F483549

General Info

Members Datasets Scaffolds Average Seq Length
853 379 1706 288

Family's Representative Sequence

Representative Sequence 3300035116|Ga0373945_0002449|Ga0373945_0002449_4700_5614
Length 296
Sequence MADGPLREPDLRRSVPIDVYLNVAVAGILTGLVYGLMALGLSVIFGVVRVVNFAHGEMMSIAMYLTVLLFSGLHLDPLVMLVPIAAILFVFGYALQAGLINPFISRPEHSQFLLLVALALIIVNTLLILFGPDARTVQTSYAFDSFQWGALIVDATKLYAGGLFVFFRFAPVGKAIRACADNYTGALVVGLDVKRLYALTFGIGAACVGAAGVMMTLIVDVTPMIGPAYTLLAFVIVITGGLGSMAGALLGGLLIGVTEALAGLLFTPSAKSMFAFAILVLVLLFRPQGILGKRSI

Samples

Sample ID Description Type Environment
1 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
201 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
231 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
347 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
348 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
357 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
358 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
359 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
362 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
363 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
364 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
365 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
366 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
367 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
368 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
369 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
370 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
371 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
372 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
373 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
374 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
375 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
379 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.1
Nodule 0
Rhizoplane 7.03
Rhizosphere 85.58
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373945_0002449 3300035116 Bacteria 5826
2 JGI25153J46596_10003964 3300003215 Bacteria 8103
3 rootH1_10101929 3300003316 Bacteria 1533
4 Ga0065712_10022039 3300005290 Bacteria 2146
5 Ga0065707_10201144 3300005295 Bacteria 1310
6 Ga0070658_10007812 3300005327 Bacteria 8619
7 Ga0070658_10163506 3300005327 Bacteria 1868
8 Ga0070690_100011486 3300005330 Bacteria 5181
9 Ga0068869_100032828 3300005334 Bacteria 3661
10 Ga0070666_10187404 3300005335 Bacteria 1453
11 Ga0070680_100004671 3300005336 Bacteria 10302
12 Ga0070680_100010183 3300005336 Bacteria 7250
13 Ga0070680_100081170 3300005336 Bacteria 2675
14 Ga0070682_100060440 3300005337 Bacteria 2396
15 Ga0068868_100327538 3300005338 Bacteria 1306
16 Ga0068868_100418451 3300005338 Bacteria 1160
17 Ga0070660_100025632 3300005339 Bacteria 4383
18 Ga0070660_100242405 3300005339 Unclassified 1469
19 Ga0070689_100003048 3300005340 Bacteria 11037
20 Ga0070689_100182890 3300005340 Bacteria 1703
21 Ga0070691_10002385 3300005341 Bacteria 8330
22 Ga0070687_100223455 3300005343 Bacteria 1155
23 Ga0070661_100129809 3300005344 Bacteria 1892
24 Ga0070692_10054837 3300005345 Bacteria 2082
25 Ga0070668_100175965 3300005347 Bacteria 1745
26 Ga0070675_100227172 3300005354 Bacteria 1627
27 Ga0070671_100001629 3300005355 Bacteria 16929
28 Ga0070671_100179031 3300005355 Bacteria 1795
29 Ga0070674_100005640 3300005356 Bacteria 7253
30 Ga0070674_100265233 3300005356 Unclassified 1355
31 Ga0070688_100010598 3300005365 Bacteria 5090
32 Ga0070688_100097895 3300005365 Bacteria 1929
33 Ga0070688_100103190 3300005365 Bacteria 1884
34 Ga0070659_100138178 3300005366 Bacteria 1983
35 Ga0070667_100194491 3300005367 Bacteria 1798
36 Ga0070667_100238863 3300005367 Bacteria 1622
37 Ga0070703_10000863 3300005406 Bacteria 9778
38 Ga0070709_10044315 3300005434 Bacteria 2754
39 Ga0070709_10089360 3300005434 Bacteria 2028
40 Ga0070714_100015537 3300005435 Bacteria 6123
41 Ga0070714_100034473 3300005435 Bacteria 4239
42 Ga0070713_100006445 3300005436 Bacteria 8140
43 Ga0070713_100066826 3300005436 Bacteria 3025
44 Ga0070713_100175961 3300005436 Bacteria 1920
45 Ga0070711_100031327 3300005439 Bacteria 3530
46 Ga0070711_100086139 3300005439 Bacteria 2252
47 Ga0070711_100130881 3300005439 Bacteria 1868
48 Ga0070711_100199513 3300005439 Bacteria 1543
49 Ga0070705_100002047 3300005440 Bacteria 10304
50 Ga0070700_100006099 3300005441 Bacteria 6420
51 Ga0070700_100307430 3300005441 Bacteria 1160
52 Ga0070694_100002834 3300005444 Bacteria 10301
53 Ga0070694_100194113 3300005444 Unclassified 1509
54 Ga0070678_100135240 3300005456 Bacteria 1965
55 Ga0070662_100088159 3300005457 Bacteria 2325
56 Ga0070662_100226547 3300005457 Bacteria 1494
57 Ga0070681_10039242 3300005458 Bacteria 4747
58 Ga0070681_10046550 3300005458 Bacteria 4336
59 Ga0068867_100379411 3300005459 Unclassified 1187
60 Ga0070685_10034379 3300005466 Bacteria 2854
61 Ga0070685_10068286 3300005466 Bacteria 2099
62 Ga0070685_10153428 3300005466 Bacteria 1462
63 Ga0070698_100107974 3300005471 Bacteria 2751
64 Ga0070698_100138364 3300005471 Bacteria 2388
65 Ga0070699_100000676 3300005518 Bacteria 31923
66 Ga0070699_100008160 3300005518 Bacteria 9087
67 Ga0070699_100037744 3300005518 Bacteria 4183
68 Ga0070679_100018216 3300005530 Bacteria 6810
69 Ga0070679_100031611 3300005530 Bacteria 5231
70 Ga0070679_100080118 3300005530 Bacteria 3254
71 Ga0070679_100543894 3300005530 Bacteria 1105
72 Ga0070684_100068425 3300005535 Bacteria 3121
73 Ga0070684_100175094 3300005535 Bacteria 1950
74 Ga0068853_100448012 3300005539 Bacteria 1214
75 Ga0070672_100086593 3300005543 Bacteria 2520
76 Ga0070672_100129074 3300005543 Bacteria 2076
77 Ga0070686_100053639 3300005544 Bacteria 2575
78 Ga0070686_100105802 3300005544 Bacteria 1908
79 Ga0070686_100148990 3300005544 Bacteria 1637
80 Ga0070695_100002706 3300005545 Bacteria 10271
81 Ga0070695_100088144 3300005545 Unclassified 2066
82 Ga0070696_100003618 3300005546 Bacteria 10294
83 Ga0070693_100258742 3300005547 Unclassified 1157
84 Ga0070665_100009831 3300005548 Bacteria 9669
85 Ga0070704_100002596 3300005549 Bacteria 10186
86 Ga0070704_100192950 3300005549 Bacteria 1639
87 Ga0068855_100019415 3300005563 Bacteria 8167
88 Ga0068855_100359197 3300005563 Bacteria 1603
89 Ga0068856_100056846 3300005614 Bacteria 3862
90 Ga0068856_100282343 3300005614 Bacteria 1677
91 Ga0068856_100444007 3300005614 Bacteria 1318
92 Ga0070702_100017320 3300005615 Bacteria 3714
93 Ga0068859_100053261 3300005617 Bacteria 4069
94 Ga0068859_100148530 3300005617 Bacteria 2419
95 Ga0068859_100157789 3300005617 Bacteria 2347
96 Ga0068861_100110705 3300005719 Bacteria 2200
97 Ga0068861_100334322 3300005719 Bacteria 1324
98 Ga0068870_10032553 3300005840 Bacteria 2652
99 Ga0068858_100396431 3300005842 Bacteria 1326
100 Ga0081455_10002266 3300005937 Bacteria 22935
101 Ga0081455_10014076 3300005937 Bacteria 7863
102 Ga0081455_10022274 3300005937 Bacteria 5925
103 Ga0081455_10071649 3300005937 Bacteria 2872
104 Ga0081538_10032375 3300005981 Bacteria 3505
105 Ga0081538_10035528 3300005981 Bacteria 3272
106 Ga0081538_10038133 3300005981 Bacteria 3106
107 Ga0081540_1000413 3300005983 Bacteria 42230
108 Ga0081540_1007933 3300005983 Bacteria 7492
109 Ga0081540_1037671 3300005983 Bacteria 2559
110 Ga0081540_1070642 3300005983 Bacteria 1616
111 Ga0081539_10009410 3300005985 Bacteria 8173
112 Ga0081539_10029464 3300005985 Bacteria 3428
113 Ga0081539_10040250 3300005985 Bacteria 2745
114 Ga0081539_10055264 3300005985 Bacteria 2210
115 Ga0070717_10001832 3300006028 Bacteria 14856
116 Ga0070717_10271317 3300006028 Bacteria 1503
117 Ga0070717_10291206 3300006028 Bacteria 1450
118 Ga0075365_10015329 3300006038 Bacteria 4634
119 Ga0075365_10031607 3300006038 Bacteria 3396
120 Ga0075365_10072168 3300006038 Bacteria 2325
121 Ga0075368_10051433 3300006042 Bacteria 1638
122 Ga0075364_10265500 3300006051 Bacteria 1167
123 Ga0070715_10000773 3300006163 Bacteria 8658
124 Ga0070716_100031558 3300006173 Bacteria 2882
125 Ga0070712_100001365 3300006175 Bacteria 14802
126 Ga0070712_100002949 3300006175 Bacteria 10539
127 Ga0075362_10025194 3300006177 Bacteria 2529
128 Ga0075362_10044880 3300006177 Bacteria 1962
129 Ga0075367_10010335 3300006178 Bacteria 4902
130 Ga0075367_10083360 3300006178 Bacteria 1937
131 Ga0075369_10003208 3300006186 Bacteria 5935
132 Ga0075369_10091376 3300006186 Bacteria 1359
133 Ga0075366_10003186 3300006195 Bacteria 8600
134 Ga0075366_10003908 3300006195 Bacteria 7945
135 Ga0097621_100034275 3300006237 Bacteria 4049
136 Ga0097621_100208396 3300006237 Bacteria 1699
137 Ga0068871_100024425 3300006358 Bacteria 4687
138 Ga0068871_100040552 3300006358 Bacteria 3729
139 Ga0075428_100033401 3300006844 Bacteria 5682
140 Ga0075428_100043702 3300006844 Bacteria 4926
141 Ga0075428_100072613 3300006844 Bacteria 3759
142 Ga0075428_100115363 3300006844 Bacteria 2926
143 Ga0075428_100138265 3300006844 Bacteria 2648
144 Ga0075428_100281631 3300006844 Bacteria 1789
145 Ga0075428_100429258 3300006844 Bacteria 1416
146 Ga0075430_100001038 3300006846 Bacteria 21949
147 Ga0075430_100008855 3300006846 Bacteria 8493
148 Ga0075430_100025536 3300006846 Bacteria 5026
149 Ga0075430_100035755 3300006846 Bacteria 4213
150 Ga0075430_100101673 3300006846 Bacteria 2400
151 Ga0075430_100121511 3300006846 Bacteria 2177
152 Ga0075430_100165915 3300006846 Bacteria 1838
153 Ga0075430_100229900 3300006846 Bacteria 1538
154 Ga0075431_100072882 3300006847 Bacteria 3543
155 Ga0075431_100169557 3300006847 Bacteria 2243
156 Ga0075431_100227964 3300006847 Bacteria 1899
157 Ga0075431_100255749 3300006847 Bacteria 1778
158 Ga0075433_10040253 3300006852 Bacteria 4045
159 Ga0075434_100006551 3300006871 Bacteria 10678
160 Ga0075434_100036000 3300006871 Bacteria 4895
161 Ga0075434_100226630 3300006871 Bacteria 1888
162 Ga0075434_100453329 3300006871 Bacteria 1304
163 Ga0075429_100118197 3300006880 Bacteria 2317
164 Ga0068865_100139009 3300006881 Bacteria 1829
165 Ga0075436_100054512 3300006914 Bacteria 2760
166 Ga0097620_100053263 3300006931 Bacteria 4069
167 Ga0097620_100148516 3300006931 Bacteria 2419
168 Ga0097620_100157776 3300006931 Bacteria 2347
169 Ga0075435_100061185 3300007076 Bacteria 3054
170 Ga0075435_100189322 3300007076 Bacteria 1741
171 Ga0105240_10018112 3300009093 Bacteria 9471
172 Ga0105240_10636057 3300009093 Bacteria 1171
173 Ga0111539_10039620 3300009094 Bacteria 5677
174 Ga0111539_10128038 3300009094 Bacteria 2974
175 Ga0111539_10137933 3300009094 Bacteria 2856
176 Ga0111539_10406481 3300009094 Bacteria 1586
177 Ga0111539_10439485 3300009094 Bacteria 1519
178 Ga0111539_10441686 3300009094 Bacteria 1515
179 Ga0111539_10521566 3300009094 Bacteria 1384
180 Ga0111539_10767389 3300009094 Bacteria 1122
181 Ga0105245_10007619 3300009098 Bacteria 9480
182 Ga0105245_10009970 3300009098 Bacteria 8275
183 Ga0105247_10159397 3300009101 Bacteria 1493
184 Ga0114129_10005876 3300009147 Bacteria 17380
185 Ga0114129_10031337 3300009147 Bacteria 7518
186 Ga0114129_10110595 3300009147 Bacteria 3792
187 Ga0114129_10111214 3300009147 Bacteria 3780
188 Ga0114129_10119370 3300009147 Bacteria 3632
189 Ga0114129_10210234 3300009147 Bacteria 2630
190 Ga0114129_10222381 3300009147 Bacteria 2546
191 Ga0114129_10257894 3300009147 Unclassified 2338
192 Ga0114129_10643814 3300009147 Bacteria 1369
193 Ga0105243_10057333 3300009148 Bacteria 3101
194 Ga0105243_10083844 3300009148 Bacteria 2608
195 Ga0105241_10456676 3300009174 Bacteria 1131
196 Ga0105242_10042703 3300009176 Bacteria 3663
197 Ga0105242_10425437 3300009176 Bacteria 1245
198 Ga0105248_10014889 3300009177 Bacteria 8566
199 Ga0105248_10087238 3300009177 Bacteria 3512
200 Ga0105248_10158891 3300009177 Bacteria 2550
201 Ga0105248_10179367 3300009177 Bacteria 2387
202 Ga0105237_10074588 3300009545 Bacteria 3385
203 Ga0105238_10083801 3300009551 Bacteria 3177
204 Ga0105238_10121564 3300009551 Unclassified 2590
205 Ga0105249_10012920 3300009553 Bacteria 7367
206 Ga0105249_10348651 3300009553 Bacteria 1499
207 Ga0105239_10090721 3300010375 Bacteria 3372
208 Ga0105239_10473938 3300010375 Bacteria 1422
209 Ga0105246_10435893 3300011119 Bacteria 1097
210 Ga0157373_10078964 3300013100 Bacteria 2321
211 Ga0157369_10436259 3300013105 Bacteria 1357
212 Ga0157374_10720323 3300013296 Bacteria 1011
213 Ga0157378_10113655 3300013297 Bacteria 2486
214 Ga0157378_10435382 3300013297 Bacteria 1298
215 Ga0163162_10085892 3300013306 Bacteria 3223
216 Ga0163162_10168685 3300013306 Bacteria 2313
217 Ga0163162_10304138 3300013306 Bacteria 1727
218 Ga0157375_10147328 3300013308 Bacteria 2486
219 Ga0157375_10363324 3300013308 Bacteria 1614
220 Ga0163163_10052576 3300014325 Bacteria 4019
221 Ga0163163_10235232 3300014325 Bacteria 1881
222 Ga0157380_10212780 3300014326 Bacteria 1724
223 Ga0157379_10019047 3300014968 Bacteria 6059
224 Ga0157379_10156673 3300014968 Bacteria 2055
225 Ga0157379_10217508 3300014968 Bacteria 1731
226 Ga0157376_10660073 3300014969 Bacteria 1047
227 Ga0163161_10319628 3300017792 Bacteria 1227
228 Ga0213872_10037343 3300021361 Bacteria 2218
229 Ga0213874_10099192 3300021377 Bacteria 966
230 Ga0213876_10027264 3300021384 Bacteria 3016
231 Ga0213876_10046534 3300021384 Bacteria 2294
232 Ga0209675_1002489 3300025291 Bacteria 9433
233 Ga0209758_1003526 3300025297 Bacteria 14107
234 Ga0207653_10011134 3300025885 Bacteria 2807
235 Ga0207682_10036882 3300025893 Bacteria 1979
236 Ga0207692_10008130 3300025898 Bacteria 4331
237 Ga0207688_10093977 3300025901 Bacteria 1725
238 Ga0207685_10001687 3300025905 Bacteria 4766
239 Ga0207699_10125925 3300025906 Bacteria 1663
240 Ga0207699_10182043 3300025906 Bacteria 1413
241 Ga0207645_10084627 3300025907 Bacteria 2035
242 Ga0207645_10190517 3300025907 Bacteria 1348
243 Ga0207643_10077870 3300025908 Bacteria 1917
244 Ga0207705_10006429 3300025909 Bacteria 8705
245 Ga0207654_10305260 3300025911 Bacteria 1083
246 Ga0207707_10134306 3300025912 Bacteria 2164
247 Ga0207671_10248297 3300025914 Bacteria 1399
248 Ga0207693_10001110 3300025915 Bacteria 24219
249 Ga0207693_10004385 3300025915 Bacteria 11930
250 Ga0207693_10005324 3300025915 Bacteria 10748
251 Ga0207693_10018460 3300025915 Bacteria 5556
252 Ga0207663_10073555 3300025916 Bacteria 2212
253 Ga0207663_10242323 3300025916 Bacteria 1323
254 Ga0207663_10253747 3300025916 Bacteria 1296
255 Ga0207660_10003455 3300025917 Bacteria 10306
256 Ga0207660_10052516 3300025917 Bacteria 2902
257 Ga0207662_10021594 3300025918 Bacteria 3683
258 Ga0207662_10059225 3300025918 Bacteria 2295
259 Ga0207657_10048882 3300025919 Bacteria 3690
260 Ga0207657_10064034 3300025919 Bacteria 3140
261 Ga0207649_10271451 3300025920 Bacteria 1229
262 Ga0207652_10013357 3300025921 Bacteria 6650
263 Ga0207652_10141511 3300025921 Bacteria 2151
264 Ga0207652_10195031 3300025921 Bacteria 1822
265 Ga0207652_10229440 3300025921 Unclassified 1673
266 Ga0207646_10143246 3300025922 Bacteria 2153
267 Ga0207694_10170549 3300025924 Bacteria 1762
268 Ga0207650_10003903 3300025925 Bacteria 10195
269 Ga0207659_10149531 3300025926 Bacteria 1822
270 Ga0207687_10067466 3300025927 Bacteria 2545
271 Ga0207687_10110692 3300025927 Bacteria 2037
272 Ga0207700_10007214 3300025928 Bacteria 6778
273 Ga0207700_10356154 3300025928 Bacteria 1275
274 Ga0207664_10106902 3300025929 Bacteria 2321
275 Ga0207644_10086654 3300025931 Bacteria 2326
276 Ga0207644_10094770 3300025931 Bacteria 2231
277 Ga0207644_10215155 3300025931 Bacteria 1521
278 Ga0207690_10324857 3300025932 Bacteria 1210
279 Ga0207690_10344223 3300025932 Bacteria 1177
280 Ga0207706_10003165 3300025933 Bacteria 15811
281 Ga0207706_10015943 3300025933 Bacteria 6791
282 Ga0207706_10028849 3300025933 Bacteria 4954
283 Ga0207706_10080732 3300025933 Bacteria 2859
284 Ga0207706_10206689 3300025933 Bacteria 1721
285 Ga0207706_10265618 3300025933 Bacteria 1498
286 Ga0207709_10039578 3300025935 Bacteria 2817
287 Ga0207709_10070805 3300025935 Bacteria 2212
288 Ga0207670_10005309 3300025936 Bacteria 7058
289 Ga0207670_10227793 3300025936 Bacteria 1430
290 Ga0207669_10008848 3300025937 Bacteria 4753
291 Ga0207669_10040865 3300025937 Bacteria 2694
292 Ga0207704_10070029 3300025938 Bacteria 2219
293 Ga0207665_10013442 3300025939 Bacteria 5382
294 Ga0207665_10085932 3300025939 Unclassified 2172
295 Ga0207691_10398930 3300025940 Bacteria 1173
296 Ga0207711_10066206 3300025941 Bacteria 3125
297 Ga0207711_10174196 3300025941 Bacteria 1954
298 Ga0207689_10050556 3300025942 Bacteria 3427
299 Ga0207689_10142109 3300025942 Bacteria 1977
300 Ga0207689_10160185 3300025942 Bacteria 1854
301 Ga0207661_10323570 3300025944 Bacteria 1387
302 Ga0207667_10019489 3300025949 Bacteria 7570
303 Ga0207651_10047465 3300025960 Bacteria 2896
304 Ga0207651_10071915 3300025960 Bacteria 2454
305 Ga0207712_10011425 3300025961 Bacteria 5657
306 Ga0207712_10342058 3300025961 Bacteria 1241
307 Ga0207658_10133627 3300025986 Bacteria 1997
308 Ga0207658_10148586 3300025986 Bacteria 1906
309 Ga0207703_10334189 3300026035 Bacteria 1391
310 Ga0207639_10126065 3300026041 Bacteria 2112
311 Ga0207639_10439269 3300026041 Bacteria 1183
312 Ga0207678_10046876 3300026067 Bacteria 3738
313 Ga0207708_10011998 3300026075 Bacteria 6457
314 Ga0207708_10322023 3300026075 Bacteria 1262
315 Ga0207702_10063784 3300026078 Bacteria 3151
316 Ga0207648_10013708 3300026089 Bacteria 7525
317 Ga0207648_10285261 3300026089 Bacteria 1477
318 Ga0207676_10108733 3300026095 Bacteria 2315
319 Ga0207675_100209894 3300026118 Bacteria 1872
320 Ga0207675_100247715 3300026118 Bacteria 1724
321 Ga0207675_100335293 3300026118 Bacteria 1479
322 Ga0207675_100347589 3300026118 Bacteria 1453
323 Ga0207683_10001401 3300026121 Bacteria 21763
324 Ga0207683_10019139 3300026121 Bacteria 5844
325 Ga0207683_10080537 3300026121 Bacteria 2889
326 Ga0209969_1000301 3300027360 Bacteria 6604
327 Ga0209967_1001239 3300027364 Bacteria 3266
328 Ga0209981_1005492 3300027378 Bacteria 1682
329 Ga0209996_1009934 3300027395 Bacteria 1258
330 Ga0210000_1001102 3300027462 Bacteria 3781
331 Ga0210000_1010799 3300027462 Bacteria 1351
332 Ga0209968_1001052 3300027526 Bacteria 4205
333 Ga0209999_1005741 3300027543 Bacteria 2234
334 Ga0209966_1037864 3300027695 Bacteria 997
335 Ga0209974_10005420 3300027876 Bacteria 4489
336 Ga0207428_10026718 3300027907 Bacteria 4813
337 Ga0207428_10109244 3300027907 Bacteria 2130
338 Ga0207428_10225018 3300027907 Bacteria 1405
339 Ga0268266_10004230 3300028379 Bacteria 13823
340 Ga0268265_10004057 3300028380 Bacteria 10293
341 Ga0268265_10192742 3300028380 Bacteria 1762
342 Ga0268264_10172702 3300028381 Bacteria 1956
343 Ga0265318_10010067 3300028577 Bacteria 4131
344 Ga0265338_10251082 3300028800 Bacteria 1305
345 Ga0265330_10082257 3300031235 Bacteria 1386
346 Ga0265320_10008692 3300031240 Bacteria 6187
347 Ga0265325_10008018 3300031241 Bacteria 6264
348 Ga0265329_10010598 3300031242 Bacteria 3375
349 Ga0265329_10011112 3300031242 Bacteria 3279
350 Ga0265340_10006108 3300031247 Bacteria 6641
351 Ga0265340_10014517 3300031247 Bacteria 4112
352 Ga0265340_10043374 3300031247 Bacteria 2205
353 Ga0265339_10009558 3300031249 Bacteria 6081
354 Ga0265339_10119720 3300031249 Bacteria 1354
355 Ga0265331_10028922 3300031250 Bacteria 2769
356 Ga0265327_10004354 3300031251 Bacteria 12598
357 Ga0265316_10099440 3300031344 Bacteria 2212
358 Ga0265316_10371318 3300031344 Bacteria 1033
359 Ga0265313_10000960 3300031595 Bacteria 28619
360 Ga0265314_10007016 3300031711 Bacteria 9843
361 Ga0265314_10117099 3300031711 Bacteria 1684
362 Ga0265342_10000026 3300031712 Bacteria 166610
363 Ga0265342_10050576 3300031712 Bacteria 2482
364 Ga0265342_10065218 3300031712 Bacteria 2135
365 Ga0307413_10079368 3300031824 Bacteria 2098
366 Ga0307413_10256068 3300031824 Bacteria 1302
367 Ga0307406_10402972 3300031901 Bacteria 1085
368 Ga0307412_10121879 3300031911 Bacteria 1879
369 Ga0307416_100140989 3300032002 Bacteria 2191
370 Ga0307416_100570071 3300032002 Bacteria 1208
371 Ga0373938_0020812 3300034957 Bacteria 1325
372 Ga0373926_0011875 3300035083 Bacteria 2938
373 Ga0373940_0039283 3300035088 Bacteria 1295
374 Ga0373949_0000762 3300035090 Bacteria 10376
375 Ga0373952_0005802 3300035092 Bacteria 2268
376 Ga0373939_0000939 3300035114 Bacteria 7257
377 Ga0373939_0112862 3300035114 Unclassified 949
378 Ga0373941_0026413 3300035115 Bacteria 1686
379 Ga0373945_0038041 3300035116 Bacteria 1729
380 Ga0373953_0081431 3300035117 Bacteria 1346
381 Ga0373954_0001982 3300035118 Bacteria 8500
382 Ga0373956_0003825 3300035119 Bacteria 6056
383 Ga0373956_0052024 3300035119 Bacteria 1841
384 Ga0373957_0004410 3300035120 Bacteria 4282
385 Ga0373943_0000537 3300035170 Bacteria 16398
386 Ga0373946_0018731 3300035171 Bacteria 2660
387 Ga0373946_0088240 3300035171 Bacteria 1370
388 Ga0373955_0003925 3300035172 Bacteria 6555
389 Ga0373955_0057057 3300035172 Bacteria 2144
390 Ga0373942_0004147 3300035207 Bacteria 3375
391 Ga0373961_0033728 3300035241 Bacteria 1443
392 Ga0316574_0002290 3300035398 Bacteria 9537
393 Ga0373931_0000865 3300035691 Bacteria 12778
394 Ga0373927_0002460 3300035695 Bacteria 13513
395 Ga0373927_0019146 3300035695 Bacteria 4489
396 Ga0373933_0006622 3300035724 Bacteria 6314
397 Ga0373933_0011665 3300035724 Bacteria 4848
398 Ga0373947_0004973 3300035725 Bacteria 7780
399 Ga0373947_0050005 3300035725 Bacteria 2512
400 Ga0373937_0023654 3300036401 Bacteria 5536
401 Ga0373937_0036110 3300036401 Bacteria 4502
402 Ga0316584_0033825 3300036712 Bacteria 3787
403 Ga0373925_0002857 3300037068 Bacteria 13624
404 Ga0373925_0135890 3300037068 Bacteria 1921
405 Ga0373925_0369432 3300037068 Bacteria 1167
406 Ga0373925_0404112 3300037068 Bacteria 1114
407 Ga0395900_0244781 3300037418 Bacteria 1797
408 Ga0436364_0006078 3300037853 Bacteria 3309
409 Ga0436364_0295959 3300037853 Bacteria 1355
410 Ga0436364_0505381 3300037853 Bacteria 66783
411 Ga0395901_0387094 3300038443 Bacteria 1438
412 Ga0242420_025739 3300038996 Bacteria 1071
413 Ga0436365_0763020 3300039437 Bacteria 7635
414 Ga0436365_0936231 3300039437 Bacteria 1926
415 Ga0436360_0757620 3300039438 Bacteria 2411
416 Ga0436360_0871302 3300039438 Bacteria 1484
417 Ga0436361_0783087 3300039447 Bacteria 7661
418 Ga0436363_0343864 3300039450 Bacteria 1015
419 Ga0439434_0004801 3300042435 Bacteria 3956
420 Ga0439434_0082573 3300042435 Bacteria 1021
421 Ga0439435_0000044 3300042436 Bacteria 14055
422 Ga0439444_0003343 3300042437 Bacteria 2262
423 Ga0439460_0015586 3300042461 Bacteria 2014
424 Ga0466963_0128427 3300044694 Bacteria 1749
425 Ga0466957_0250912 3300044842 Bacteria 1177
426 Ga0451576_0516591 3300045051 Bacteria 1255
427 Ga0466958_0228396 3300045836 Bacteria 1188
428 Ga0495592_0043227 3300046454 Bacteria 3371
429 Ga0495592_0047711 3300046454 Bacteria 3189
430 Ga0495603_0107459 3300046455 Bacteria 1628
431 Ga0495629_0012832 3300046459 Bacteria 6062
432 Ga0495629_0085072 3300046459 Bacteria 2206
433 Ga0495638_0103390 3300046460 Bacteria 1700
434 Ga0495641_0064091 3300046461 Bacteria 1655
435 Ga0495651_0016719 3300046462 Bacteria 5681
436 Ga0495651_0028661 3300046462 Bacteria 4339
437 Ga0495653_0004022 3300046463 Bacteria 11871
438 Ga0495653_0013856 3300046463 Bacteria 6571
439 Ga0495653_0155596 3300046463 Bacteria 1592
440 Ga0495580_0068199 3300046472 Bacteria 2487
441 Ga0495580_0113981 3300046472 Bacteria 1878
442 Ga0495605_0127938 3300046474 Bacteria 1147
443 Ga0495639_0026038 3300046475 Bacteria 2583
444 Ga0495662_0001391 3300046476 Bacteria 11991
445 Ga0495662_0052257 3300046476 Bacteria 1973
446 Ga0495662_0065124 3300046476 Bacteria 1761
447 Ga0495664_0000854 3300046477 Bacteria 15638
448 Ga0495664_0014471 3300046477 Bacteria 4473
449 Ga0495664_0069690 3300046477 Bacteria 2099
450 Ga0495594_0075553 3300046499 Unclassified 1878
451 Ga0495608_0012022 3300046511 Bacteria 6017
452 Ga0495608_0044624 3300046511 Bacteria 2958
453 Ga0495608_0113266 3300046511 Bacteria 1743
454 Ga0495618_0002357 3300046514 Bacteria 12181
455 Ga0495618_0005360 3300046514 Bacteria 7824
456 Ga0495618_0015587 3300046514 Bacteria 4639
457 Ga0495618_0074986 3300046514 Bacteria 2155
458 Ga0495628_0029083 3300046516 Bacteria 4484
459 Ga0495628_0031255 3300046516 Bacteria 4307
460 Ga0495628_0478825 3300046516 Unclassified 901
461 Ga0495630_0006177 3300046517 Bacteria 8495
462 Ga0495630_0011171 3300046517 Bacteria 6499
463 Ga0495630_0181826 3300046517 Unclassified 1603
464 Ga0495630_0488519 3300046517 Bacteria 944
465 Ga0495666_0004437 3300046526 Bacteria 7092
466 Ga0495666_0032824 3300046526 Bacteria 2539
467 Ga0495642_0056930 3300046528 Bacteria 1616
468 Ga0495652_0002979 3300046529 Bacteria 17017
469 Ga0495652_0005448 3300046529 Bacteria 11986
470 Ga0495652_0154542 3300046529 Bacteria 1788
471 Ga0495652_0202927 3300046529 Bacteria 1503
472 Ga0495640_0005918 3300046533 Bacteria 9696
473 Ga0495640_0040849 3300046533 Bacteria 3245
474 Ga0495586_0006577 3300046535 Bacteria 6210
475 Ga0495586_0012914 3300046535 Bacteria 4430
476 Ga0495587_0018230 3300046536 Bacteria 4354
477 Ga0495598_0007747 3300046537 Bacteria 2477
478 Ga0495598_0051983 3300046537 Bacteria 1237
479 Ga0495621_0032725 3300046539 Bacteria 1789
480 Ga0495645_0001772 3300046543 Bacteria 14693
481 Ga0495645_0004794 3300046543 Bacteria 9241
482 Ga0495667_0002411 3300046559 Bacteria 12483
483 Ga0495667_0037832 3300046559 Bacteria 3214
484 Ga0495656_0039772 3300046615 Bacteria 1956
485 Ga0495634_0006350 3300046642 Bacteria 8987
486 Ga0495634_0086219 3300046642 Bacteria 2045
487 Ga0495634_0098788 3300046642 Bacteria 1888
488 Ga0495634_0105933 3300046642 Bacteria 1812
489 Ga0495634_0345751 3300046642 Bacteria 891
490 Ga0495635_0002197 3300046663 Bacteria 13268
491 Ga0495635_0007512 3300046663 Bacteria 7607
492 Ga0495635_0009754 3300046663 Bacteria 6710
493 Ga0495635_0157161 3300046663 Bacteria 1547
494 Ga0495659_0038466 3300046664 Unclassified 1699
495 Ga0495588_0136294 3300046674 Unclassified 1296
496 Ga0495657_0009163 3300046675 Bacteria 7518
497 Ga0495657_0075738 3300046675 Bacteria 2187
498 Ga0495599_0036152 3300046678 Bacteria 3100
499 Ga0495623_0002799 3300046679 Bacteria 11511
500 Ga0495646_0003366 3300046680 Bacteria 9942
501 Ga0495646_0019276 3300046680 Bacteria 4320
502 Ga0495646_0125466 3300046680 Bacteria 1449
503 Ga0495647_0046698 3300046681 Bacteria 1669
504 Ga0495658_0045835 3300046683 Bacteria 2455
505 Ga0495624_0029495 3300046690 Bacteria 3579
506 Ga0495624_0116267 3300046690 Bacteria 1644
507 Ga0495624_0246814 3300046690 Bacteria 1080
508 Ga0495600_0015386 3300046809 Bacteria 4836
509 Ga0495600_0024345 3300046809 Bacteria 3896
510 Ga0495581_0069497 3300047315 Bacteria 2036
511 Ga0495581_0258628 3300047315 Bacteria 1018
512 Ga0495604_0009356 3300047317 Bacteria 7754
513 Ga0495604_0021564 3300047317 Bacteria 5142
514 Ga0495636_0203334 3300047318 Bacteria 905
515 Ga0495674_0010284 3300047319 Bacteria 8857
516 Ga0495674_0022332 3300047319 Bacteria 5836
517 Ga0495672_0165851 3300047320 Bacteria 1131
518 Ga0495676_0118399 3300047321 Bacteria 1931
519 Ga0495676_0225737 3300047321 Bacteria 1289
520 Ga0495680_0006934 3300047322 Bacteria 10457
521 Ga0495680_0021194 3300047322 Bacteria 5445
522 Ga0495680_0108044 3300047322 Bacteria 2065
523 Ga0495675_0023103 3300047444 Bacteria 3962
524 Ga0495684_0042839 3300047471 Bacteria 3466
525 Ga0495684_0047235 3300047471 Bacteria 3293
526 Ga0495593_0006391 3300047673 Bacteria 6913
527 Ga0495593_0042302 3300047673 Bacteria 2445
528 Ga0495593_0060782 3300047673 Bacteria 1978
529 Ga0495602_0008235 3300048088 Bacteria 10888
530 Ga0495602_0083467 3300048088 Bacteria 2676
531 Ga0495614_0031776 3300048089 Bacteria 2273
532 Ga0495615_0003005 3300048090 Bacteria 2780
533 Ga0496101_0003115 3300048904 Bacteria 10261
534 Ga0496101_0044622 3300048904 Bacteria 3172
535 Ga0496101_0231387 3300048904 Bacteria 1437
536 Ga0496101_0295485 3300048904 Bacteria 1268
537 Ga0496102_0005771 3300048905 Bacteria 10526
538 Ga0496102_0006136 3300048905 Bacteria 10240
539 Ga0496102_0024027 3300048905 Bacteria 5418
540 Ga0496102_0055522 3300048905 Bacteria 3611
541 Ga0496102_0122032 3300048905 Bacteria 2434
542 Ga0496103_0063023 3300048906 Bacteria 2308
543 Ga0496103_0080284 3300048906 Bacteria 2051
544 Ga0496103_0236674 3300048906 Bacteria 1175
545 Ga0496104_0000618 3300048907 Bacteria 30466
546 Ga0496104_0005842 3300048907 Bacteria 10776
547 Ga0496104_0013745 3300048907 Bacteria 7301
548 Ga0496104_0018794 3300048907 Bacteria 6311
549 Ga0496104_0021537 3300048907 Bacteria 5920
550 Ga0496104_0273599 3300048907 Bacteria 1601
551 Ga0496105_0001514 3300048908 Bacteria 16426
552 Ga0496105_0037429 3300048908 Bacteria 3995
553 Ga0496105_0152872 3300048908 Bacteria 1896
554 Ga0496106_0005441 3300048909 Bacteria 9422
555 Ga0496106_0069698 3300048909 Bacteria 2685
556 Ga0496106_0076192 3300048909 Bacteria 2571
557 Ga0496106_0077587 3300048909 Bacteria 2547
558 Ga0496107_0003704 3300048910 Bacteria 10268
559 Ga0496107_0005110 3300048910 Bacteria 8949
560 Ga0496107_0162697 3300048910 Bacteria 1654
561 Ga0496107_0313672 3300048910 Bacteria 1167
562 Ga0496108_0000544 3300048911 Bacteria 29516
563 Ga0496108_0065717 3300048911 Bacteria 3058
564 Ga0496108_0346557 3300048911 Bacteria 1296
565 Ga0496108_0758615 3300048911 Bacteria 839
566 Ga0496109_0003416 3300048912 Bacteria 13286
567 Ga0496109_0030575 3300048912 Bacteria 4827
568 Ga0496109_0578427 3300048912 Bacteria 1059
569 Ga0496110_0001581 3300048913 Bacteria 16633
570 Ga0496110_0007612 3300048913 Bacteria 8658
571 Ga0496110_0009471 3300048913 Bacteria 7887
572 Ga0496110_0152444 3300048913 Bacteria 2093
573 Ga0496111_0002315 3300048914 Bacteria 11464
574 Ga0496111_0105187 3300048914 Bacteria 2077
575 Ga0496111_0107427 3300048914 Bacteria 2055
576 Ga0496111_0120556 3300048914 Bacteria 1937
577 Ga0496112_0001706 3300048915 Bacteria 17153
578 Ga0496112_0221587 3300048915 Bacteria 1848
579 Ga0496112_0269834 3300048915 Bacteria 1650
580 Ga0496112_0295482 3300048915 Bacteria 1566
581 Ga0496112_0364814 3300048915 Bacteria 1386
582 Ga0496113_0000577 3300048916 Bacteria 18288
583 Ga0496113_0035036 3300048916 Bacteria 3668
584 Ga0496114_0043891 3300048917 Bacteria 3707
585 Ga0496114_0249014 3300048917 Bacteria 1563
586 Ga0496114_0685759 3300048917 Bacteria 899
587 Ga0496115_0035876 3300048918 Bacteria 3925
588 Ga0496115_0082311 3300048918 Bacteria 2622
589 Ga0496115_0092249 3300048918 Bacteria 2476
590 Ga0496115_0188444 3300048918 Bacteria 1704
591 Ga0496115_0267086 3300048918 Bacteria 1406
592 Ga0496115_0334878 3300048918 Bacteria 1236
593 Ga0496126_0188476 3300048929 Bacteria 1748
594 Ga0501031_0015531 3300049568 Bacteria 4943
595 Ga0501032_0173066 3300049569 Bacteria 1415
596 Ga0501033_0004789 3300049570 Bacteria 10803
597 Ga0501033_0005891 3300049570 Bacteria 9629
598 Ga0501033_0031280 3300049570 Bacteria 4000
599 Ga0501033_0039910 3300049570 Bacteria 3506
600 Ga0501033_0201702 3300049570 Bacteria 1420
601 Ga0501034_0145164 3300049571 Bacteria 2350
602 Ga0501034_0236132 3300049571 Bacteria 1776
603 Ga0501034_0239469 3300049571 Bacteria 1761
604 Ga0501036_0010564 3300049572 Bacteria 7626
605 Ga0501036_0072802 3300049572 Bacteria 2905
606 Ga0501036_0410737 3300049572 Bacteria 1129
607 Ga0501036_0494959 3300049572 Bacteria 1017
608 Ga0501037_0000124 3300049573 Bacteria 71522
609 Ga0501037_0003538 3300049573 Bacteria 11340
610 Ga0501037_0308163 3300049573 Bacteria 1098
611 Ga0501038_0058663 3300049574 Bacteria 3299
612 Ga0501038_0061414 3300049574 Bacteria 3213
613 Ga0501038_0119788 3300049574 Bacteria 2172
614 Ga0501038_0145817 3300049574 Bacteria 1933
615 Ga0501038_0161500 3300049574 Bacteria 1821
616 Ga0501039_0158162 3300049575 Bacteria 1780
617 Ga0501039_0286338 3300049575 Bacteria 1295
618 Ga0501040_0011721 3300049576 Bacteria 5735
619 Ga0501040_0078815 3300049576 Bacteria 2280
620 Ga0501041_0039800 3300049577 Bacteria 2853
621 Ga0501041_0089201 3300049577 Bacteria 1904
622 Ga0501041_0106541 3300049577 Bacteria 1737
623 Ga0501041_0112116 3300049577 Bacteria 1692
624 Ga0501042_0001369 3300049578 Bacteria 14310
625 Ga0501042_0093140 3300049578 Bacteria 2164
626 Ga0501042_0237568 3300049578 Bacteria 1315
627 Ga0501042_0303388 3300049578 Bacteria 1154
628 Ga0501043_0000003 3300049579 Bacteria 318844
629 Ga0501043_0000013 3300049579 Bacteria 185639
630 Ga0501043_0122475 3300049579 Bacteria 2040
631 Ga0501043_0181663 3300049579 Bacteria 1639
632 Ga0501043_0201984 3300049579 Bacteria 1542
633 Ga0501046_0000099 3300049580 Bacteria 92986
634 Ga0501046_0170160 3300049580 Bacteria 1636
635 Ga0501047_0000040 3300049581 Bacteria 185677
636 Ga0501047_0022490 3300049581 Bacteria 6055
637 Ga0501047_0079948 3300049581 Bacteria 3143
638 Ga0501047_0087222 3300049581 Bacteria 2998
639 Ga0501047_0114871 3300049581 Bacteria 2574
640 Ga0501047_0120953 3300049581 Bacteria 2501
641 Ga0501047_0171066 3300049581 Bacteria 2041
642 Ga0501047_0226851 3300049581 Bacteria 1722
643 Ga0501047_0314551 3300049581 Bacteria 1406
644 Ga0501047_0375949 3300049581 Bacteria 1255
645 Ga0501048_0000932 3300049582 Bacteria 21587
646 Ga0501048_0009377 3300049582 Bacteria 7349
647 Ga0501048_0019726 3300049582 Bacteria 4944
648 Ga0501048_0056563 3300049582 Bacteria 2783
649 Ga0501067_0021984 3300049583 Bacteria 3529
650 Ga0501067_0156157 3300049583 Bacteria 1271
651 Ga0501068_0043899 3300049584 Bacteria 2690
652 Ga0501068_0156298 3300049584 Bacteria 1436
653 Ga0501069_0000003 3300049585 Bacteria 210301
654 Ga0501069_0003992 3300049585 Bacteria 7614
655 Ga0501069_0011946 3300049585 Bacteria 4608
656 Ga0501069_0049927 3300049585 Bacteria 2326
657 Ga0501070_0000321 3300049586 Bacteria 43662
658 Ga0501070_0000665 3300049586 Bacteria 31670
659 Ga0501070_0001482 3300049586 Bacteria 21004
660 Ga0501070_0168173 3300049586 Bacteria 1806
661 Ga0501071_0004774 3300049587 Bacteria 8628
662 Ga0501071_0014941 3300049587 Bacteria 5320
663 Ga0501071_0029463 3300049587 Bacteria 3874
664 Ga0501071_0397196 3300049587 Bacteria 1052
665 Ga0501072_0008121 3300049588 Bacteria 7965
666 Ga0501072_0109117 3300049588 Bacteria 2202
667 Ga0501072_0226408 3300049588 Bacteria 1490
668 Ga0501072_0228177 3300049588 Bacteria 1483
669 Ga0501072_0250925 3300049588 Bacteria 1409
670 Ga0501072_0263922 3300049588 Bacteria 1370
671 Ga0501073_0061619 3300049589 Bacteria 2617
672 Ga0501073_0066558 3300049589 Bacteria 2511
673 Ga0501073_0100359 3300049589 Bacteria 2010
674 Ga0501074_0000027 3300049590 Bacteria 67860
675 Ga0501074_0005145 3300049590 Bacteria 9400
676 Ga0501074_0005821 3300049590 Bacteria 8890
677 Ga0501074_0031335 3300049590 Bacteria 3853
678 Ga0501074_0031498 3300049590 Bacteria 3841
679 Ga0501074_0074422 3300049590 Bacteria 2439
680 Ga0501074_0130476 3300049590 Bacteria 1798
681 Ga0501075_0109380 3300049591 Bacteria 2101
682 Ga0501075_0253781 3300049591 Bacteria 1340
683 Ga0501076_0004334 3300049592 Bacteria 10068
684 Ga0501076_0053995 3300049592 Bacteria 3185
685 Ga0501076_0146955 3300049592 Bacteria 1917
686 Ga0501076_0410109 3300049592 Unclassified 1114
687 Ga0501077_0053073 3300049593 Bacteria 2574
688 Ga0501077_0192731 3300049593 Bacteria 1295
689 Ga0501077_0340474 3300049593 Bacteria 957
690 Ga0501079_0009079 3300049741 Bacteria 7530
691 Ga0501079_0023785 3300049741 Bacteria 4701
692 Ga0501079_0064766 3300049741 Bacteria 2819
693 Ga0501079_0074273 3300049741 Bacteria 2628
694 Ga0501080_0000139 3300049742 Bacteria 50565
695 Ga0501080_0005001 3300049742 Bacteria 11806
696 Ga0501080_0039043 3300049742 Bacteria 4430
697 Ga0501080_0079114 3300049742 Bacteria 3057
698 Ga0501080_0306870 3300049742 Bacteria 1439
699 Ga0501081_0003673 3300049743 Bacteria 9823
700 Ga0501081_0008074 3300049743 Bacteria 6832
701 Ga0501081_0015350 3300049743 Bacteria 5053
702 Ga0501081_0087087 3300049743 Bacteria 2193
703 Ga0501083_0000024 3300049744 Bacteria 123029
704 Ga0501083_0069649 3300049744 Bacteria 2341
705 Ga0501083_0105408 3300049744 Bacteria 1856
706 Ga0501083_0182952 3300049744 Bacteria 1368
707 Ga0501035_0001357 3300049822 Bacteria 25189
708 Ga0501035_0003123 3300049822 Bacteria 15899
709 Ga0501035_0007814 3300049822 Bacteria 9994
710 Ga0501035_0045837 3300049822 Bacteria 3933
711 Ga0501035_0051453 3300049822 Bacteria 3688
712 Ga0501035_0068824 3300049822 Bacteria 3138
713 Ga0501035_0096757 3300049822 Bacteria 2593
714 Ga0501035_0103582 3300049822 Bacteria 2496
715 Ga0501035_0122363 3300049822 Bacteria 2274
716 Ga0501035_0435005 3300049822 Bacteria 1087
717 Ga0501044_0000016 3300049823 Bacteria 231626
718 Ga0501044_0001046 3300049823 Bacteria 33251
719 Ga0501044_0014332 3300049823 Bacteria 8559
720 Ga0501044_0030367 3300049823 Bacteria 5696
721 Ga0501044_0037941 3300049823 Bacteria 5034
722 Ga0501044_0039887 3300049823 Bacteria 4895
723 Ga0501044_0109989 3300049823 Bacteria 2764
724 Ga0501044_0288048 3300049823 Bacteria 1574
725 Ga0501044_0292359 3300049823 Bacteria 1560
726 Ga0501045_0038056 3300049824 Bacteria 3498
727 Ga0501045_0080201 3300049824 Bacteria 2406
728 Ga0501045_0090153 3300049824 Bacteria 2265
729 Ga0501045_0133518 3300049824 Bacteria 1845
730 Ga0501045_0135655 3300049824 Bacteria 1830
731 Ga0501045_0136770 3300049824 Bacteria 1822
732 nmdc:mga03683_19246_c2 3300050489 Bacteria 1663
733 nmdc:mga00v17_101375_c1 3300050491 Bacteria 1818
734 nmdc:mga00v17_94680_c1 3300050491 Bacteria 1879
735 nmdc:mga0yw44_25714_c1 3300050492 Bacteria 3353
736 nmdc:mga0yw44_36773_c1 3300050492 Bacteria 2887
737 nmdc:mga0yw44_7206_c1 3300050492 Bacteria 5450
738 nmdc:mga0k408_2879_c1 3300050493 Bacteria 9123
739 nmdc:mga06z11_146544_c1 3300050494 Bacteria 1338
740 nmdc:mga06z11_55368_c1 3300050494 Bacteria 2048
741 nmdc:mga06z11_6143_c1 3300050494 Bacteria 4863
742 nmdc:mga04h51_13416_c1 3300050495 Bacteria 2319
743 nmdc:mga05p37_110528_c1 3300050507 Bacteria 3381
744 nmdc:mga05p37_13591_c2 3300050507 Bacteria 6115
745 nmdc:mga05p37_144139_c1 3300050507 Bacteria 2917
746 nmdc:mga05p37_23642_c1 3300050507 Bacteria 7460
747 nmdc:mga05p37_30735_c2 3300050507 Bacteria 3600
748 nmdc:mga05p37_351922_c1 3300050507 Bacteria 1734
749 nmdc:mga05p37_83131_c1 3300050507 Bacteria 3944
750 nmdc:mga09592_131804_c1 3300050508 Bacteria 2151
751 nmdc:mga09592_2967_c1 3300050508 Bacteria 13752
752 nmdc:mga09592_97108_c1 3300050508 Bacteria 2521
753 nmdc:mga0qj67_10255_c1 3300050509 Bacteria 6998
754 nmdc:mga0qj67_106085_c1 3300050509 Bacteria 2267
755 nmdc:mga0qj67_11822_c1 3300050509 Bacteria 6552
756 nmdc:mga0qj67_27803_c1 3300050509 Bacteria 4385
757 nmdc:mga0qj67_65631_c1 3300050509 Bacteria 2890
758 nmdc:mga0qj67_88087_c1 3300050509 Bacteria 2492
759 nmdc:mga0qj67_886_c1 3300050509 Bacteria 20528
760 nmdc:mga06r32_101016_c1 3300050510 Bacteria 2830
761 nmdc:mga06r32_108764_c1 3300050510 Bacteria 2726
762 nmdc:mga06r32_19380_c1 3300050510 Bacteria 6242
763 nmdc:mga06r32_271596_c1 3300050510 Bacteria 1683
764 nmdc:mga06r32_2722_c1 3300050510 Bacteria 15812
765 nmdc:mga06r32_326_c1 3300050510 Bacteria 39903
766 nmdc:mga06r32_51135_c1 3300050510 Bacteria 3954
767 nmdc:mga06r32_584639_c1 3300050510 Bacteria 1089
768 nmdc:mga06r32_671066_c1 3300050510 Bacteria 1004
769 nmdc:mga06r32_84675_c1 3300050510 Bacteria 3091
770 nmdc:mga08y16_100602_c1 3300050511 Bacteria 3010
771 nmdc:mga08y16_119201_c1 3300050511 Bacteria 2747
772 nmdc:mga08y16_160340_c1 3300050511 Bacteria 2337
773 nmdc:mga08y16_293895_c1 3300050511 Bacteria 1675
774 nmdc:mga08y16_52055_c1 3300050511 Bacteria 4284
775 nmdc:mga08y16_63461_c1 3300050511 Bacteria 3858
776 nmdc:mga08y16_73373_c1 3300050511 Bacteria 3566
777 nmdc:mga08y16_80106_c1 3300050511 Bacteria 3405
778 nmdc:mga0n895_20825_c1 3300050512 Bacteria 6125
779 nmdc:mga0n895_22291_c1 3300050512 Bacteria 5937
780 nmdc:mga0n895_343408_c1 3300050512 Bacteria 1512
781 nmdc:mga0n895_49235_c1 3300050512 Bacteria 4127
782 nmdc:mga0n895_526793_c1 3300050512 Bacteria 1189
783 nmdc:mga0n895_79479_c1 3300050512 Bacteria 3266
784 nmdc:mga0rr50_33097_c1 3300050513 Bacteria 3690
785 nmdc:mga0rr50_93733_c1 3300050513 Bacteria 2343
786 nmdc:mga08x19_162899_c1 3300050514 Bacteria 1515
787 nmdc:mga08x19_88759_c1 3300050514 Bacteria 2038
788 nmdc:mga0a205_132084_c1 3300050515 Bacteria 2397
789 nmdc:mga0a205_527981_c1 3300050515 Bacteria 1036
790 nmdc:mga0sz30_15352_c1 3300050516 Bacteria 3026
791 nmdc:mga0sz30_170760_c1 3300050516 Bacteria 964
792 Ga0495601_0001311 3300053077 Bacteria 13647
793 Ga0495601_0001595 3300053077 Bacteria 12519
794 Ga0495601_0012075 3300053077 Bacteria 5177
795 Ga0495601_0054380 3300053077 Bacteria 2532
796 Ga0495612_0000213 3300053078 Bacteria 24541
797 Ga0495612_0007271 3300053078 Bacteria 4530
798 Ga0495612_0013923 3300053078 Bacteria 3240
799 Ga0495612_0019969 3300053078 Bacteria 2684
800 Ga0495612_0039445 3300053078 Bacteria 1921
801 Ga0500610_0086801 3300053079 Bacteria 1628
802 Ga0495655_0009972 3300053083 Bacteria 1861
803 Ga0495595_0000240 3300053084 Bacteria 21669
804 Ga0495595_0034307 3300053084 Bacteria 2294
805 Ga0495619_0001165 3300053085 Bacteria 17262
806 Ga0495619_0002451 3300053085 Bacteria 12145
807 Ga0495619_0010589 3300053085 Bacteria 5801
808 Ga0495619_0017915 3300053085 Bacteria 4489
809 Ga0495619_0029930 3300053085 Bacteria 3521
810 Ga0495619_0059076 3300053085 Bacteria 2547
811 Ga0495619_0168834 3300053085 Bacteria 1513
812 Ga0495619_0342544 3300053085 Bacteria 1034
813 Ga0500646_0003719 3300053090 Bacteria 3908
814 Ga0500646_0041243 3300053090 Bacteria 1300
815 Ga0500566_0001471 3300053094 Bacteria 13782
816 Ga0500641_0013485 3300053096 Bacteria 3003
817 Ga0500593_012270 3300053117 Bacteria 3629
818 Ga0500594_0007213 3300053118 Bacteria 2514
819 Ga0500595_007580 3300053119 Bacteria 4494
820 Ga0500597_002499 3300053120 Bacteria 5128
821 Ga0500614_002487 3300053123 Bacteria 4100
822 Ga0500614_007050 3300053123 Bacteria 2365
823 Ga0500642_0011249 3300053130 Bacteria 3194
824 Ga0500642_0011917 3300053130 Bacteria 3133
825 Ga0500642_0051038 3300053130 Bacteria 1826
826 Ga0500642_0102596 3300053130 Bacteria 1332
827 Ga0500652_000003 3300053131 Bacteria 221528
828 Ga0500652_050255 3300053131 Bacteria 1701
829 Ga0500568_0037464 3300053139 Bacteria 1967
830 Ga0500603_001708 3300053150 Bacteria 4945
831 Ga0500604_0000255 3300053151 Bacteria 15224
832 Ga0500604_0029923 3300053151 Bacteria 1590
833 Ga0500616_0007706 3300053153 Bacteria 6796
834 Ga0500636_0018124 3300053177 Bacteria 4163
835 Ga0501084_0005808 3300054114 Bacteria 10158
836 Ga0501084_0031558 3300054114 Bacteria 4429
837 Ga0501084_0058828 3300054114 Bacteria 3216
838 Ga0501084_0069657 3300054114 Bacteria 2945
839 Ga0501084_0215005 3300054114 Bacteria 1622
840 Ga0501084_0228168 3300054114 Bacteria 1572
841 Ga0501084_0408553 3300054114 Bacteria 1147
842 Ga0501082_0008388 3300060353 Bacteria 8913
843 Ga0501082_0014628 3300060353 Bacteria 6759
844 Ga0501082_0031447 3300060353 Bacteria 4577
845 Ga0501082_0058534 3300060353 Bacteria 3320
846 Ga0501082_0196289 3300060353 Bacteria 1756
847 Ga0501082_0348010 3300060353 Unclassified 1292
848 Ga0501082_0408408 3300060353 Bacteria 1185
849 Ga0466962_0146378 3300061719 Bacteria 1145
850 Ga0530510_0086846 3300061734 Bacteria 2279
851 Ga0530510_0115336 3300061734 Bacteria 1969
852 Ga0530510_0197812 3300061734 Bacteria 1492
853 Ga0530510_0201128 3300061734 Bacteria 1480
854 Ga0373945_0002449
855 JGI25153J46596_10003964
856 rootH1_10101929
857 Ga0065712_10022039
858 Ga0065707_10201144
859 Ga0070658_10007812
860 Ga0070658_10163506
861 Ga0070690_100011486
862 Ga0068869_100032828
863 Ga0070666_10187404
864 Ga0070680_100004671
865 Ga0070680_100010183
866 Ga0070680_100081170
867 Ga0070682_100060440
868 Ga0068868_100327538
869 Ga0068868_100418451
870 Ga0070660_100025632
871 Ga0070660_100242405
872 Ga0070689_100003048
873 Ga0070689_100182890
874 Ga0070691_10002385
875 Ga0070687_100223455
876 Ga0070661_100129809
877 Ga0070692_10054837
878 Ga0070668_100175965
879 Ga0070675_100227172
880 Ga0070671_100001629
881 Ga0070671_100179031
882 Ga0070674_100005640
883 Ga0070674_100265233
884 Ga0070688_100010598
885 Ga0070688_100097895
886 Ga0070688_100103190
887 Ga0070659_100138178
888 Ga0070667_100194491
889 Ga0070667_100238863
890 Ga0070703_10000863
891 Ga0070709_10044315
892 Ga0070709_10089360
893 Ga0070714_100015537
894 Ga0070714_100034473
895 Ga0070713_100006445
896 Ga0070713_100066826
897 Ga0070713_100175961
898 Ga0070711_100031327
899 Ga0070711_100086139
900 Ga0070711_100130881
901 Ga0070711_100199513
902 Ga0070705_100002047
903 Ga0070700_100006099
904 Ga0070700_100307430
905 Ga0070694_100002834
906 Ga0070694_100194113
907 Ga0070678_100135240
908 Ga0070662_100088159
909 Ga0070662_100226547
910 Ga0070681_10039242
911 Ga0070681_10046550
912 Ga0068867_100379411
913 Ga0070685_10034379
914 Ga0070685_10068286
915 Ga0070685_10153428
916 Ga0070698_100107974
917 Ga0070698_100138364
918 Ga0070699_100000676
919 Ga0070699_100008160
920 Ga0070699_100037744
921 Ga0070679_100018216
922 Ga0070679_100031611
923 Ga0070679_100080118
924 Ga0070679_100543894
925 Ga0070684_100068425
926 Ga0070684_100175094
927 Ga0068853_100448012
928 Ga0070672_100086593
929 Ga0070672_100129074
930 Ga0070686_100053639
931 Ga0070686_100105802
932 Ga0070686_100148990
933 Ga0070695_100002706
934 Ga0070695_100088144
935 Ga0070696_100003618
936 Ga0070693_100258742
937 Ga0070665_100009831
938 Ga0070704_100002596
939 Ga0070704_100192950
940 Ga0068855_100019415
941 Ga0068855_100359197
942 Ga0068856_100056846
943 Ga0068856_100282343
944 Ga0068856_100444007
945 Ga0070702_100017320
946 Ga0068859_100053261
947 Ga0068859_100148530
948 Ga0068859_100157789
949 Ga0068861_100110705
950 Ga0068861_100334322
951 Ga0068870_10032553
952 Ga0068858_100396431
953 Ga0081455_10002266
954 Ga0081455_10014076
955 Ga0081455_10022274
956 Ga0081455_10071649
957 Ga0081538_10032375
958 Ga0081538_10035528
959 Ga0081538_10038133
960 Ga0081540_1000413
961 Ga0081540_1007933
962 Ga0081540_1037671
963 Ga0081540_1070642
964 Ga0081539_10009410
965 Ga0081539_10029464
966 Ga0081539_10040250
967 Ga0081539_10055264
968 Ga0070717_10001832
969 Ga0070717_10271317
970 Ga0070717_10291206
971 Ga0075365_10015329
972 Ga0075365_10031607
973 Ga0075365_10072168
974 Ga0075368_10051433
975 Ga0075364_10265500
976 Ga0070715_10000773
977 Ga0070716_100031558
978 Ga0070712_100001365
979 Ga0070712_100002949
980 Ga0075362_10025194
981 Ga0075362_10044880
982 Ga0075367_10010335
983 Ga0075367_10083360
984 Ga0075369_10003208
985 Ga0075369_10091376
986 Ga0075366_10003186
987 Ga0075366_10003908
988 Ga0097621_100034275
989 Ga0097621_100208396
990 Ga0068871_100024425
991 Ga0068871_100040552
992 Ga0075428_100033401
993 Ga0075428_100043702
994 Ga0075428_100072613
995 Ga0075428_100115363
996 Ga0075428_100138265
997 Ga0075428_100281631
998 Ga0075428_100429258
999 Ga0075430_100001038
1000 Ga0075430_100008855
1001 Ga0075430_100025536
1002 Ga0075430_100035755
1003 Ga0075430_100101673
1004 Ga0075430_100121511
1005 Ga0075430_100165915
1006 Ga0075430_100229900
1007 Ga0075431_100072882
1008 Ga0075431_100169557
1009 Ga0075431_100227964
1010 Ga0075431_100255749
1011 Ga0075433_10040253
1012 Ga0075434_100006551
1013 Ga0075434_100036000
1014 Ga0075434_100226630
1015 Ga0075434_100453329
1016 Ga0075429_100118197
1017 Ga0068865_100139009
1018 Ga0075436_100054512
1019 Ga0097620_100053263
1020 Ga0097620_100148516
1021 Ga0097620_100157776
1022 Ga0075435_100061185
1023 Ga0075435_100189322
1024 Ga0105240_10018112
1025 Ga0105240_10636057
1026 Ga0111539_10039620
1027 Ga0111539_10128038
1028 Ga0111539_10137933
1029 Ga0111539_10406481
1030 Ga0111539_10439485
1031 Ga0111539_10441686
1032 Ga0111539_10521566
1033 Ga0111539_10767389
1034 Ga0105245_10007619
1035 Ga0105245_10009970
1036 Ga0105247_10159397
1037 Ga0114129_10005876
1038 Ga0114129_10031337
1039 Ga0114129_10110595
1040 Ga0114129_10111214
1041 Ga0114129_10119370
1042 Ga0114129_10210234
1043 Ga0114129_10222381
1044 Ga0114129_10257894
1045 Ga0114129_10643814
1046 Ga0105243_10057333
1047 Ga0105243_10083844
1048 Ga0105241_10456676
1049 Ga0105242_10042703
1050 Ga0105242_10425437
1051 Ga0105248_10014889
1052 Ga0105248_10087238
1053 Ga0105248_10158891
1054 Ga0105248_10179367
1055 Ga0105237_10074588
1056 Ga0105238_10083801
1057 Ga0105238_10121564
1058 Ga0105249_10012920
1059 Ga0105249_10348651
1060 Ga0105239_10090721
1061 Ga0105239_10473938
1062 Ga0105246_10435893
1063 Ga0157373_10078964
1064 Ga0157369_10436259
1065 Ga0157374_10720323
1066 Ga0157378_10113655
1067 Ga0157378_10435382
1068 Ga0163162_10085892
1069 Ga0163162_10168685
1070 Ga0163162_10304138
1071 Ga0157375_10147328
1072 Ga0157375_10363324
1073 Ga0163163_10052576
1074 Ga0163163_10235232
1075 Ga0157380_10212780
1076 Ga0157379_10019047
1077 Ga0157379_10156673
1078 Ga0157379_10217508
1079 Ga0157376_10660073
1080 Ga0163161_10319628
1081 Ga0213872_10037343
1082 Ga0213874_10099192
1083 Ga0213876_10027264
1084 Ga0213876_10046534
1085 Ga0209675_1002489
1086 Ga0209758_1003526
1087 Ga0207653_10011134
1088 Ga0207682_10036882
1089 Ga0207692_10008130
1090 Ga0207688_10093977
1091 Ga0207685_10001687
1092 Ga0207699_10125925
1093 Ga0207699_10182043
1094 Ga0207645_10084627
1095 Ga0207645_10190517
1096 Ga0207643_10077870
1097 Ga0207705_10006429
1098 Ga0207654_10305260
1099 Ga0207707_10134306
1100 Ga0207671_10248297
1101 Ga0207693_10001110
1102 Ga0207693_10004385
1103 Ga0207693_10005324
1104 Ga0207693_10018460
1105 Ga0207663_10073555
1106 Ga0207663_10242323
1107 Ga0207663_10253747
1108 Ga0207660_10003455
1109 Ga0207660_10052516
1110 Ga0207662_10021594
1111 Ga0207662_10059225
1112 Ga0207657_10048882
1113 Ga0207657_10064034
1114 Ga0207649_10271451
1115 Ga0207652_10013357
1116 Ga0207652_10141511
1117 Ga0207652_10195031
1118 Ga0207652_10229440
1119 Ga0207646_10143246
1120 Ga0207694_10170549
1121 Ga0207650_10003903
1122 Ga0207659_10149531
1123 Ga0207687_10067466
1124 Ga0207687_10110692
1125 Ga0207700_10007214
1126 Ga0207700_10356154
1127 Ga0207664_10106902
1128 Ga0207644_10086654
1129 Ga0207644_10094770
1130 Ga0207644_10215155
1131 Ga0207690_10324857
1132 Ga0207690_10344223
1133 Ga0207706_10003165
1134 Ga0207706_10015943
1135 Ga0207706_10028849
1136 Ga0207706_10080732
1137 Ga0207706_10206689
1138 Ga0207706_10265618
1139 Ga0207709_10039578
1140 Ga0207709_10070805
1141 Ga0207670_10005309
1142 Ga0207670_10227793
1143 Ga0207669_10008848
1144 Ga0207669_10040865
1145 Ga0207704_10070029
1146 Ga0207665_10013442
1147 Ga0207665_10085932
1148 Ga0207691_10398930
1149 Ga0207711_10066206
1150 Ga0207711_10174196
1151 Ga0207689_10050556
1152 Ga0207689_10142109
1153 Ga0207689_10160185
1154 Ga0207661_10323570
1155 Ga0207667_10019489
1156 Ga0207651_10047465
1157 Ga0207651_10071915
1158 Ga0207712_10011425
1159 Ga0207712_10342058
1160 Ga0207658_10133627
1161 Ga0207658_10148586
1162 Ga0207703_10334189
1163 Ga0207639_10126065
1164 Ga0207639_10439269
1165 Ga0207678_10046876
1166 Ga0207708_10011998
1167 Ga0207708_10322023
1168 Ga0207702_10063784
1169 Ga0207648_10013708
1170 Ga0207648_10285261
1171 Ga0207676_10108733
1172 Ga0207675_100209894
1173 Ga0207675_100247715
1174 Ga0207675_100335293
1175 Ga0207675_100347589
1176 Ga0207683_10001401
1177 Ga0207683_10019139
1178 Ga0207683_10080537
1179 Ga0209969_1000301
1180 Ga0209967_1001239
1181 Ga0209981_1005492
1182 Ga0209996_1009934
1183 Ga0210000_1001102
1184 Ga0210000_1010799
1185 Ga0209968_1001052
1186 Ga0209999_1005741
1187 Ga0209966_1037864
1188 Ga0209974_10005420
1189 Ga0207428_10026718
1190 Ga0207428_10109244
1191 Ga0207428_10225018
1192 Ga0268266_10004230
1193 Ga0268265_10004057
1194 Ga0268265_10192742
1195 Ga0268264_10172702
1196 Ga0265318_10010067
1197 Ga0265338_10251082
1198 Ga0265330_10082257
1199 Ga0265320_10008692
1200 Ga0265325_10008018
1201 Ga0265329_10010598
1202 Ga0265329_10011112
1203 Ga0265340_10006108
1204 Ga0265340_10014517
1205 Ga0265340_10043374
1206 Ga0265339_10009558
1207 Ga0265339_10119720
1208 Ga0265331_10028922
1209 Ga0265327_10004354
1210 Ga0265316_10099440
1211 Ga0265316_10371318
1212 Ga0265313_10000960
1213 Ga0265314_10007016
1214 Ga0265314_10117099
1215 Ga0265342_10000026
1216 Ga0265342_10050576
1217 Ga0265342_10065218
1218 Ga0307413_10079368
1219 Ga0307413_10256068
1220 Ga0307406_10402972
1221 Ga0307412_10121879
1222 Ga0307416_100140989
1223 Ga0307416_100570071
1224 Ga0373938_0020812
1225 Ga0373926_0011875
1226 Ga0373940_0039283
1227 Ga0373949_0000762
1228 Ga0373952_0005802
1229 Ga0373939_0000939
1230 Ga0373939_0112862
1231 Ga0373941_0026413
1232 Ga0373945_0038041
1233 Ga0373953_0081431
1234 Ga0373954_0001982
1235 Ga0373956_0003825
1236 Ga0373956_0052024
1237 Ga0373957_0004410
1238 Ga0373943_0000537
1239 Ga0373946_0018731
1240 Ga0373946_0088240
1241 Ga0373955_0003925
1242 Ga0373955_0057057
1243 Ga0373942_0004147
1244 Ga0373961_0033728
1245 Ga0316574_0002290
1246 Ga0373931_0000865
1247 Ga0373927_0002460
1248 Ga0373927_0019146
1249 Ga0373933_0006622
1250 Ga0373933_0011665
1251 Ga0373947_0004973
1252 Ga0373947_0050005
1253 Ga0373937_0023654
1254 Ga0373937_0036110
1255 Ga0316584_0033825
1256 Ga0373925_0002857
1257 Ga0373925_0135890
1258 Ga0373925_0369432
1259 Ga0373925_0404112
1260 Ga0395900_0244781
1261 Ga0436364_0006078
1262 Ga0436364_0295959
1263 Ga0436364_0505381
1264 Ga0395901_0387094
1265 Ga0242420_025739
1266 Ga0436365_0763020
1267 Ga0436365_0936231
1268 Ga0436360_0757620
1269 Ga0436360_0871302
1270 Ga0436361_0783087
1271 Ga0436363_0343864
1272 Ga0439434_0004801
1273 Ga0439434_0082573
1274 Ga0439435_0000044
1275 Ga0439444_0003343
1276 Ga0439460_0015586
1277 Ga0466963_0128427
1278 Ga0466957_0250912
1279 Ga0451576_0516591
1280 Ga0466958_0228396
1281 Ga0495592_0043227
1282 Ga0495592_0047711
1283 Ga0495603_0107459
1284 Ga0495629_0012832
1285 Ga0495629_0085072
1286 Ga0495638_0103390
1287 Ga0495641_0064091
1288 Ga0495651_0016719
1289 Ga0495651_0028661
1290 Ga0495653_0004022
1291 Ga0495653_0013856
1292 Ga0495653_0155596
1293 Ga0495580_0068199
1294 Ga0495580_0113981
1295 Ga0495605_0127938
1296 Ga0495639_0026038
1297 Ga0495662_0001391
1298 Ga0495662_0052257
1299 Ga0495662_0065124
1300 Ga0495664_0000854
1301 Ga0495664_0014471
1302 Ga0495664_0069690
1303 Ga0495594_0075553
1304 Ga0495608_0012022
1305 Ga0495608_0044624
1306 Ga0495608_0113266
1307 Ga0495618_0002357
1308 Ga0495618_0005360
1309 Ga0495618_0015587
1310 Ga0495618_0074986
1311 Ga0495628_0029083
1312 Ga0495628_0031255
1313 Ga0495628_0478825
1314 Ga0495630_0006177
1315 Ga0495630_0011171
1316 Ga0495630_0181826
1317 Ga0495630_0488519
1318 Ga0495666_0004437
1319 Ga0495666_0032824
1320 Ga0495642_0056930
1321 Ga0495652_0002979
1322 Ga0495652_0005448
1323 Ga0495652_0154542
1324 Ga0495652_0202927
1325 Ga0495640_0005918
1326 Ga0495640_0040849
1327 Ga0495586_0006577
1328 Ga0495586_0012914
1329 Ga0495587_0018230
1330 Ga0495598_0007747
1331 Ga0495598_0051983
1332 Ga0495621_0032725
1333 Ga0495645_0001772
1334 Ga0495645_0004794
1335 Ga0495667_0002411
1336 Ga0495667_0037832
1337 Ga0495656_0039772
1338 Ga0495634_0006350
1339 Ga0495634_0086219
1340 Ga0495634_0098788
1341 Ga0495634_0105933
1342 Ga0495634_0345751
1343 Ga0495635_0002197
1344 Ga0495635_0007512
1345 Ga0495635_0009754
1346 Ga0495635_0157161
1347 Ga0495659_0038466
1348 Ga0495588_0136294
1349 Ga0495657_0009163
1350 Ga0495657_0075738
1351 Ga0495599_0036152
1352 Ga0495623_0002799
1353 Ga0495646_0003366
1354 Ga0495646_0019276
1355 Ga0495646_0125466
1356 Ga0495647_0046698
1357 Ga0495658_0045835
1358 Ga0495624_0029495
1359 Ga0495624_0116267
1360 Ga0495624_0246814
1361 Ga0495600_0015386
1362 Ga0495600_0024345
1363 Ga0495581_0069497
1364 Ga0495581_0258628
1365 Ga0495604_0009356
1366 Ga0495604_0021564
1367 Ga0495636_0203334
1368 Ga0495674_0010284
1369 Ga0495674_0022332
1370 Ga0495672_0165851
1371 Ga0495676_0118399
1372 Ga0495676_0225737
1373 Ga0495680_0006934
1374 Ga0495680_0021194
1375 Ga0495680_0108044
1376 Ga0495675_0023103
1377 Ga0495684_0042839
1378 Ga0495684_0047235
1379 Ga0495593_0006391
1380 Ga0495593_0042302
1381 Ga0495593_0060782
1382 Ga0495602_0008235
1383 Ga0495602_0083467
1384 Ga0495614_0031776
1385 Ga0495615_0003005
1386 Ga0496101_0003115
1387 Ga0496101_0044622
1388 Ga0496101_0231387
1389 Ga0496101_0295485
1390 Ga0496102_0005771
1391 Ga0496102_0006136
1392 Ga0496102_0024027
1393 Ga0496102_0055522
1394 Ga0496102_0122032
1395 Ga0496103_0063023
1396 Ga0496103_0080284
1397 Ga0496103_0236674
1398 Ga0496104_0000618
1399 Ga0496104_0005842
1400 Ga0496104_0013745
1401 Ga0496104_0018794
1402 Ga0496104_0021537
1403 Ga0496104_0273599
1404 Ga0496105_0001514
1405 Ga0496105_0037429
1406 Ga0496105_0152872
1407 Ga0496106_0005441
1408 Ga0496106_0069698
1409 Ga0496106_0076192
1410 Ga0496106_0077587
1411 Ga0496107_0003704
1412 Ga0496107_0005110
1413 Ga0496107_0162697
1414 Ga0496107_0313672
1415 Ga0496108_0000544
1416 Ga0496108_0065717
1417 Ga0496108_0346557
1418 Ga0496108_0758615
1419 Ga0496109_0003416
1420 Ga0496109_0030575
1421 Ga0496109_0578427
1422 Ga0496110_0001581
1423 Ga0496110_0007612
1424 Ga0496110_0009471
1425 Ga0496110_0152444
1426 Ga0496111_0002315
1427 Ga0496111_0105187
1428 Ga0496111_0107427
1429 Ga0496111_0120556
1430 Ga0496112_0001706
1431 Ga0496112_0221587
1432 Ga0496112_0269834
1433 Ga0496112_0295482
1434 Ga0496112_0364814
1435 Ga0496113_0000577
1436 Ga0496113_0035036
1437 Ga0496114_0043891
1438 Ga0496114_0249014
1439 Ga0496114_0685759
1440 Ga0496115_0035876
1441 Ga0496115_0082311
1442 Ga0496115_0092249
1443 Ga0496115_0188444
1444 Ga0496115_0267086
1445 Ga0496115_0334878
1446 Ga0496126_0188476
1447 Ga0501031_0015531
1448 Ga0501032_0173066
1449 Ga0501033_0004789
1450 Ga0501033_0005891
1451 Ga0501033_0031280
1452 Ga0501033_0039910
1453 Ga0501033_0201702
1454 Ga0501034_0145164
1455 Ga0501034_0236132
1456 Ga0501034_0239469
1457 Ga0501036_0010564
1458 Ga0501036_0072802
1459 Ga0501036_0410737
1460 Ga0501036_0494959
1461 Ga0501037_0000124
1462 Ga0501037_0003538
1463 Ga0501037_0308163
1464 Ga0501038_0058663
1465 Ga0501038_0061414
1466 Ga0501038_0119788
1467 Ga0501038_0145817
1468 Ga0501038_0161500
1469 Ga0501039_0158162
1470 Ga0501039_0286338
1471 Ga0501040_0011721
1472 Ga0501040_0078815
1473 Ga0501041_0039800
1474 Ga0501041_0089201
1475 Ga0501041_0106541
1476 Ga0501041_0112116
1477 Ga0501042_0001369
1478 Ga0501042_0093140
1479 Ga0501042_0237568
1480 Ga0501042_0303388
1481 Ga0501043_0000003
1482 Ga0501043_0000013
1483 Ga0501043_0122475
1484 Ga0501043_0181663
1485 Ga0501043_0201984
1486 Ga0501046_0000099
1487 Ga0501046_0170160
1488 Ga0501047_0000040
1489 Ga0501047_0022490
1490 Ga0501047_0079948
1491 Ga0501047_0087222
1492 Ga0501047_0114871
1493 Ga0501047_0120953
1494 Ga0501047_0171066
1495 Ga0501047_0226851
1496 Ga0501047_0314551
1497 Ga0501047_0375949
1498 Ga0501048_0000932
1499 Ga0501048_0009377
1500 Ga0501048_0019726
1501 Ga0501048_0056563
1502 Ga0501067_0021984
1503 Ga0501067_0156157
1504 Ga0501068_0043899
1505 Ga0501068_0156298
1506 Ga0501069_0000003
1507 Ga0501069_0003992
1508 Ga0501069_0011946
1509 Ga0501069_0049927
1510 Ga0501070_0000321
1511 Ga0501070_0000665
1512 Ga0501070_0001482
1513 Ga0501070_0168173
1514 Ga0501071_0004774
1515 Ga0501071_0014941
1516 Ga0501071_0029463
1517 Ga0501071_0397196
1518 Ga0501072_0008121
1519 Ga0501072_0109117
1520 Ga0501072_0226408
1521 Ga0501072_0228177
1522 Ga0501072_0250925
1523 Ga0501072_0263922
1524 Ga0501073_0061619
1525 Ga0501073_0066558
1526 Ga0501073_0100359
1527 Ga0501074_0000027
1528 Ga0501074_0005145
1529 Ga0501074_0005821
1530 Ga0501074_0031335
1531 Ga0501074_0031498
1532 Ga0501074_0074422
1533 Ga0501074_0130476
1534 Ga0501075_0109380
1535 Ga0501075_0253781
1536 Ga0501076_0004334
1537 Ga0501076_0053995
1538 Ga0501076_0146955
1539 Ga0501076_0410109
1540 Ga0501077_0053073
1541 Ga0501077_0192731
1542 Ga0501077_0340474
1543 Ga0501079_0009079
1544 Ga0501079_0023785
1545 Ga0501079_0064766
1546 Ga0501079_0074273
1547 Ga0501080_0000139
1548 Ga0501080_0005001
1549 Ga0501080_0039043
1550 Ga0501080_0079114
1551 Ga0501080_0306870
1552 Ga0501081_0003673
1553 Ga0501081_0008074
1554 Ga0501081_0015350
1555 Ga0501081_0087087
1556 Ga0501083_0000024
1557 Ga0501083_0069649
1558 Ga0501083_0105408
1559 Ga0501083_0182952
1560 Ga0501035_0001357
1561 Ga0501035_0003123
1562 Ga0501035_0007814
1563 Ga0501035_0045837
1564 Ga0501035_0051453
1565 Ga0501035_0068824
1566 Ga0501035_0096757
1567 Ga0501035_0103582
1568 Ga0501035_0122363
1569 Ga0501035_0435005
1570 Ga0501044_0000016
1571 Ga0501044_0001046
1572 Ga0501044_0014332
1573 Ga0501044_0030367
1574 Ga0501044_0037941
1575 Ga0501044_0039887
1576 Ga0501044_0109989
1577 Ga0501044_0288048
1578 Ga0501044_0292359
1579 Ga0501045_0038056
1580 Ga0501045_0080201
1581 Ga0501045_0090153
1582 Ga0501045_0133518
1583 Ga0501045_0135655
1584 Ga0501045_0136770
1585 nmdc:mga03683_19246_c2
1586 nmdc:mga00v17_101375_c1
1587 nmdc:mga00v17_94680_c1
1588 nmdc:mga0yw44_25714_c1
1589 nmdc:mga0yw44_36773_c1
1590 nmdc:mga0yw44_7206_c1
1591 nmdc:mga0k408_2879_c1
1592 nmdc:mga06z11_146544_c1
1593 nmdc:mga06z11_55368_c1
1594 nmdc:mga06z11_6143_c1
1595 nmdc:mga04h51_13416_c1
1596 nmdc:mga05p37_110528_c1
1597 nmdc:mga05p37_13591_c2
1598 nmdc:mga05p37_144139_c1
1599 nmdc:mga05p37_23642_c1
1600 nmdc:mga05p37_30735_c2
1601 nmdc:mga05p37_351922_c1
1602 nmdc:mga05p37_83131_c1
1603 nmdc:mga09592_131804_c1
1604 nmdc:mga09592_2967_c1
1605 nmdc:mga09592_97108_c1
1606 nmdc:mga0qj67_10255_c1
1607 nmdc:mga0qj67_106085_c1
1608 nmdc:mga0qj67_11822_c1
1609 nmdc:mga0qj67_27803_c1
1610 nmdc:mga0qj67_65631_c1
1611 nmdc:mga0qj67_88087_c1
1612 nmdc:mga0qj67_886_c1
1613 nmdc:mga06r32_101016_c1
1614 nmdc:mga06r32_108764_c1
1615 nmdc:mga06r32_19380_c1
1616 nmdc:mga06r32_271596_c1
1617 nmdc:mga06r32_2722_c1
1618 nmdc:mga06r32_326_c1
1619 nmdc:mga06r32_51135_c1
1620 nmdc:mga06r32_584639_c1
1621 nmdc:mga06r32_671066_c1
1622 nmdc:mga06r32_84675_c1
1623 nmdc:mga08y16_100602_c1
1624 nmdc:mga08y16_119201_c1
1625 nmdc:mga08y16_160340_c1
1626 nmdc:mga08y16_293895_c1
1627 nmdc:mga08y16_52055_c1
1628 nmdc:mga08y16_63461_c1
1629 nmdc:mga08y16_73373_c1
1630 nmdc:mga08y16_80106_c1
1631 nmdc:mga0n895_20825_c1
1632 nmdc:mga0n895_22291_c1
1633 nmdc:mga0n895_343408_c1
1634 nmdc:mga0n895_49235_c1
1635 nmdc:mga0n895_526793_c1
1636 nmdc:mga0n895_79479_c1
1637 nmdc:mga0rr50_33097_c1
1638 nmdc:mga0rr50_93733_c1
1639 nmdc:mga08x19_162899_c1
1640 nmdc:mga08x19_88759_c1
1641 nmdc:mga0a205_132084_c1
1642 nmdc:mga0a205_527981_c1
1643 nmdc:mga0sz30_15352_c1
1644 nmdc:mga0sz30_170760_c1
1645 Ga0495601_0001311
1646 Ga0495601_0001595
1647 Ga0495601_0012075
1648 Ga0495601_0054380
1649 Ga0495612_0000213
1650 Ga0495612_0007271
1651 Ga0495612_0013923
1652 Ga0495612_0019969
1653 Ga0495612_0039445
1654 Ga0500610_0086801
1655 Ga0495655_0009972
1656 Ga0495595_0000240
1657 Ga0495595_0034307
1658 Ga0495619_0001165
1659 Ga0495619_0002451
1660 Ga0495619_0010589
1661 Ga0495619_0017915
1662 Ga0495619_0029930
1663 Ga0495619_0059076
1664 Ga0495619_0168834
1665 Ga0495619_0342544
1666 Ga0500646_0003719
1667 Ga0500646_0041243
1668 Ga0500566_0001471
1669 Ga0500641_0013485
1670 Ga0500593_012270
1671 Ga0500594_0007213
1672 Ga0500595_007580
1673 Ga0500597_002499
1674 Ga0500614_002487
1675 Ga0500614_007050
1676 Ga0500642_0011249
1677 Ga0500642_0011917
1678 Ga0500642_0051038
1679 Ga0500642_0102596
1680 Ga0500652_000003
1681 Ga0500652_050255
1682 Ga0500568_0037464
1683 Ga0500603_001708
1684 Ga0500604_0000255
1685 Ga0500604_0029923
1686 Ga0500616_0007706
1687 Ga0500636_0018124
1688 Ga0501084_0005808
1689 Ga0501084_0031558
1690 Ga0501084_0058828
1691 Ga0501084_0069657
1692 Ga0501084_0215005
1693 Ga0501084_0228168
1694 Ga0501084_0408553
1695 Ga0501082_0008388
1696 Ga0501082_0014628
1697 Ga0501082_0031447
1698 Ga0501082_0058534
1699 Ga0501082_0196289
1700 Ga0501082_0348010
1701 Ga0501082_0408408
1702 Ga0466962_0146378
1703 Ga0530510_0086846
1704 Ga0530510_0115336
1705 Ga0530510_0197812
1706 Ga0530510_0201128

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

23

283

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5297 7 279
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5172 8 282
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5146 7 279
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5007 6 282
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.4958 7 279
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9175 10 275 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8649 10 275 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.864 12 278 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.818 12 278 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7854 12 275 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A1W6CKT9-F1-model_v4 Branched-chain amino acid ABC transporter 0.9868 6 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A231HHQ6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9826 4 290 GO:0005886
GO:0006865
GO:0022857
AF-A0A433SED4-F1-model_v4 High-affinity branched-chain amino acid transport system permease protein LivH 0.9804 4 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A4Q7DK43-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9788 5 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A399I3A9-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9787 4 290 GO:0005886
GO:0006865
GO:0022857

Map