 264 |
| 722 | 3300049581 | Ga0501047_0367260 | Ga0501047_0367260_313_1110 | 264 |
| 723 | 3300049582 | Ga0501048_0006462 | Ga0501048_0006462_1471_2268 | 264 |
| 724 | 3300049582 | Ga0501048_0083437 | Ga0501048_0083437_1141_1938 | 264 |
| 725 | 3300049582 | Ga0501048_0210730 | Ga0501048_0210730_42_845 | 264 |
| 726 | 3300049583 | Ga0501067_0035467 | Ga0501067_0035467_100_900 | 264 |
| 727 | 3300049584 | Ga0501068_0188600 | Ga0501068_0188600_102_899 | 264 |
| 728 | 3300049585 | Ga0501069_0121219 | Ga0501069_0121219_321_1118 | 264 |
| 729 | 3300049586 | Ga0501070_0000033 | Ga0501070_0000033_477_1292 | 264 |
| 730 | 3300049586 | Ga0501070_0127126 | Ga0501070_0127126_1281_2078 | 264 |
| 731 | 3300049586 | Ga0501070_0172523 | Ga0501070_0172523_168_965 | 264 |
| 732 | 3300049587 | Ga0501071_0003718 | Ga0501071_0003718_4004_4807 | 264 |
| 733 | 3300049587 | Ga0501071_0021107 | Ga0501071_0021107_3158_3955 | 264 |
| 734 | 3300049587 | Ga0501071_0047761 | Ga0501071_0047761_1464_2261 | 264 |
| 735 | 3300049588 | Ga0501072_0003456 | Ga0501072_0003456_9319_10119 | 264 |
| 736 | 3300049588 | Ga0501072_0030407 | Ga0501072_0030407_932_1729 | 264 |
| 737 | 3300049588 | Ga0501072_0043434 | Ga0501072_0043434_121_924 | 264 |
| 738 | 3300049588 | Ga0501072_0060051 | Ga0501072_0060051_1568_2365 | 264 |
| 739 | 3300049589 | Ga0501073_0039675 | Ga0501073_0039675_584_1384 | 264 |
| 740 | 3300049589 | Ga0501073_0048482 | Ga0501073_0048482_246_1055 | 264 |
| 741 | 3300049589 | Ga0501073_0362019 | Ga0501073_0362019_137_934 | 264 |
| 742 | 3300049589 | Ga0501073_0484753 | Ga0501073_0484753_43_840 | 264 |
| 743 | 3300049590 | Ga0501074_0039505 | Ga0501074_0039505_968_1768 | 264 |
| 744 | 3300049591 | Ga0501075_0009891 | Ga0501075_0009891_1150_1953 | 264 |
| 745 | 3300049591 | Ga0501075_0053365 | Ga0501075_0053365_2048_2845 | 264 |
| 746 | 3300049591 | Ga0501075_0187531 | Ga0501075_0187531_290_1087 | 264 |
| 747 | 3300049592 | Ga0501076_0006358 | Ga0501076_0006358_1332_2129 | 264 |
| 748 | 3300049592 | Ga0501076_0008071 | Ga0501076_0008071_853_1650 | 264 |
| 749 | 3300049592 | Ga0501076_0018226 | Ga0501076_0018226_730_1533 | 264 |
| 750 | 3300049593 | Ga0501077_0008361 | Ga0501077_0008361_284_1087 | 264 |
| 751 | 3300049593 | Ga0501077_0034366 | Ga0501077_0034366_2340_3134 | 264 |
| 752 | 3300049593 | Ga0501077_0090319 | Ga0501077_0090319_296_1093 | 264 |
| 753 | 3300049593 | Ga0501077_0235766 | Ga0501077_0235766_297_1094 | 264 |
| 754 | 3300049741 | Ga0501079_0006027 | Ga0501079_0006027_2539_3345 | 264 |
| 755 | 3300049741 | Ga0501079_0007033 | Ga0501079_0007033_4077_4880 | 264 |
| 756 | 3300049741 | Ga0501079_0011467 | Ga0501079_0011467_2859_3656 | 264 |
| 757 | 3300049742 | Ga0501080_0003821 | Ga0501080_0003821_8543_9358 | 264 |
| 758 | 3300049742 | Ga0501080_0054137 | Ga0501080_0054137_2682_3491 | 264 |
| 759 | 3300049742 | Ga0501080_0124520 | Ga0501080_0124520_297_1097 | 264 |
| 760 | 3300049742 | Ga0501080_0192262 | Ga0501080_0192262_914_1720 | 264 |
| 761 | 3300049742 | Ga0501080_0274094 | Ga0501080_0274094_527_1324 | 264 |
| 762 | 3300049742 | Ga0501080_0283212 | Ga0501080_0283212_189_992 | 264 |
| 763 | 3300049742 | Ga0501080_0351802 | Ga0501080_0351802_356_1153 | 264 |
| 764 | 3300049743 | Ga0501081_0014806 | Ga0501081_0014806_3158_3955 | 264 |
| 765 | 3300049743 | Ga0501081_0124456 | Ga0501081_0124456_596_1393 | 264 |
| 766 | 3300049743 | Ga0501081_0429550 | Ga0501081_0429550_81_884 | 264 |
| 767 | 3300049743 | Ga0501081_0447094 | Ga0501081_0447094_127_924 | 264 |
| 768 | 3300049744 | Ga0501083_0160261 | Ga0501083_0160261_23_820 | 264 |
| 769 | 3300049822 | Ga0501035_0009931 | Ga0501035_0009931_3756_4571 | 264 |
| 770 | 3300049822 | Ga0501035_0041274 | Ga0501035_0041274_1765_2571 | 264 |
| 771 | 3300049822 | Ga0501035_0066532 | Ga0501035_0066532_1490_2287 | 264 |
| 772 | 3300049822 | Ga0501035_0551476 | Ga0501035_0551476_70_885 | 264 |
| 773 | 3300049823 | Ga0501044_0006810 | Ga0501044_0006810_4415_5230 | 264 |
| 774 | 3300049823 | Ga0501044_0105892 | Ga0501044_0105892_1236_2030 | 264 |
| 775 | 3300049823 | Ga0501044_0109780 | Ga0501044_0109780_535_1350 | 264 |
| 776 | 3300049823 | Ga0501044_0165715 | Ga0501044_0165715_864_1661 | 264 |
| 777 | 3300049823 | Ga0501044_0231248 | Ga0501044_0231248_434_1249 | 264 |
| 778 | 3300049824 | Ga0501045_0006104 | Ga0501045_0006104_4714_5511 | 264 |
| 779 | 3300049824 | Ga0501045_0011319 | Ga0501045_0011319_4212_5009 | 264 |
| 780 | 3300049824 | Ga0501045_0049915 | Ga0501045_0049915_1929_2732 | 264 |
| 781 | 3300050489 | nmdc:mga03683_28684_c1 | nmdc:mga03683_28684_c1_910_1707 | 264 |
| 782 | 3300050489 | nmdc:mga03683_9105_c1 | nmdc:mga03683_9105_c1_2068_2865 | 264 |
| 783 | 3300050490 | nmdc:mga03n38_41205_c1 | nmdc:mga03n38_41205_c1_1014_1811 | 264 |
| 784 | 3300050492 | nmdc:mga0yw44_19567_c1 | nmdc:mga0yw44_19567_c1_1118_1915 | 264 |
| 785 | 3300050492 | nmdc:mga0yw44_28226_c1 | nmdc:mga0yw44_28226_c1_383_1180 | 264 |
| 786 | 3300050492 | nmdc:mga0yw44_3416_c1 | nmdc:mga0yw44_3416_c1_3250_4047 | 264 |
| 787 | 3300050493 | nmdc:mga0k408_31758_c1 | nmdc:mga0k408_31758_c1_1054_1851 | 264 |
| 788 | 3300050494 | nmdc:mga06z11_122457_c1 | nmdc:mga06z11_122457_c1_116_913 | 264 |
| 789 | 3300050495 | nmdc:mga04h51_30041_c1 | nmdc:mga04h51_30041_c1_407_1204 | 264 |
| 790 | 3300050496 | nmdc:mga07m45_47426_c1 | nmdc:mga07m45_47426_c1_866_1663 | 264 |
| 791 | 3300050511 | nmdc:mga08y16_183864_c1 | nmdc:mga08y16_183864_c1_1285_2088 | 264 |
| 792 | 3300050511 | nmdc:mga08y16_199913_c1 | nmdc:mga08y16_199913_c1_402_1211 | 264 |
| 793 | 3300050511 | nmdc:mga08y16_34_c1 | nmdc:mga08y16_34_c1_10394_11188 | 264 |
| 794 | 3300050514 | nmdc:mga08x19_190523_c1 | nmdc:mga08x19_190523_c1_384_1181 | 264 |
| 795 | 3300050516 | nmdc:mga0sz30_7389_c1 | nmdc:mga0sz30_7389_c1_2028_2825 | 264 |
| 796 | 3300053077 | Ga0495601_0176906 | Ga0495601_0176906_202_999 | 264 |
| 797 | 3300053084 | Ga0495595_0024502 | Ga0495595_0024502_1329_2123 | 264 |
| 798 | 3300053087 | Ga0500643_000055 | Ga0500643_000055_100957_101754 | 264 |
| 799 | 3300053090 | Ga0500646_0053058 | Ga0500646_0053058_136_933 | 264 |
| 800 | 3300053093 | Ga0500651_0145463 | Ga0500651_0145463_413_1210 | 264 |
| 801 | 3300053094 | Ga0500566_0000041 | Ga0500566_0000041_61139_61936 | 264 |
| 802 | 3300053095 | Ga0500640_046848 | Ga0500640_046848_1055_1852 | 264 |
| 803 | 3300053096 | Ga0500641_0002772 | Ga0500641_0002772_3203_4000 | 264 |
| 804 | 3300053096 | Ga0500641_0051903 | Ga0500641_0051903_567_1364 | 264 |
| 805 | 3300053098 | Ga0500650_0225184 | Ga0500650_0225184_17_814 | 264 |
| 806 | 3300053103 | Ga0500555_002542 | Ga0500555_002542_566_1363 | 264 |
| 807 | 3300053105 | Ga0500557_000017 | Ga0500557_000017_22376_23173 | 264 |
| 808 | 3300053109 | Ga0500569_001055 | Ga0500569_001055_12_809 | 264 |
| 809 | 3300053111 | Ga0500572_044574 | Ga0500572_044574_40_837 | 264 |
| 810 | 3300053118 | Ga0500594_0012816 | Ga0500594_0012816_427_1224 | 264 |
| 811 | 3300053121 | Ga0500607_011787 | Ga0500607_011787_1231_2028 | 264 |
| 812 | 3300053130 | Ga0500642_0000256 | Ga0500642_0000256_16213_17010 | 264 |
| 813 | 3300053130 | Ga0500642_0042877 | Ga0500642_0042877_501_1298 | 264 |
| 814 | 3300053131 | Ga0500652_058621 | Ga0500652_058621_112_909 | 264 |
| 815 | 3300053133 | Ga0500655_024347 | Ga0500655_024347_338_1135 | 264 |
| 816 | 3300053136 | Ga0500559_0004313 | Ga0500559_0004313_3788_4585 | 264 |
| 817 | 3300053138 | Ga0500564_093418 | Ga0500564_093418_420_1217 | 264 |
| 818 | 3300053147 | Ga0500589_049178 | Ga0500589_049178_899_1696 | 264 |
| 819 | 3300053153 | Ga0500616_0000757 | Ga0500616_0000757_3391_4188 | 264 |
| 820 | 3300053155 | Ga0500620_016705 | Ga0500620_016705_383_1180 | 264 |
| 821 | 3300053162 | Ga0500638_184640 | Ga0500638_184640_49_846 | 264 |
| 822 | 3300053177 | Ga0500636_0000389 | Ga0500636_0000389_5996_6793 | 264 |
| 823 | 3300053178 | Ga0500637_0046381 | Ga0500637_0046381_264_1061 | 264 |
| 824 | 3300053729 | Ga0500625_037436 | Ga0500625_037436_1342_2139 | 264 |
| 825 | 3300053730 | Ga0500645_074449 | Ga0500645_074449_12_809 | 264 |
| 826 | 3300053736 | Ga0500599_000235 | Ga0500599_000235_2593_3390 | 264 |
| 827 | 3300053737 | Ga0500601_000091 | Ga0500601_000091_3576_4373 | 264 |
| 828 | 3300054114 | Ga0501084_0064778 | Ga0501084_0064778_327_1130 | 264 |
| 829 | 3300054114 | Ga0501084_0087470 | Ga0501084_0087470_1586_2386 | 264 |
| 830 | 3300054114 | Ga0501084_0091008 | Ga0501084_0091008_394_1188 | 264 |
| 831 | 3300054114 | Ga0501084_0155953 | Ga0501084_0155953_160_957 | 264 |
| 832 | 3300054114 | Ga0501084_0167359 | Ga0501084_0167359_572_1369 | 264 |
| 833 | 3300060353 | Ga0501082_0014435 | Ga0501082_0014435_4799_5605 | 264 |
| 834 | 3300060353 | Ga0501082_0041695 | Ga0501082_0041695_1175_1972 | 264 |
| 835 | 3300060353 | Ga0501082_0045391 | Ga0501082_0045391_2574_3368 | 264 |
| 836 | 3300060353 | Ga0501082_0095123 | Ga0501082_0095123_1040_1837 | 264 |
| 837 | 3300061734 | Ga0530510_0007292 | Ga0530510_0007292_487_1284 | 264 |
| 838 | 3300061734 | Ga0530510_0008880 | Ga0530510_0008880_394_1188 | 264 |
| 839 | 3300061734 | Ga0530510_0066403 | Ga0530510_0066403_129_926 | 264 |
| 840 | 3300061734 | Ga0530510_0189350 | Ga0530510_0189350_168_971 | 264 |
| 841 | 3300003187 | JGI25151J46595_10000581 | JGI25151J46595_1000058126 | 265 |
| 842 | 3300003215 | JGI25153J46596_10038973 | JGI25153J46596_100389731 | 265 |
| 843 | 3300003354 | JGI25160J50197_1012997 | JGI25160J50197_10129972 | 265 |
| 844 | 3300025284 | Ga0209130_1000502 | Ga0209130_10005029 | 265 |
| 845 | 3300025284 | Ga0209130_1010355 | Ga0209130_10103552 | 265 |
| 846 | 3300025294 | Ga0209025_1000077 | Ga0209025_1000077122 | 265 |
| 847 | 3300025302 | Ga0207426_1000576 | Ga0207426_100057642 | 265 |
| 848 | 3300026041 | Ga0207639_10534975 | Ga0207639_105349752 | 265 |
| 849 | 3300041997 | Ga0439431_0018837 | Ga0439431_0018837_215_1012 | 265 |
| 850 | 3300046512 | Ga0495610_0035969 | Ga0495610_0035969_1119_1916 | 265 |
| 851 | 3300048924 | Ga0496121_0193569 | Ga0496121_0193569_358_1155 | 265 |
| 852 | 3300049586 | Ga0501070_0407750 | Ga0501070_0407750_58_858 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zxi-assembly1.cif.gz_F | reconstituted co dehydrogenase from oligotropha carboxidovorans | 0.903 | 3 | 264 |
| 1ffu-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor | 0.9021 | 4 | 264 |
| 1ffv-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.8952 | 4 | 264 |
| 1n5w-assembly1.cif.gz_C | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.8937 | 1 | 264 |
| 1zxi-assembly1.cif.gz_F | reconstituted co dehydrogenase from oligotropha carboxidovorans | 0.89 | 3 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y7N2_57_165_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9475 | 68 | 166 | 3.30.465.10 |
| 1ffvC03 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9463 | 57 | 166 | 3.30.465.10 |
| 1t3qF02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9434 | 56 | 168 | 3.30.465.10 |
| 1ffuF01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.9389 | 4 | 51 | 3.30.43.10 |
| af_P77324_1_53_3.30.43.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.9375 | 1 | 53 | 3.30.43.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A431NS82-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.987 | 1 | 265 |
GO:0016491
GO:0071949 |
| AF-A0A1H8YRK0-F1-model_v4 | Carbon-monoxide dehydrogenase medium subunit | 0.9839 | 168 | 265 |
|
| AF-A0A537V8Z3-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.9838 | 1 | 265 |
GO:0016491
GO:0071949 |
| AF-A0A6L7YY57-F1-model_v4 | FAD-binding PCMH-type domain-containing protein | 0.9837 | 1 | 231 |
GO:0016491
GO:0071949 |
| AF-A0A6G6YVB9-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.9833 | 1 | 262 |
GO:0016491
GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar