F483552
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 853 | 500 | 1706 | 644 |
Family's Representative Sequence
| Representative Sequence | 3300041405|Ga0439438_001497|Ga0439438_001497_2320_4431 |
| Length | 703 |
| Sequence | MHRVWSGQVTVYWKKYSTIKIYGKNIDYCRSLVLVCIHQSVGVGSGVKRRLIKITGASMGQTRFASGRQLDVICLGRLGVDLYAQQVGARLEDVSSFAKYLGGSSANIAFGTARLGLRSAMLSRVGDDHMGRFLVESLMREGCDVSGIKVDPERLTAMVLLGIKDRETFPLVFYRENCADMALRAEDIDEAFIASSKALLITGTHFSTDSVYQASIQALDYAQTHQVKRILDIDYRPVLWGLAPKADGETRFVADRKVSQHVQGILARFDLIVGTEEEFLIAGGSEDLLTALRTVRSLTAATLVVKLGPQGCTVIHGDIPNRLEDGAIYPGVRVEVLNVLGAGDAFMSGFLAGWLEDASDERCCQLANACGGLVVSRHACAPAMPTRAELDYLFASPVPITRPDQDVVLQRLHQVSVPRRVWKQLFIFAFDHRWQLVELAQRGGRGLDSIGELKQLFIQAVERVEADLQRQGIEADVGLLADQRFGQDSLNAATGRGWWIARPVEVQGSRPLAFEHGRSIGSNLIAWPQEQIIKCLVQFHPDDEPLLRLEQEAQLLGLYKASQVSGHELLLEVIPPKDHPSAHPDVLYRALKRLYNLGIFPAWWKIEAQTCDEWKQLDELIQQRDPYCRGVVLLGLNAPAAALAEGFRQASQSSTCRGFAVGRTIFQEPSRAWLAGEIDDETLIRDVQGRFVELIEAWRAARS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 52 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 53 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 126 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 131 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 134 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 135 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 136 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 138 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 139 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 140 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 142 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 143 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 148 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 149 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 150 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 151 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 152 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 153 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 154 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 155 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 156 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 157 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 158 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 159 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 160 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 161 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 162 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 163 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 164 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 165 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 166 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 167 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 243 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 244 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 245 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 246 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 247 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 248 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 249 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 250 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 251 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 252 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 253 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 277 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 278 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 279 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 280 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 281 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 282 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 284 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 285 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 286 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 287 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 288 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 289 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 292 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 293 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 294 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 295 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 296 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 297 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 298 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 299 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 300 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 301 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 302 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 303 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 304 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 305 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 306 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 307 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 308 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 309 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 310 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 311 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 312 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 313 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 314 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 315 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 316 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 317 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 318 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 319 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 320 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 321 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 322 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 323 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 324 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 325 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 326 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 327 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 328 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 329 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 330 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 331 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 332 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 333 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 334 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 335 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 336 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 337 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 338 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 339 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 340 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 341 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 342 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 343 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 344 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 345 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 346 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 347 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 348 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 349 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 350 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 351 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 352 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 353 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 354 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 355 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 356 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 357 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 358 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 359 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 360 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 361 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 362 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 363 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 364 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 365 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 366 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 367 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 368 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 369 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 370 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 371 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 372 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 373 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 374 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 375 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 376 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 377 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 378 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 379 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 380 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 381 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 382 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 383 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 384 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 385 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 386 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 387 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 388 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 389 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 390 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 391 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 392 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 393 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 394 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 395 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 396 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 397 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 398 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 399 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 400 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 401 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 402 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 403 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 404 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 405 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 406 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 407 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 408 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 409 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 410 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 411 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 412 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 413 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 414 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 415 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 416 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 417 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 418 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 419 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 420 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 421 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 422 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 423 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 424 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 425 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 426 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 427 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 428 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 429 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 430 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 431 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 432 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 433 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 434 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 435 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 436 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 437 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 438 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 439 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 440 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 441 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 442 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 443 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 444 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 445 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 446 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 447 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 448 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 449 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 450 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 451 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 452 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 453 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 454 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 455 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 456 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 457 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 458 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 459 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 460 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 461 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 462 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 463 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 464 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 465 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 466 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 467 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 468 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 469 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 470 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 471 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 472 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 473 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 474 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 475 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 476 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 477 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 478 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 479 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 480 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 481 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 482 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 483 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 484 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 485 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 486 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 487 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 488 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 489 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 490 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 491 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 492 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 493 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 494 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 495 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 496 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 497 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 498 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 499 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 500 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.15 |
| Metatranscriptomes | 0.23 |
| Isolates | 24.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 13.72 |
| Nodule | 1.52 |
| Rhizoplane | 8.68 |
| Rhizosphere | 62.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439438_001497 | 3300041405 | Bacteria | 10298 |
| 2 | MRS2a_Contig_11 | 2124908027 | Bacteria | 54720 |
| 3 | SwRhRL2b_contig_2082775 | 2162886007 | Bacteria | 8626 |
| 4 | JGI24736J21556_1000922 | 3300001904 | Bacteria | 5414 |
| 5 | JGI24738J21930_10001672 | 3300002075 | Bacteria | 6069 |
| 6 | JGI25162J39368_1000014 | 3300002737 | Bacteria | 328873 |
| 7 | JGI25162J39368_1000015 | 3300002737 | Bacteria | 316381 |
| 8 | JGI25163J39215_1001215 | 3300002771 | Bacteria | 4851 |
| 9 | JGI25163J39215_1002286 | 3300002771 | Bacteria | 2082 |
| 10 | JGI25164J39214_1000037 | 3300002772 | Bacteria | 137530 |
| 11 | JGI25164J39214_1000059 | 3300002772 | Bacteria | 111483 |
| 12 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 13 | JGI25165J46597_1000027 | 3300003214 | Bacteria | 328873 |
| 14 | JGI25165J46597_1000118 | 3300003214 | Bacteria | 137530 |
| 15 | JGI25153J46596_10000149 | 3300003215 | Bacteria | 70796 |
| 16 | Ga0006562J51391_1046111 | 3300003578 | Bacteria | 7190 |
| 17 | Ga0006562J51391_1046112 | 3300003578 | Bacteria | 5770 |
| 18 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 19 | Ga0055538_1000057 | 3300003751 | Bacteria | 112934 |
| 20 | Ga0055538_1000158 | 3300003751 | Bacteria | 45679 |
| 21 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 22 | Ga0055539_1000088 | 3300003752 | Bacteria | 112934 |
| 23 | Ga0055539_1000208 | 3300003752 | Bacteria | 45679 |
| 24 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 25 | Ga0055533_1000096 | 3300003756 | Bacteria | 112934 |
| 26 | Ga0055533_1000209 | 3300003756 | Bacteria | 45679 |
| 27 | Ga0055532_1000214 | 3300003758 | Bacteria | 45671 |
| 28 | Ga0055525_1000087 | 3300003759 | Bacteria | 149803 |
| 29 | Ga0055525_1000129 | 3300003759 | Bacteria | 112934 |
| 30 | Ga0055525_1000287 | 3300003759 | Bacteria | 45679 |
| 31 | Ga0055527_1000781 | 3300003760 | Bacteria | 8694 |
| 32 | Ga0055535_1001921 | 3300003761 | Bacteria | 8705 |
| 33 | Ga0055535_1001925 | 3300003761 | Bacteria | 8694 |
| 34 | Ga0055542_1001738 | 3300003762 | Bacteria | 9314 |
| 35 | Ga0055542_1003477 | 3300003762 | Bacteria | 4243 |
| 36 | Ga0055529_1000493 | 3300003763 | Bacteria | 35995 |
| 37 | Ga0055536_1000046 | 3300003781 | Bacteria | 118284 |
| 38 | Ga0055530_10000133 | 3300003791 | Bacteria | 65211 |
| 39 | Ga0055530_10000136 | 3300003791 | Bacteria | 64931 |
| 40 | Ga0055530_10006501 | 3300003791 | Bacteria | 5202 |
| 41 | Ga0055540_1000070 | 3300003792 | Bacteria | 118483 |
| 42 | Ga0055540_1000168 | 3300003792 | Bacteria | 65211 |
| 43 | Ga0055540_1000303 | 3300003792 | Bacteria | 43632 |
| 44 | Ga0055531_10002895 | 3300003794 | Bacteria | 11174 |
| 45 | Ga0055531_10004152 | 3300003794 | Bacteria | 8937 |
| 46 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 47 | Ga0055541_1000059 | 3300003841 | Bacteria | 112934 |
| 48 | Ga0055541_1000067 | 3300003841 | Bacteria | 99013 |
| 49 | Ga0065165_1004047 | 3300005262 | Bacteria | 9526 |
| 50 | Ga0065714_10011647 | 3300005288 | Bacteria | 2173 |
| 51 | Ga0065714_10064673 | 3300005288 | Bacteria | 24513 |
| 52 | Ga0065714_10084986 | 3300005288 | Bacteria | 2166 |
| 53 | Ga0065704_10070740 | 3300005289 | Bacteria | 16834 |
| 54 | Ga0065712_10067765 | 3300005290 | Bacteria | 47045 |
| 55 | Ga0065712_10079941 | 3300005290 | Bacteria | 3162 |
| 56 | Ga0070658_10007195 | 3300005327 | Bacteria | 8989 |
| 57 | Ga0070670_100043450 | 3300005331 | Bacteria | 3863 |
| 58 | Ga0070660_100000080 | 3300005339 | Bacteria | 57858 |
| 59 | Ga0070661_100000399 | 3300005344 | Bacteria | 33668 |
| 60 | Ga0070661_100033882 | 3300005344 | Bacteria | 3702 |
| 61 | Ga0070668_100048034 | 3300005347 | Bacteria | 3282 |
| 62 | Ga0070659_100000068 | 3300005366 | Bacteria | 81455 |
| 63 | Ga0070708_100048922 | 3300005445 | Bacteria | 3740 |
| 64 | Ga0070678_100009561 | 3300005456 | Bacteria | 5882 |
| 65 | Ga0070662_100000595 | 3300005457 | Bacteria | 22020 |
| 66 | Ga0070662_100006829 | 3300005457 | Bacteria | 7379 |
| 67 | Ga0070662_100013868 | 3300005457 | Bacteria | 5368 |
| 68 | Ga0070685_10000935 | 3300005466 | Bacteria | 15709 |
| 69 | Ga0068853_100030852 | 3300005539 | Bacteria | 4529 |
| 70 | Ga0070665_100000786 | 3300005548 | Bacteria | 41741 |
| 71 | Ga0070665_100045492 | 3300005548 | Bacteria | 4408 |
| 72 | Ga0068855_100000112 | 3300005563 | Bacteria | 100923 |
| 73 | Ga0070664_100000824 | 3300005564 | Bacteria | 23877 |
| 74 | Ga0068854_100002880 | 3300005578 | Bacteria | 10705 |
| 75 | Ga0068851_10000857 | 3300005834 | Bacteria | 13097 |
| 76 | Ga0068851_10009790 | 3300005834 | Bacteria | 4465 |
| 77 | Ga0068858_100005634 | 3300005842 | Bacteria | 12247 |
| 78 | Ga0068862_100005745 | 3300005844 | Bacteria | 10350 |
| 79 | Ga0081538_10012237 | 3300005981 | Bacteria | 6891 |
| 80 | Ga0081540_1009283 | 3300005983 | Bacteria | 6784 |
| 81 | Ga0081539_10001562 | 3300005985 | Bacteria | 37987 |
| 82 | Ga0079104_1000823 | 3300006946 | Bacteria | 25811 |
| 83 | Ga0099826_10025336 | 3300006948 | Bacteria | 4399 |
| 84 | Ga0105251_10000215 | 3300009011 | Bacteria | 58675 |
| 85 | Ga0105251_10000924 | 3300009011 | Bacteria | 26310 |
| 86 | Ga0105251_10012316 | 3300009011 | Bacteria | 4844 |
| 87 | Ga0105251_10017057 | 3300009011 | Bacteria | 3902 |
| 88 | Ga0105244_10000564 | 3300009036 | Bacteria | 33108 |
| 89 | Ga0105244_10001338 | 3300009036 | Bacteria | 20125 |
| 90 | Ga0105244_10002323 | 3300009036 | Bacteria | 14461 |
| 91 | Ga0105244_10009100 | 3300009036 | Bacteria | 6134 |
| 92 | Ga0105244_10013244 | 3300009036 | Bacteria | 4830 |
| 93 | Ga0105244_10016000 | 3300009036 | Bacteria | 4287 |
| 94 | Ga0105244_10024178 | 3300009036 | Bacteria | 3319 |
| 95 | Ga0105244_10044264 | 3300009036 | Bacteria | 2294 |
| 96 | Ga0105250_10000370 | 3300009092 | Bacteria | 33590 |
| 97 | Ga0105250_10001079 | 3300009092 | Bacteria | 15444 |
| 98 | Ga0105250_10003522 | 3300009092 | Bacteria | 7381 |
| 99 | Ga0105240_10002080 | 3300009093 | Bacteria | 32802 |
| 100 | Ga0105240_10005298 | 3300009093 | Bacteria | 19245 |
| 101 | Ga0105240_10006245 | 3300009093 | Bacteria | 17532 |
| 102 | Ga0105240_10006631 | 3300009093 | Bacteria | 16992 |
| 103 | Ga0105240_10022023 | 3300009093 | Bacteria | 8462 |
| 104 | Ga0105240_10027693 | 3300009093 | Bacteria | 7417 |
| 105 | Ga0105247_10000745 | 3300009101 | Bacteria | 25126 |
| 106 | Ga0105243_10000045 | 3300009148 | Bacteria | 156620 |
| 107 | Ga0105242_10004232 | 3300009176 | Bacteria | 11189 |
| 108 | Ga0105248_10001036 | 3300009177 | Bacteria | 30759 |
| 109 | Ga0105237_10001264 | 3300009545 | Bacteria | 33746 |
| 110 | Ga0105237_10008385 | 3300009545 | Bacteria | 11199 |
| 111 | Ga0105238_10001781 | 3300009551 | Bacteria | 21549 |
| 112 | Ga0105238_10007435 | 3300009551 | Bacteria | 10971 |
| 113 | Ga0105238_10014906 | 3300009551 | Bacteria | 7866 |
| 114 | Ga0105238_10043229 | 3300009551 | Bacteria | 4559 |
| 115 | Ga0105249_10005339 | 3300009553 | Bacteria | 11084 |
| 116 | Ga0105239_10004940 | 3300010375 | Bacteria | 15740 |
| 117 | Ga0105239_10013785 | 3300010375 | Bacteria | 8972 |
| 118 | Ga0105246_10005991 | 3300011119 | Bacteria | 7423 |
| 119 | Ga0157373_10000819 | 3300013100 | Bacteria | 24092 |
| 120 | Ga0157373_10008189 | 3300013100 | Bacteria | 7774 |
| 121 | Ga0157373_10011579 | 3300013100 | Bacteria | 6479 |
| 122 | Ga0157371_10000359 | 3300013102 | Bacteria | 57981 |
| 123 | Ga0157371_10002766 | 3300013102 | Bacteria | 16483 |
| 124 | Ga0157370_10000127 | 3300013104 | Bacteria | 90772 |
| 125 | Ga0157370_10070231 | 3300013104 | Bacteria | 3306 |
| 126 | Ga0157370_10101181 | 3300013104 | Bacteria | 2699 |
| 127 | Ga0157369_10026879 | 3300013105 | Bacteria | 6382 |
| 128 | Ga0157369_10040412 | 3300013105 | Bacteria | 5091 |
| 129 | Ga0157372_10097213 | 3300013307 | Bacteria | 3358 |
| 130 | Ga0182008_10021402 | 3300014497 | Bacteria | 3320 |
| 131 | Ga0182008_10031554 | 3300014497 | Bacteria | 2667 |
| 132 | Ga0157376_10016268 | 3300014969 | Bacteria | 5641 |
| 133 | Ga0182006_1000034 | 3300015261 | Bacteria | 232484 |
| 134 | Ga0182006_1000342 | 3300015261 | Bacteria | 39675 |
| 135 | Ga0182006_1005976 | 3300015261 | Bacteria | 5714 |
| 136 | Ga0182006_1009981 | 3300015261 | Bacteria | 4240 |
| 137 | Ga0182006_1011544 | 3300015261 | Bacteria | 3884 |
| 138 | Ga0182007_10000177 | 3300015262 | Bacteria | 43427 |
| 139 | Ga0182007_10005023 | 3300015262 | Bacteria | 5877 |
| 140 | Ga0182005_1000045 | 3300015265 | Bacteria | 138175 |
| 141 | Ga0182005_1000613 | 3300015265 | Bacteria | 17239 |
| 142 | Ga0182005_1001311 | 3300015265 | Bacteria | 10192 |
| 143 | Ga0182005_1004405 | 3300015265 | Bacteria | 4558 |
| 144 | Ga0182005_1004528 | 3300015265 | Bacteria | 4477 |
| 145 | Ga0163161_10004619 | 3300017792 | Bacteria | 9585 |
| 146 | Ga0209760_100023 | 3300025207 | Bacteria | 159144 |
| 147 | Ga0209760_100025 | 3300025207 | Bacteria | 156628 |
| 148 | Ga0209760_100710 | 3300025207 | Bacteria | 5059 |
| 149 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 150 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 151 | Ga0209784_100058 | 3300025224 | Bacteria | 167327 |
| 152 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 153 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 154 | Ga0209566_100045 | 3300025225 | Bacteria | 258557 |
| 155 | Ga0209566_101309 | 3300025225 | Bacteria | 8054 |
| 156 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 157 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 158 | Ga0209674_100096 | 3300025226 | Bacteria | 167418 |
| 159 | Ga0209674_100443 | 3300025226 | Bacteria | 19098 |
| 160 | Ga0209674_103427 | 3300025226 | Bacteria | 2916 |
| 161 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 162 | Ga0209672_100065 | 3300025228 | Bacteria | 198168 |
| 163 | Ga0209147_100026 | 3300025229 | Bacteria | 421622 |
| 164 | Ga0209147_100056 | 3300025229 | Bacteria | 258557 |
| 165 | Ga0209147_100180 | 3300025229 | Bacteria | 78654 |
| 166 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 167 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 168 | Ga0209563_100064 | 3300025230 | Bacteria | 258557 |
| 169 | Ga0207427_100003 | 3300025231 | Bacteria | 1035004 |
| 170 | Ga0207427_100018 | 3300025231 | Bacteria | 530735 |
| 171 | Ga0207427_102581 | 3300025231 | Bacteria | 4688 |
| 172 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 173 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 174 | Ga0209437_100031 | 3300025233 | Bacteria | 530871 |
| 175 | Ga0209437_105108 | 3300025233 | Bacteria | 2255 |
| 176 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 177 | Ga0209258_100079 | 3300025242 | Bacteria | 263132 |
| 178 | Ga0209258_100446 | 3300025242 | Bacteria | 45941 |
| 179 | Ga0209646_1000147 | 3300025246 | Bacteria | 103287 |
| 180 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 181 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 182 | Ga0209677_100053 | 3300025253 | Bacteria | 167537 |
| 183 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 184 | Ga0209148_1001323 | 3300025254 | Bacteria | 13159 |
| 185 | Ga0209148_1001500 | 3300025254 | Bacteria | 11567 |
| 186 | Ga0209129_1001032 | 3300025258 | Bacteria | 16561 |
| 187 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 188 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 189 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 190 | Ga0209455_1000058 | 3300025272 | Bacteria | 342028 |
| 191 | Ga0209455_1001897 | 3300025272 | Bacteria | 8690 |
| 192 | Ga0209673_1000420 | 3300025273 | Bacteria | 74545 |
| 193 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 194 | Ga0209676_1000055 | 3300025292 | Bacteria | 361565 |
| 195 | Ga0209564_1011024 | 3300025295 | Bacteria | 4091 |
| 196 | Ga0209758_1000060 | 3300025297 | Bacteria | 324326 |
| 197 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 198 | Ga0209050_1000043 | 3300025298 | Bacteria | 398654 |
| 199 | Ga0209050_1000231 | 3300025298 | Bacteria | 122373 |
| 200 | Ga0209050_1002798 | 3300025298 | Bacteria | 13965 |
| 201 | Ga0209051_1000030 | 3300025303 | Bacteria | 398654 |
| 202 | Ga0209051_1000052 | 3300025303 | Bacteria | 283346 |
| 203 | Ga0209051_1000165 | 3300025303 | Bacteria | 122373 |
| 204 | Ga0209257_1000297 | 3300025304 | Bacteria | 109481 |
| 205 | Ga0209257_1000767 | 3300025304 | Bacteria | 47879 |
| 206 | Ga0209257_1001804 | 3300025304 | Bacteria | 23486 |
| 207 | Ga0209257_1012816 | 3300025304 | Bacteria | 3813 |
| 208 | Ga0207656_10002350 | 3300025321 | Bacteria | 6352 |
| 209 | Ga0207656_10005547 | 3300025321 | Bacteria | 4468 |
| 210 | Ga0207696_1000011 | 3300025711 | Bacteria | 530614 |
| 211 | Ga0207696_1000041 | 3300025711 | Bacteria | 311695 |
| 212 | Ga0207696_1000628 | 3300025711 | Bacteria | 25903 |
| 213 | Ga0207655_1000085 | 3300025728 | Bacteria | 206425 |
| 214 | Ga0207655_1000137 | 3300025728 | Bacteria | 140084 |
| 215 | Ga0207655_1000141 | 3300025728 | Bacteria | 138956 |
| 216 | Ga0207655_1001565 | 3300025728 | Bacteria | 20579 |
| 217 | Ga0207655_1009316 | 3300025728 | Bacteria | 6111 |
| 218 | Ga0207655_1031660 | 3300025728 | Bacteria | 2432 |
| 219 | Ga0207713_1000042 | 3300025735 | Bacteria | 242199 |
| 220 | Ga0207713_1000162 | 3300025735 | Bacteria | 98630 |
| 221 | Ga0207713_1001279 | 3300025735 | Bacteria | 20735 |
| 222 | Ga0207713_1003516 | 3300025735 | Bacteria | 10623 |
| 223 | Ga0207713_1012405 | 3300025735 | Bacteria | 4561 |
| 224 | Ga0207713_1016476 | 3300025735 | Bacteria | 3749 |
| 225 | Ga0207713_1035283 | 3300025735 | Bacteria | 2160 |
| 226 | Ga0207647_10002292 | 3300025904 | Bacteria | 14570 |
| 227 | Ga0207647_10009895 | 3300025904 | Bacteria | 6753 |
| 228 | Ga0207695_10000033 | 3300025913 | Bacteria | 507477 |
| 229 | Ga0207695_10000961 | 3300025913 | Bacteria | 51376 |
| 230 | Ga0207695_10001626 | 3300025913 | Bacteria | 36374 |
| 231 | Ga0207695_10018930 | 3300025913 | Bacteria | 7943 |
| 232 | Ga0207695_10103482 | 3300025913 | Bacteria | 2838 |
| 233 | Ga0207671_10000394 | 3300025914 | Bacteria | 61087 |
| 234 | Ga0207671_10004277 | 3300025914 | Bacteria | 13738 |
| 235 | Ga0207657_10000494 | 3300025919 | Bacteria | 41647 |
| 236 | Ga0207649_10000251 | 3300025920 | Bacteria | 43152 |
| 237 | Ga0207681_10003143 | 3300025923 | Bacteria | 10379 |
| 238 | Ga0207694_10001986 | 3300025924 | Bacteria | 16920 |
| 239 | Ga0207694_10015424 | 3300025924 | Bacteria | 5762 |
| 240 | Ga0207650_10000384 | 3300025925 | Bacteria | 40899 |
| 241 | Ga0207650_10023751 | 3300025925 | Bacteria | 4353 |
| 242 | Ga0207650_10040682 | 3300025925 | Bacteria | 3403 |
| 243 | Ga0207690_10000026 | 3300025932 | Bacteria | 175904 |
| 244 | Ga0207706_10003456 | 3300025933 | Bacteria | 15081 |
| 245 | Ga0207706_10011479 | 3300025933 | Bacteria | 8067 |
| 246 | Ga0207706_10031620 | 3300025933 | Bacteria | 4714 |
| 247 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 248 | Ga0207711_10000819 | 3300025941 | Bacteria | 30356 |
| 249 | Ga0207679_10000016 | 3300025945 | Bacteria | 253494 |
| 250 | Ga0207667_10000032 | 3300025949 | Bacteria | 322253 |
| 251 | Ga0207667_10025283 | 3300025949 | Bacteria | 6502 |
| 252 | Ga0207712_10000288 | 3300025961 | Bacteria | 47902 |
| 253 | Ga0207658_10010889 | 3300025986 | Bacteria | 6190 |
| 254 | Ga0207703_10001081 | 3300026035 | Bacteria | 25944 |
| 255 | Ga0207639_10000448 | 3300026041 | Bacteria | 28377 |
| 256 | Ga0207639_10089134 | 3300026041 | Bacteria | 2464 |
| 257 | Ga0207639_10109651 | 3300026041 | Bacteria | 2246 |
| 258 | Ga0207678_10001257 | 3300026067 | Bacteria | 23391 |
| 259 | Ga0207678_10014945 | 3300026067 | Bacteria | 6829 |
| 260 | Ga0207648_10012176 | 3300026089 | Bacteria | 8058 |
| 261 | Ga0207648_10077781 | 3300026089 | Bacteria | 2893 |
| 262 | Ga0207683_10036062 | 3300026121 | Bacteria | 4304 |
| 263 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 264 | Ga0209371_1000858 | 3300027312 | Bacteria | 24618 |
| 265 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 266 | Ga0307517_10001421 | 3300028786 | Bacteria | 40285 |
| 267 | Ga0307515_10006095 | 3300028794 | Bacteria | 24239 |
| 268 | Ga0307515_10023797 | 3300028794 | Bacteria | 10710 |
| 269 | Ga0307515_10025906 | 3300028794 | Bacteria | 10118 |
| 270 | Ga0268256_1000477 | 3300030500 | Bacteria | 34416 |
| 271 | Ga0307513_10005067 | 3300031456 | Bacteria | 17439 |
| 272 | Ga0307408_100015782 | 3300031548 | Bacteria | 5032 |
| 273 | Ga0307408_100046021 | 3300031548 | Bacteria | 3119 |
| 274 | Ga0307508_10000096 | 3300031616 | Bacteria | 103730 |
| 275 | Ga0307508_10063396 | 3300031616 | Bacteria | 3261 |
| 276 | Ga0307508_10067003 | 3300031616 | Bacteria | 3159 |
| 277 | Ga0307514_10001862 | 3300031649 | Bacteria | 23281 |
| 278 | Ga0307516_10002913 | 3300031730 | Bacteria | 22413 |
| 279 | Ga0307405_10000390 | 3300031731 | Bacteria | 16413 |
| 280 | Ga0307405_10004963 | 3300031731 | Bacteria | 6355 |
| 281 | Ga0307405_10014951 | 3300031731 | Bacteria | 4190 |
| 282 | Ga0307405_10026124 | 3300031731 | Bacteria | 3364 |
| 283 | Ga0307413_10000009 | 3300031824 | Bacteria | 62408 |
| 284 | Ga0307413_10000598 | 3300031824 | Bacteria | 12121 |
| 285 | Ga0307413_10011428 | 3300031824 | Bacteria | 4365 |
| 286 | Ga0307413_10016640 | 3300031824 | Bacteria | 3806 |
| 287 | Ga0307413_10025758 | 3300031824 | Bacteria | 3230 |
| 288 | Ga0307410_10000430 | 3300031852 | Bacteria | 16734 |
| 289 | Ga0307410_10034585 | 3300031852 | Bacteria | 3274 |
| 290 | Ga0307406_10020193 | 3300031901 | Bacteria | 3919 |
| 291 | Ga0307412_10000720 | 3300031911 | Bacteria | 19115 |
| 292 | Ga0307409_100011807 | 3300031995 | Bacteria | 5530 |
| 293 | Ga0307409_100090202 | 3300031995 | Bacteria | 2508 |
| 294 | Ga0307414_10000718 | 3300032004 | Bacteria | 16955 |
| 295 | Ga0307414_10037648 | 3300032004 | Bacteria | 3241 |
| 296 | Ga0307411_10000058 | 3300032005 | Bacteria | 32882 |
| 297 | Ga0307411_10007373 | 3300032005 | Bacteria | 5596 |
| 298 | Ga0307411_10007688 | 3300032005 | Bacteria | 5517 |
| 299 | Ga0307411_10025119 | 3300032005 | Bacteria | 3564 |
| 300 | Ga0307411_10032964 | 3300032005 | Bacteria | 3207 |
| 301 | Ga0307411_10040216 | 3300032005 | Bacteria | 2964 |
| 302 | Ga0307415_100009328 | 3300032126 | Bacteria | 5493 |
| 303 | Ga0307510_10000006 | 3300033180 | Bacteria | 566474 |
| 304 | Ga0373937_0190751 | 3300036401 | Bacteria | 1926 |
| 305 | Ga0395901_0030901 | 3300038443 | Bacteria | 5519 |
| 306 | Ga0436361_0513552 | 3300039447 | Bacteria | 4331 |
| 307 | Ga0439436_0000015 | 3300041404 | Bacteria | 85239 |
| 308 | Ga0439438_001800 | 3300041405 | Bacteria | 9404 |
| 309 | Ga0439447_002071 | 3300041407 | Bacteria | 7377 |
| 310 | Ga0439466_0004012 | 3300041411 | Bacteria | 5680 |
| 311 | Ga0439466_0010241 | 3300041411 | Bacteria | 3487 |
| 312 | Ga0439465_0000091 | 3300041413 | Bacteria | 20149 |
| 313 | Ga0451853_0587720 | 3300041512 | Bacteria | 2357 |
| 314 | Ga0439432_001119 | 3300042006 | Bacteria | 10187 |
| 315 | Ga0439432_022622 | 3300042006 | Bacteria | 2075 |
| 316 | Ga0439451_003923 | 3300042009 | Bacteria | 3025 |
| 317 | Ga0439452_006659 | 3300042010 | Bacteria | 3601 |
| 318 | Ga0439456_008021 | 3300042013 | Bacteria | 2178 |
| 319 | Ga0450907_000010 | 3300042146 | Bacteria | 95376 |
| 320 | Ga0450908_000273 | 3300042184 | Bacteria | 10186 |
| 321 | Ga0450909_000696 | 3300042185 | Bacteria | 4503 |
| 322 | Ga0451577_0027187 | 3300042876 | Bacteria | 5178 |
| 323 | Ga0466972_0000754 | 3300044658 | Bacteria | 15432 |
| 324 | Ga0453683_0025830 | 3300044673 | Bacteria | 3729 |
| 325 | Ga0453684_0009221 | 3300044712 | Bacteria | 17333 |
| 326 | Ga0466968_0002276 | 3300044735 | Bacteria | 7020 |
| 327 | Ga0451576_0001244 | 3300045051 | Bacteria | 44809 |
| 328 | Ga0495617_000024 | 3300046452 | Bacteria | 174402 |
| 329 | Ga0495617_000054 | 3300046452 | Bacteria | 102256 |
| 330 | Ga0495617_000144 | 3300046452 | Bacteria | 46606 |
| 331 | Ga0495617_000476 | 3300046452 | Bacteria | 21320 |
| 332 | Ga0495627_000120 | 3300046453 | Bacteria | 97375 |
| 333 | Ga0495627_000308 | 3300046453 | Bacteria | 48367 |
| 334 | Ga0495627_012417 | 3300046453 | Bacteria | 3023 |
| 335 | Ga0495592_0011881 | 3300046454 | Bacteria | 6599 |
| 336 | Ga0495603_0001986 | 3300046455 | Bacteria | 12045 |
| 337 | Ga0495590_0000364 | 3300046457 | Bacteria | 23127 |
| 338 | Ga0495590_0001495 | 3300046457 | Bacteria | 10040 |
| 339 | Ga0495590_0005545 | 3300046457 | Bacteria | 4994 |
| 340 | Ga0495591_000064 | 3300046458 | Bacteria | 123820 |
| 341 | Ga0495591_000315 | 3300046458 | Bacteria | 43798 |
| 342 | Ga0495591_001261 | 3300046458 | Bacteria | 16235 |
| 343 | Ga0495591_003301 | 3300046458 | Bacteria | 8429 |
| 344 | Ga0495638_0000363 | 3300046460 | Bacteria | 56118 |
| 345 | Ga0495638_0017737 | 3300046460 | Bacteria | 4740 |
| 346 | Ga0495638_0020356 | 3300046460 | Bacteria | 4384 |
| 347 | Ga0495638_0026643 | 3300046460 | Bacteria | 3746 |
| 348 | Ga0495638_0038691 | 3300046460 | Bacteria | 3029 |
| 349 | Ga0495651_0007096 | 3300046462 | Bacteria | 8562 |
| 350 | Ga0495653_0001170 | 3300046463 | Bacteria | 20256 |
| 351 | Ga0495653_0009203 | 3300046463 | Bacteria | 8078 |
| 352 | Ga0495650_0000557 | 3300046471 | Bacteria | 52926 |
| 353 | Ga0495650_0000881 | 3300046471 | Bacteria | 35559 |
| 354 | Ga0495650_0001501 | 3300046471 | Bacteria | 22235 |
| 355 | Ga0495650_0003204 | 3300046471 | Bacteria | 12176 |
| 356 | Ga0495650_0008186 | 3300046471 | Bacteria | 6144 |
| 357 | Ga0495605_0000057 | 3300046474 | Bacteria | 150333 |
| 358 | Ga0495605_0000191 | 3300046474 | Bacteria | 76513 |
| 359 | Ga0495605_0000794 | 3300046474 | Bacteria | 22656 |
| 360 | Ga0495605_0003323 | 3300046474 | Bacteria | 9622 |
| 361 | Ga0495605_0032845 | 3300046474 | Bacteria | 2639 |
| 362 | Ga0495639_0000032 | 3300046475 | Bacteria | 64548 |
| 363 | Ga0495584_0000409 | 3300046491 | Bacteria | 29687 |
| 364 | Ga0495584_0000547 | 3300046491 | Bacteria | 25497 |
| 365 | Ga0495584_0002662 | 3300046491 | Bacteria | 10055 |
| 366 | Ga0495584_0014174 | 3300046491 | Bacteria | 4062 |
| 367 | Ga0495585_0000082 | 3300046492 | Bacteria | 99210 |
| 368 | Ga0495585_0013643 | 3300046492 | Bacteria | 4751 |
| 369 | Ga0495594_0044447 | 3300046499 | Bacteria | 2436 |
| 370 | Ga0495607_0000008 | 3300046501 | Bacteria | 265274 |
| 371 | Ga0495607_0000058 | 3300046501 | Bacteria | 109864 |
| 372 | Ga0495607_0000185 | 3300046501 | Bacteria | 66759 |
| 373 | Ga0495607_0000266 | 3300046501 | Bacteria | 56114 |
| 374 | Ga0495607_0000290 | 3300046501 | Bacteria | 53251 |
| 375 | Ga0495607_0000617 | 3300046501 | Bacteria | 34500 |
| 376 | Ga0495607_0003284 | 3300046501 | Bacteria | 12430 |
| 377 | Ga0495607_0011010 | 3300046501 | Bacteria | 6043 |
| 378 | Ga0495607_0016974 | 3300046501 | Bacteria | 4686 |
| 379 | Ga0495607_0027186 | 3300046501 | Bacteria | 3542 |
| 380 | Ga0495607_0071375 | 3300046501 | Bacteria | 1936 |
| 381 | Ga0495583_0000483 | 3300046506 | Bacteria | 58302 |
| 382 | Ga0495583_0001110 | 3300046506 | Bacteria | 29768 |
| 383 | Ga0495583_0003663 | 3300046506 | Bacteria | 11448 |
| 384 | Ga0495583_0004945 | 3300046506 | Bacteria | 9256 |
| 385 | Ga0495583_0010911 | 3300046506 | Bacteria | 5249 |
| 386 | Ga0495583_0014279 | 3300046506 | Bacteria | 4389 |
| 387 | Ga0495606_0000136 | 3300046507 | Bacteria | 125611 |
| 388 | Ga0495606_0000633 | 3300046507 | Bacteria | 55270 |
| 389 | Ga0495606_0001206 | 3300046507 | Bacteria | 36344 |
| 390 | Ga0495606_0001286 | 3300046507 | Bacteria | 34779 |
| 391 | Ga0495606_0001714 | 3300046507 | Bacteria | 28242 |
| 392 | Ga0495606_0003155 | 3300046507 | Bacteria | 17833 |
| 393 | Ga0495608_0018050 | 3300046511 | Bacteria | 4874 |
| 394 | Ga0495608_0040254 | 3300046511 | Bacteria | 3131 |
| 395 | Ga0495610_0002898 | 3300046512 | Bacteria | 13883 |
| 396 | Ga0495610_0004604 | 3300046512 | Bacteria | 10105 |
| 397 | Ga0495610_0040400 | 3300046512 | Bacteria | 2351 |
| 398 | Ga0495616_0000003 | 3300046513 | Bacteria | 290178 |
| 399 | Ga0495616_0000226 | 3300046513 | Bacteria | 46396 |
| 400 | Ga0495616_0000661 | 3300046513 | Bacteria | 25616 |
| 401 | Ga0495616_0003952 | 3300046513 | Bacteria | 9441 |
| 402 | Ga0495616_0004101 | 3300046513 | Bacteria | 9238 |
| 403 | Ga0495616_0004782 | 3300046513 | Bacteria | 8483 |
| 404 | Ga0495618_0002091 | 3300046514 | Bacteria | 13092 |
| 405 | Ga0495618_0071780 | 3300046514 | Bacteria | 2203 |
| 406 | Ga0495620_0000102 | 3300046515 | Bacteria | 68028 |
| 407 | Ga0495620_0000166 | 3300046515 | Bacteria | 52419 |
| 408 | Ga0495620_0000537 | 3300046515 | Bacteria | 24263 |
| 409 | Ga0495620_0003457 | 3300046515 | Bacteria | 9035 |
| 410 | Ga0495620_0011683 | 3300046515 | Bacteria | 4569 |
| 411 | Ga0495620_0014405 | 3300046515 | Bacteria | 4019 |
| 412 | Ga0495628_0001001 | 3300046516 | Bacteria | 25857 |
| 413 | Ga0495628_0004631 | 3300046516 | Bacteria | 12146 |
| 414 | Ga0495631_0000267 | 3300046518 | Bacteria | 36464 |
| 415 | Ga0495631_0000489 | 3300046518 | Bacteria | 26545 |
| 416 | Ga0495631_0001295 | 3300046518 | Bacteria | 15349 |
| 417 | Ga0495631_0006742 | 3300046518 | Bacteria | 5895 |
| 418 | Ga0495631_0015307 | 3300046518 | Bacteria | 3677 |
| 419 | Ga0495632_0000008 | 3300046519 | Bacteria | 294056 |
| 420 | Ga0495632_0000754 | 3300046519 | Bacteria | 29135 |
| 421 | Ga0495632_0001740 | 3300046519 | Bacteria | 17652 |
| 422 | Ga0495632_0002380 | 3300046519 | Bacteria | 14374 |
| 423 | Ga0495632_0028117 | 3300046519 | Bacteria | 2937 |
| 424 | Ga0495632_0028591 | 3300046519 | Bacteria | 2908 |
| 425 | Ga0495632_0035967 | 3300046519 | Bacteria | 2522 |
| 426 | Ga0495637_0000037 | 3300046520 | Bacteria | 120732 |
| 427 | Ga0495637_0000977 | 3300046520 | Bacteria | 18146 |
| 428 | Ga0495637_0001374 | 3300046520 | Bacteria | 14567 |
| 429 | Ga0495637_0003424 | 3300046520 | Bacteria | 8427 |
| 430 | Ga0495637_0017095 | 3300046520 | Bacteria | 3386 |
| 431 | Ga0495643_0024936 | 3300046522 | Bacteria | 3388 |
| 432 | Ga0495643_0030373 | 3300046522 | Bacteria | 3017 |
| 433 | Ga0495643_0045146 | 3300046522 | Bacteria | 2393 |
| 434 | Ga0495648_0000194 | 3300046524 | Bacteria | 69964 |
| 435 | Ga0495648_0000377 | 3300046524 | Bacteria | 48820 |
| 436 | Ga0495648_0001717 | 3300046524 | Bacteria | 21157 |
| 437 | Ga0495648_0010178 | 3300046524 | Bacteria | 7188 |
| 438 | Ga0495642_0000316 | 3300046528 | Bacteria | 26656 |
| 439 | Ga0495652_0012335 | 3300046529 | Bacteria | 7714 |
| 440 | Ga0495652_0026645 | 3300046529 | Bacteria | 5104 |
| 441 | Ga0495654_0000211 | 3300046530 | Bacteria | 55188 |
| 442 | Ga0495654_0000288 | 3300046530 | Bacteria | 45799 |
| 443 | Ga0495654_0000306 | 3300046530 | Bacteria | 43427 |
| 444 | Ga0495654_0001477 | 3300046530 | Bacteria | 16099 |
| 445 | Ga0495654_0001887 | 3300046530 | Bacteria | 13935 |
| 446 | Ga0495654_0002069 | 3300046530 | Bacteria | 13171 |
| 447 | Ga0495654_0006785 | 3300046530 | Bacteria | 6465 |
| 448 | Ga0495587_0014470 | 3300046536 | Bacteria | 4946 |
| 449 | Ga0495609_0000011 | 3300046538 | Bacteria | 334377 |
| 450 | Ga0495609_0000075 | 3300046538 | Bacteria | 121584 |
| 451 | Ga0495609_0001756 | 3300046538 | Bacteria | 13921 |
| 452 | Ga0495645_0008523 | 3300046543 | Bacteria | 7159 |
| 453 | Ga0495645_0025652 | 3300046543 | Bacteria | 4280 |
| 454 | Ga0495622_0000590 | 3300046557 | Bacteria | 21268 |
| 455 | Ga0495622_0001201 | 3300046557 | Bacteria | 13369 |
| 456 | Ga0495622_0001396 | 3300046557 | Bacteria | 12267 |
| 457 | Ga0495668_0005182 | 3300046616 | Bacteria | 8950 |
| 458 | Ga0495634_0000025 | 3300046642 | Bacteria | 115964 |
| 459 | Ga0495611_0000004 | 3300046648 | Bacteria | 308149 |
| 460 | Ga0495611_0000113 | 3300046648 | Bacteria | 56814 |
| 461 | Ga0495611_0000349 | 3300046648 | Bacteria | 30120 |
| 462 | Ga0495625_0000024 | 3300046660 | Bacteria | 271126 |
| 463 | Ga0495625_0000089 | 3300046660 | Bacteria | 147075 |
| 464 | Ga0495625_0000847 | 3300046660 | Bacteria | 41784 |
| 465 | Ga0495625_0009172 | 3300046660 | Bacteria | 8313 |
| 466 | Ga0495635_0000298 | 3300046663 | Bacteria | 31939 |
| 467 | Ga0495659_0000123 | 3300046664 | Bacteria | 33987 |
| 468 | Ga0495661_0000018 | 3300046665 | Bacteria | 200787 |
| 469 | Ga0495661_0000028 | 3300046665 | Bacteria | 182191 |
| 470 | Ga0495661_0000083 | 3300046665 | Bacteria | 116027 |
| 471 | Ga0495661_0000101 | 3300046665 | Bacteria | 104928 |
| 472 | Ga0495661_0001798 | 3300046665 | Bacteria | 17218 |
| 473 | Ga0495661_0004052 | 3300046665 | Bacteria | 10673 |
| 474 | Ga0495661_0031298 | 3300046665 | Bacteria | 3379 |
| 475 | Ga0495588_0007463 | 3300046674 | Bacteria | 4978 |
| 476 | Ga0495623_0006329 | 3300046679 | Bacteria | 7697 |
| 477 | Ga0495623_0014890 | 3300046679 | Bacteria | 5029 |
| 478 | Ga0495646_0001211 | 3300046680 | Bacteria | 15107 |
| 479 | Ga0495646_0003303 | 3300046680 | Bacteria | 10042 |
| 480 | Ga0495669_0003084 | 3300046684 | Bacteria | 6850 |
| 481 | Ga0495670_0000168 | 3300046691 | Bacteria | 28846 |
| 482 | Ga0495670_0000332 | 3300046691 | Bacteria | 22511 |
| 483 | Ga0495670_0014042 | 3300046691 | Bacteria | 3940 |
| 484 | Ga0495671_0000295 | 3300046692 | Bacteria | 41756 |
| 485 | Ga0495671_0000960 | 3300046692 | Bacteria | 20228 |
| 486 | Ga0495671_0001060 | 3300046692 | Bacteria | 19054 |
| 487 | Ga0495671_0001565 | 3300046692 | Bacteria | 15188 |
| 488 | Ga0495671_0004195 | 3300046692 | Bacteria | 8681 |
| 489 | Ga0495671_0029739 | 3300046692 | Bacteria | 2802 |
| 490 | Ga0495649_0000013 | 3300046694 | Bacteria | 316013 |
| 491 | Ga0495649_0000909 | 3300046694 | Bacteria | 23449 |
| 492 | Ga0495649_0027968 | 3300046694 | Bacteria | 3126 |
| 493 | Ga0495589_0000038 | 3300046794 | Bacteria | 149381 |
| 494 | Ga0495589_0000141 | 3300046794 | Bacteria | 66457 |
| 495 | Ga0495589_0000846 | 3300046794 | Bacteria | 19210 |
| 496 | Ga0495660_0000052 | 3300046810 | Bacteria | 137821 |
| 497 | Ga0495660_0000064 | 3300046810 | Bacteria | 124968 |
| 498 | Ga0495660_0003252 | 3300046810 | Bacteria | 10096 |
| 499 | Ga0495581_0013045 | 3300047315 | Bacteria | 4816 |
| 500 | Ga0495604_0002087 | 3300047317 | Bacteria | 16085 |
| 501 | Ga0495604_0002922 | 3300047317 | Bacteria | 13682 |
| 502 | Ga0495636_0002282 | 3300047318 | Bacteria | 7363 |
| 503 | Ga0495674_0054405 | 3300047319 | Bacteria | 3515 |
| 504 | Ga0495672_0000419 | 3300047320 | Bacteria | 51114 |
| 505 | Ga0495672_0001510 | 3300047320 | Bacteria | 22783 |
| 506 | Ga0495672_0003661 | 3300047320 | Bacteria | 13008 |
| 507 | Ga0495672_0013150 | 3300047320 | Bacteria | 5723 |
| 508 | Ga0495676_0000020 | 3300047321 | Bacteria | 166813 |
| 509 | Ga0495680_0047968 | 3300047322 | Bacteria | 3356 |
| 510 | Ga0495683_0000482 | 3300047323 | Bacteria | 30948 |
| 511 | Ga0495683_0031829 | 3300047323 | Bacteria | 2687 |
| 512 | Ga0495687_000715 | 3300047443 | Bacteria | 36786 |
| 513 | Ga0495687_001973 | 3300047443 | Bacteria | 17494 |
| 514 | Ga0495687_004068 | 3300047443 | Bacteria | 10135 |
| 515 | Ga0495687_009189 | 3300047443 | Bacteria | 5558 |
| 516 | Ga0495675_0019279 | 3300047444 | Bacteria | 4333 |
| 517 | Ga0495679_000011 | 3300047446 | Bacteria | 324498 |
| 518 | Ga0495679_000079 | 3300047446 | Bacteria | 90806 |
| 519 | Ga0495679_000711 | 3300047446 | Bacteria | 21533 |
| 520 | Ga0495679_004366 | 3300047446 | Bacteria | 6553 |
| 521 | Ga0495673_0000036 | 3300047469 | Bacteria | 311035 |
| 522 | Ga0495673_0000101 | 3300047469 | Bacteria | 173409 |
| 523 | Ga0495673_0000190 | 3300047469 | Bacteria | 97539 |
| 524 | Ga0495673_0000421 | 3300047469 | Bacteria | 48148 |
| 525 | Ga0495673_0000833 | 3300047469 | Bacteria | 28784 |
| 526 | Ga0495673_0002842 | 3300047469 | Bacteria | 11791 |
| 527 | Ga0495673_0004301 | 3300047469 | Bacteria | 8971 |
| 528 | Ga0495673_0012840 | 3300047469 | Bacteria | 4419 |
| 529 | Ga0495673_0017156 | 3300047469 | Bacteria | 3684 |
| 530 | Ga0495673_0018027 | 3300047469 | Bacteria | 3570 |
| 531 | Ga0495673_0031214 | 3300047469 | Bacteria | 2496 |
| 532 | Ga0495681_0000027 | 3300047470 | Bacteria | 141884 |
| 533 | Ga0495681_0000237 | 3300047470 | Bacteria | 45823 |
| 534 | Ga0495686_0001651 | 3300047472 | Bacteria | 23245 |
| 535 | Ga0495593_0000310 | 3300047673 | Bacteria | 26732 |
| 536 | Ga0495593_0008619 | 3300047673 | Bacteria | 5928 |
| 537 | Ga0495626_0000041 | 3300048091 | Bacteria | 172663 |
| 538 | Ga0495626_0000352 | 3300048091 | Bacteria | 48007 |
| 539 | Ga0495626_0000583 | 3300048091 | Bacteria | 36143 |
| 540 | Ga0496101_0015206 | 3300048904 | Bacteria | 5180 |
| 541 | Ga0496102_0000038 | 3300048905 | Bacteria | 198844 |
| 542 | Ga0496102_0001378 | 3300048905 | Bacteria | 21651 |
| 543 | Ga0496102_0006765 | 3300048905 | Bacteria | 9786 |
| 544 | Ga0496104_0018269 | 3300048907 | Bacteria | 6397 |
| 545 | Ga0496106_0000402 | 3300048909 | Bacteria | 30717 |
| 546 | Ga0496109_0077812 | 3300048912 | Bacteria | 3053 |
| 547 | Ga0496110_0012406 | 3300048913 | Bacteria | 7006 |
| 548 | Ga0496114_0080632 | 3300048917 | Bacteria | 2749 |
| 549 | Ga0496116_0000221 | 3300048919 | Bacteria | 106314 |
| 550 | Ga0496116_0000984 | 3300048919 | Bacteria | 34981 |
| 551 | Ga0496116_0010423 | 3300048919 | Bacteria | 7787 |
| 552 | Ga0496116_0031228 | 3300048919 | Bacteria | 3817 |
| 553 | Ga0496116_0043318 | 3300048919 | Bacteria | 3068 |
| 554 | Ga0496117_0000090 | 3300048920 | Bacteria | 206388 |
| 555 | Ga0496117_0001257 | 3300048920 | Bacteria | 37760 |
| 556 | Ga0496117_0007657 | 3300048920 | Bacteria | 10465 |
| 557 | Ga0496117_0046008 | 3300048920 | Bacteria | 3144 |
| 558 | Ga0496118_0000032 | 3300048921 | Bacteria | 330072 |
| 559 | Ga0496118_0001081 | 3300048921 | Bacteria | 42396 |
| 560 | Ga0496118_0008451 | 3300048921 | Bacteria | 10640 |
| 561 | Ga0496118_0019747 | 3300048921 | Bacteria | 6009 |
| 562 | Ga0496118_0028393 | 3300048921 | Bacteria | 4712 |
| 563 | Ga0496119_0012436 | 3300048922 | Bacteria | 6912 |
| 564 | Ga0496119_0018617 | 3300048922 | Bacteria | 5159 |
| 565 | Ga0496119_0047360 | 3300048922 | Bacteria | 2675 |
| 566 | Ga0496120_0005377 | 3300048923 | Bacteria | 10235 |
| 567 | Ga0496121_0000071 | 3300048924 | Bacteria | 247039 |
| 568 | Ga0496121_0000307 | 3300048924 | Bacteria | 101849 |
| 569 | Ga0496121_0004753 | 3300048924 | Bacteria | 17930 |
| 570 | Ga0496121_0005910 | 3300048924 | Bacteria | 15484 |
| 571 | Ga0496121_0015170 | 3300048924 | Bacteria | 8102 |
| 572 | Ga0496121_0018989 | 3300048924 | Bacteria | 6897 |
| 573 | Ga0496121_0044422 | 3300048924 | Bacteria | 3832 |
| 574 | Ga0496122_0000285 | 3300048925 | Bacteria | 113073 |
| 575 | Ga0496122_0001763 | 3300048925 | Bacteria | 33210 |
| 576 | Ga0496122_0010175 | 3300048925 | Bacteria | 9746 |
| 577 | Ga0496123_0000232 | 3300048926 | Bacteria | 113073 |
| 578 | Ga0496124_0001091 | 3300048927 | Bacteria | 42641 |
| 579 | Ga0496124_0003813 | 3300048927 | Bacteria | 18088 |
| 580 | Ga0496124_0003909 | 3300048927 | Bacteria | 17810 |
| 581 | Ga0496124_0045951 | 3300048927 | Bacteria | 3741 |
| 582 | Ga0496124_0058092 | 3300048927 | Bacteria | 3255 |
| 583 | Ga0496125_0003672 | 3300048928 | Bacteria | 18339 |
| 584 | Ga0496125_0007498 | 3300048928 | Bacteria | 11600 |
| 585 | Ga0496125_0011347 | 3300048928 | Bacteria | 8921 |
| 586 | Ga0496125_0056129 | 3300048928 | Bacteria | 3201 |
| 587 | Ga0496126_0082985 | 3300048929 | Bacteria | 2829 |
| 588 | Ga0495678_000062 | 3300049459 | Bacteria | 140706 |
| 589 | Ga0495678_000724 | 3300049459 | Bacteria | 29966 |
| 590 | Ga0495678_001110 | 3300049459 | Bacteria | 22429 |
| 591 | Ga0495678_002200 | 3300049459 | Bacteria | 13669 |
| 592 | Ga0495678_003441 | 3300049459 | Bacteria | 9806 |
| 593 | Ga0495678_007111 | 3300049459 | Bacteria | 5850 |
| 594 | Ga0495678_035745 | 3300049459 | Bacteria | 2033 |
| 595 | Ga0495682_0000020 | 3300049460 | Bacteria | 210849 |
| 596 | Ga0495682_0000065 | 3300049460 | Bacteria | 98530 |
| 597 | Ga0495682_0001332 | 3300049460 | Bacteria | 13685 |
| 598 | Ga0495682_0001951 | 3300049460 | Bacteria | 10223 |
| 599 | Ga0501033_0001677 | 3300049570 | Bacteria | 19371 |
| 600 | Ga0501037_0001520 | 3300049573 | Bacteria | 16925 |
| 601 | Ga0501038_0013715 | 3300049574 | Bacteria | 7388 |
| 602 | Ga0501038_0038734 | 3300049574 | Bacteria | 4172 |
| 603 | Ga0501043_0006058 | 3300049579 | Bacteria | 9717 |
| 604 | Ga0501043_0018299 | 3300049579 | Bacteria | 5494 |
| 605 | Ga0501046_0000935 | 3300049580 | Bacteria | 28596 |
| 606 | Ga0501047_0015518 | 3300049581 | Bacteria | 7257 |
| 607 | Ga0501048_0020942 | 3300049582 | Bacteria | 4790 |
| 608 | Ga0501067_0014551 | 3300049583 | Bacteria | 4356 |
| 609 | Ga0501070_0139977 | 3300049586 | Bacteria | 1998 |
| 610 | Ga0501073_0003385 | 3300049589 | Bacteria | 11988 |
| 611 | Ga0501074_0030331 | 3300049590 | Bacteria | 3919 |
| 612 | Ga0501077_0004582 | 3300049593 | Bacteria | 8398 |
| 613 | Ga0501079_0009603 | 3300049741 | Bacteria | 7336 |
| 614 | Ga0501080_0011968 | 3300049742 | Bacteria | 7947 |
| 615 | Ga0501080_0042311 | 3300049742 | Bacteria | 4242 |
| 616 | Ga0501081_0007747 | 3300049743 | Bacteria | 6962 |
| 617 | Ga0501083_0001250 | 3300049744 | Bacteria | 17258 |
| 618 | Ga0501083_0029113 | 3300049744 | Bacteria | 3802 |
| 619 | Ga0501083_0068523 | 3300049744 | Bacteria | 2361 |
| 620 | Ga0501083_0074209 | 3300049744 | Bacteria | 2260 |
| 621 | Ga0501035_0024051 | 3300049822 | Bacteria | 5589 |
| 622 | Ga0501035_0024682 | 3300049822 | Bacteria | 5511 |
| 623 | Ga0501035_0105841 | 3300049822 | Bacteria | 2466 |
| 624 | Ga0501044_0044309 | 3300049823 | Bacteria | 4616 |
| 625 | nmdc:mga0qj67_12876_c1 | 3300050509 | Bacteria | 6312 |
| 626 | nmdc:mga0n895_138900_c1 | 3300050512 | Bacteria | 2457 |
| 627 | Ga0495601_0008699 | 3300053077 | Bacteria | 5991 |
| 628 | Ga0500643_000012 | 3300053087 | Bacteria | 369839 |
| 629 | Ga0500646_0009564 | 3300053090 | Bacteria | 2482 |
| 630 | Ga0500651_0016231 | 3300053093 | Bacteria | 4579 |
| 631 | Ga0500555_000233 | 3300053103 | Bacteria | 24816 |
| 632 | Ga0500595_014824 | 3300053119 | Bacteria | 2946 |
| 633 | Ga0500595_023197 | 3300053119 | Bacteria | 2184 |
| 634 | Ga0500642_0006822 | 3300053130 | Bacteria | 3792 |
| 635 | Ga0500658_0005620 | 3300053134 | Bacteria | 4665 |
| 636 | Ga0500574_001090 | 3300053141 | Bacteria | 3852 |
| 637 | Ga0500616_0000708 | 3300053153 | Bacteria | 38639 |
| 638 | Ga0500619_000066 | 3300053154 | Bacteria | 31862 |
| 639 | Ga0500633_0001497 | 3300053160 | Bacteria | 4432 |
| 640 | Ga0500645_000884 | 3300053730 | Bacteria | 17419 |
| 641 | Ga0500609_000357 | 3300053731 | Bacteria | 6761 |
| 642 | Ga0501084_0070918 | 3300054114 | Bacteria | 2917 |
| 643 | Ga0501082_0008394 | 3300060353 | Bacteria | 8909 |
| 644 | 2510284531 | 2510065053 | Bacteria | 5005518 |
| 645 | 2510295981 | 2510065055 | Bacteria | 5037935 |
| 646 | 2510311909 | 2510065058 | Bacteria | 5005894 |
| 647 | 2511272552 | 2511231007 | Bacteria | 6306603 |
| 648 | 2511290767 | 2511231010 | Bacteria | 6373152 |
| 649 | 2511313841 | 2511231014 | Bacteria | 6462302 |
| 650 | 2511323324 | 2511231015 | Bacteria | 6598026 |
| 651 | 2511327785 | 2511231016 | Bacteria | 6704427 |
| 652 | 2511343841 | 2511231019 | Bacteria | 6520662 |
| 653 | 2511359761 | 2511231021 | Bacteria | 7302637 |
| 654 | 2511362420 | 2511231022 | Bacteria | 6719296 |
| 655 | 2511824363 | 2511231156 | Bacteria | 6845832 |
| 656 | 2512328373 | 2512047018 | Bacteria | 6663241 |
| 657 | 2519458507 | 2519103095 | Bacteria | 6629912 |
| 658 | 2555669594 | 2554235341 | Bacteria | 6867980 |
| 659 | 2583792845 | 2582580891 | Bacteria | 6800976 |
| 660 | 2585292913 | 2582581311 | Bacteria | 6763856 |
| 661 | 2587756688 | 2585428062 | Bacteria | 6842168 |
| 662 | 2595447386 | 2593339238 | Bacteria | 4182970 |
| 663 | 2595450158 | 2593339239 | Bacteria | 4124669 |
| 664 | 2597857598 | 2597489887 | Bacteria | 6666321 |
| 665 | 2597864251 | 2597489888 | Bacteria | 6179543 |
| 666 | 2597869496 | 2597489889 | Bacteria | 6297495 |
| 667 | 2599330601 | 2599185155 | Bacteria | 5827168 |
| 668 | 2599353409 | 2599185160 | Bacteria | 6844013 |
| 669 | 2599363802 | 2599185161 | Bacteria | 6960462 |
| 670 | 2599370122 | 2599185162 | Bacteria | 6957254 |
| 671 | 2599372429 | 2599185163 | Bacteria | 6995158 |
| 672 | 2599378517 | 2599185164 | Bacteria | 6841688 |
| 673 | 2599384106 | 2599185165 | Bacteria | 6843250 |
| 674 | 2599391288 | 2599185166 | Bacteria | 6959206 |
| 675 | 2599399238 | 2599185167 | Bacteria | 6353609 |
| 676 | 2599407533 | 2599185168 | Bacteria | 6997636 |
| 677 | 2599453661 | 2599185179 | Bacteria | 6611171 |
| 678 | 2599460243 | 2599185181 | Bacteria | 6844519 |
| 679 | 2599470635 | 2599185182 | Bacteria | 6883168 |
| 680 | 2599484467 | 2599185185 | Bacteria | 6652270 |
| 681 | 2599489264 | 2599185186 | Bacteria | 6831633 |
| 682 | 2599502196 | 2599185188 | Bacteria | 6164180 |
| 683 | 2599509107 | 2599185189 | Bacteria | 5862825 |
| 684 | 2599513730 | 2599185190 | Bacteria | 6285678 |
| 685 | 2599518910 | 2599185191 | Bacteria | 6297582 |
| 686 | 2599616061 | 2599185212 | Bacteria | 6765997 |
| 687 | 2599737440 | 2599185239 | Bacteria | 8686614 |
| 688 | 2599748709 | 2599185240 | Bacteria | 7968121 |
| 689 | 2599772664 | 2599185248 | Bacteria | 6696816 |
| 690 | 2599802261 | 2599185257 | Bacteria | 6492581 |
| 691 | 2599881037 | 2599185288 | Bacteria | 6666191 |
| 692 | 2599885074 | 2599185289 | Bacteria | 6778765 |
| 693 | 2599892787 | 2599185290 | Bacteria | 6289611 |
| 694 | 2599899799 | 2599185291 | Bacteria | 6775623 |
| 695 | 2599932744 | 2599185300 | Bacteria | 6062622 |
| 696 | 2599945259 | 2599185302 | Bacteria | 5954930 |
| 697 | 2599949681 | 2599185303 | Bacteria | 6512725 |
| 698 | 2599955389 | 2599185304 | Bacteria | 5951361 |
| 699 | 2599960890 | 2599185305 | Bacteria | 6748700 |
| 700 | 2599965495 | 2599185306 | Bacteria | 6637356 |
| 701 | 2599976610 | 2599185308 | Bacteria | 6621546 |
| 702 | 2599984434 | 2599185309 | Bacteria | 5969593 |
| 703 | 2599990395 | 2599185310 | Bacteria | 6014457 |
| 704 | 2599992836 | 2599185311 | Bacteria | 6354990 |
| 705 | 2600001663 | 2599185312 | Bacteria | 5912071 |
| 706 | 2600008918 | 2599185313 | Bacteria | 6658188 |
| 707 | 2600010645 | 2599185314 | Bacteria | 6621749 |
| 708 | 2600018384 | 2599185315 | Bacteria | 6771107 |
| 709 | 2600023314 | 2599185316 | Bacteria | 6320029 |
| 710 | 2600028227 | 2599185317 | Bacteria | 6435722 |
| 711 | 2600034165 | 2599185318 | Bacteria | 6961590 |
| 712 | 2600040323 | 2599185319 | Bacteria | 6637840 |
| 713 | 2600049243 | 2599185320 | Bacteria | 5963263 |
| 714 | 2600052904 | 2599185321 | Bacteria | 6764560 |
| 715 | 2600056986 | 2599185322 | Bacteria | 6763055 |
| 716 | 2600066812 | 2599185323 | Bacteria | 6688755 |
| 717 | 2600074064 | 2599185324 | Bacteria | 6590677 |
| 718 | 2600077529 | 2599185325 | Bacteria | 6324919 |
| 719 | 2600210620 | 2599185355 | Bacteria | 7968906 |
| 720 | 2600212852 | 2599185356 | Bacteria | 6843884 |
| 721 | 2600357324 | 2600254930 | Bacteria | 6431253 |
| 722 | 2600366916 | 2600254931 | Bacteria | 6734225 |
| 723 | 2601625303 | 2600255283 | Bacteria | 6061572 |
| 724 | 2601690397 | 2600255296 | Bacteria | 5784754 |
| 725 | 2601773020 | 2600255313 | Bacteria | 6842543 |
| 726 | 2621300200 | 2619619299 | Bacteria | 6649820 |
| 727 | 2624491482 | 2623620446 | Bacteria | 6500345 |
| 728 | 2643871073 | 2643221571 | Bacteria | 6228673 |
| 729 | 2644190355 | 2643221633 | Bacteria | 6733554 |
| 730 | 2644284926 | 2643221650 | Bacteria | 7029547 |
| 731 | 2644622514 | 2643221713 | Bacteria | 6554480 |
| 732 | 2652548246 | 2651869719 | Bacteria | 6047974 |
| 733 | 2671094662 | 2667528170 | Bacteria | 6786960 |
| 734 | 2671095024 | 2667528171 | Bacteria | 6900659 |
| 735 | 2671124815 | 2667528176 | Bacteria | 6724917 |
| 736 | 2671770120 | 2671180172 | Bacteria | 6495783 |
| 737 | 2676746870 | 2675903129 | Bacteria | 7964495 |
| 738 | 2677901169 | 2675903420 | Bacteria | 6247433 |
| 739 | 2678263891 | 2675903515 | Bacteria | 6580491 |
| 740 | 2721028871 | 2718218334 | Bacteria | 4765486 |
| 741 | 2723249078 | 2721755607 | Bacteria | 5841722 |
| 742 | 2738675104 | 2738541265 | Bacteria | 6594665 |
| 743 | 2738690750 | 2738541271 | Bacteria | 5657310 |
| 744 | 2738753394 | 2738541282 | Bacteria | 6593925 |
| 745 | 2738810544 | 2738541294 | Bacteria | 6925949 |
| 746 | 2738862306 | 2738541303 | Bacteria | 6591772 |
| 747 | 2738897904 | 2738541309 | Bacteria | 6926455 |
| 748 | 2739257992 | 2738543015 | Bacteria | 6750701 |
| 749 | 2739266524 | 2738543016 | Bacteria | 5657564 |
| 750 | 2743737033 | 2740892503 | Bacteria | 6855563 |
| 751 | 2745004344 | 2744054620 | Bacteria | 6551379 |
| 752 | 2774123117 | 2773857670 | Bacteria | 6407454 |
| 753 | 2774130788 | 2773857672 | Bacteria | 4993178 |
| 754 | 2784315477 | 2784132072 | Bacteria | 6596533 |
| 755 | 2794594719 | 2791355520 | Bacteria | 5948615 |
| 756 | 2808854888 | 2808606361 | Bacteria | 6136259 |
| 757 | 2808926330 | 2808606376 | Bacteria | 6248667 |
| 758 | 2808932744 | 2808606377 | Bacteria | 6646337 |
| 759 | 2808934917 | 2808606378 | Bacteria | 6177535 |
| 760 | 2808948431 | 2808606380 | Bacteria | 6248705 |
| 761 | 2808954866 | 2808606381 | Bacteria | 6646461 |
| 762 | 2808963314 | 2808606383 | Bacteria | 6138645 |
| 763 | 2808978547 | 2808606385 | Bacteria | 6711065 |
| 764 | 2808993926 | 2808606388 | Bacteria | 6706662 |
| 765 | 2808998281 | 2808606389 | Bacteria | 6138126 |
| 766 | 2817260731 | 2816332253 | Bacteria | 6764532 |
| 767 | 2817278369 | 2816332256 | Bacteria | 6891714 |
| 768 | 2817456345 | 2816332286 | Bacteria | 6853759 |
| 769 | 2817491545 | 2816332298 | Bacteria | 6852809 |
| 770 | 2819544991 | 2818991436 | Bacteria | 5376622 |
| 771 | 2819637154 | 2818991452 | Bacteria | 8442785 |
| 772 | 2819705621 | 2818991464 | Bacteria | 6907494 |
| 773 | 2825657323 | 2825651385 | Bacteria | 6715909 |
| 774 | 2826585164 | 2826581358 | Bacteria | 5963467 |
| 775 | 2834030248 | 2834028612 | Bacteria | 6354979 |
| 776 | 2842818698 | 2842815866 | Bacteria | 5947510 |
| 777 | 2842831861 | 2842826826 | Bacteria | 5974129 |
| 778 | 2842840208 | 2842837860 | Bacteria | 6066181 |
| 779 | 2842853637 | 2842849001 | Bacteria | 5924277 |
| 780 | 2842858376 | 2842854478 | Bacteria | 6143501 |
| 781 | 2842920467 | 2842918807 | Bacteria | 4289178 |
| 782 | 2844670096 | 2844665904 | Bacteria | 6817974 |
| 783 | 2852617423 | 2852612431 | Bacteria | 6885235 |
| 784 | 2852672458 | 2852667396 | Bacteria | 6885555 |
| 785 | 2860342516 | 2860339153 | Bacteria | 6846989 |
| 786 | 2860870370 | 2860867994 | Bacteria | 5645326 |
| 787 | 2863427689 | 2863421361 | Bacteria | 7300805 |
| 788 | 2870071797 | 2870068957 | Bacteria | 8925310 |
| 789 | 2904571166 | 2904564687 | Bacteria | 7609577 |
| 790 | 2904578259 | 2904571731 | Bacteria | 7608790 |
| 791 | 2908450193 | 2908446538 | Bacteria | 6829095 |
| 792 | 2913039284 | 2913036834 | Bacteria | 6704877 |
| 793 | 2917073407 | 2917070673 | Bacteria | 6868303 |
| 794 | 2917833662 | 2917832318 | Bacteria | 5346010 |
| 795 | 2919087110 | 2919085039 | Bacteria | 4532964 |
| 796 | 2919128061 | 2919125081 | Bacteria | 5385106 |
| 797 | 2919406707 | 2919404418 | Bacteria | 4232372 |
| 798 | 2919456646 | 2919456309 | Bacteria | 6586567 |
| 799 | 2919485284 | 2919481497 | Bacteria | 6907839 |
| 800 | 2919537665 | 2919534386 | Bacteria | 4577686 |
| 801 | 2919700959 | 2919697872 | Bacteria | 6553725 |
| 802 | 2923156065 | 2923153595 | Bacteria | 6870622 |
| 803 | 2923586589 | 2923586266 | Bacteria | 6565975 |
| 804 | 2928131601 | 2928130867 | Bacteria | 5467269 |
| 805 | 2928163785 | 2928157003 | Bacteria | 7522202 |
| 806 | 2928164783 | 2928163908 | Bacteria | 7561269 |
| 807 | 2928172973 | 2928170801 | Bacteria | 8785406 |
| 808 | 2928540947 | 2928536128 | Bacteria | 7657547 |
| 809 | 2929147889 | 2929144301 | Bacteria | 6622272 |
| 810 | 2929192841 | 2929189879 | Bacteria | 5930554 |
| 811 | 2931369753 | 2931369376 | Bacteria | 6847892 |
| 812 | 2931394365 | 2931390751 | Bacteria | 6273349 |
| 813 | 2931402600 | 2931396565 | Bacteria | 7251677 |
| 814 | 2935357595 | 2935353572 | Unclassified | 6955622 |
| 815 | 2945933881 | 2945928738 | Bacteria | 6053221 |
| 816 | 2945964229 | 2945961074 | Bacteria | 7342064 |
| 817 | 2946010312 | 2946006987 | Bacteria | 6705746 |
| 818 | 2946030619 | 2946027586 | Bacteria | 6049274 |
| 819 | 2947237415 | 2947233263 | Bacteria | 6439278 |
| 820 | 2953995748 | 2953994433 | Bacteria | 4303959 |
| 821 | 2974298358 | 2974298342 | Bacteria | 4840922 |
| 822 | 2981996350 | 2981990288 | Bacteria | 7590678 |
| 823 | 2984289959 | 2984286254 | Bacteria | 6702062 |
| 824 | 2984504264 | 2984499530 | Bacteria | 5020881 |
| 825 | 2984505959 | 2984504281 | Bacteria | 5262371 |
| 826 | 2988729470 | 2988728565 | Bacteria | 6124362 |
| 827 | 3007401595 | 3007395558 | Bacteria | 6755444 |
| 828 | 3007869751 | 3007866637 | Bacteria | 5899198 |
| 829 | 637319925 | 637000220 | Bacteria | 7074893 |
| 830 | 642417896 | 641736154 | Bacteria | 7689995 |
| 831 | 8015690282 | 8015687852 | Bacteria | 6613826 |
| 832 | 8018845715 | 8018845410 | Bacteria | 8933938 |
| 833 | 8019772539 | 8019769354 | Bacteria | 6924660 |
| 834 | 8019778375 | 8019775933 | Bacteria | 6858656 |
| 835 | 8020813696 | 8020807995 | Bacteria | 6801506 |
| 836 | 8020942295 | 8020938398 | Bacteria | 7472757 |
| 837 | 8020947519 | 8020945358 | Bacteria | 8467355 |
| 838 | 8020958152 | 8020953355 | Bacteria | 7439080 |
| 839 | 8021124133 | 8021120328 | Bacteria | 8782274 |
| 840 | 8039104026 | 8039098773 | Bacteria | 6602928 |
| 841 | 8040171624 | 8040167225 | Bacteria | 6542727 |
| 842 | 8040177825 | 8040173305 | Bacteria | 6827067 |
| 843 | 8054286281 | 8054285046 | Bacteria | 6919322 |
| 844 | 8054348239 | 8054347763 | Bacteria | 5901107 |
| 845 | 8054505797 | 8054503363 | Bacteria | 6101651 |
| 846 | 8055773411 | 8055770955 | Bacteria | 6827675 |
| 847 | 8055820410 | 8055817908 | Bacteria | 6609162 |
| 848 | 8056134363 | 8056131705 | Bacteria | 6107031 |
| 849 | 8056145529 | 8056143049 | Bacteria | 6307666 |
| 850 | 8056149806 | 8056148874 | Bacteria | 6479865 |
| 851 | 8056156905 | 8056155041 | Bacteria | 6486948 |
| 852 | 8056166490 | 8056161164 | Bacteria | 6106669 |
| 853 | 8057800885 | 8057798959 | Bacteria | 6713499 |
| 854 | Ga0439438_001497 | |||
| 855 | MRS2a_Contig_11 | |||
| 856 | SwRhRL2b_contig_2082775 | |||
| 857 | JGI24736J21556_1000922 | |||
| 858 | JGI24738J21930_10001672 | |||
| 859 | JGI25162J39368_1000014 | |||
| 860 | JGI25162J39368_1000015 | |||
| 861 | JGI25163J39215_1001215 | |||
| 862 | JGI25163J39215_1002286 | |||
| 863 | JGI25164J39214_1000037 | |||
| 864 | JGI25164J39214_1000059 | |||
| 865 | JGI25165J46597_1000001 | |||
| 866 | JGI25165J46597_1000027 | |||
| 867 | JGI25165J46597_1000118 | |||
| 868 | JGI25153J46596_10000149 | |||
| 869 | Ga0006562J51391_1046111 | |||
| 870 | Ga0006562J51391_1046112 | |||
| 871 | Ga0055538_1000001 | |||
| 872 | Ga0055538_1000057 | |||
| 873 | Ga0055538_1000158 | |||
| 874 | Ga0055539_1000001 | |||
| 875 | Ga0055539_1000088 | |||
| 876 | Ga0055539_1000208 | |||
| 877 | Ga0055533_1000003 | |||
| 878 | Ga0055533_1000096 | |||
| 879 | Ga0055533_1000209 | |||
| 880 | Ga0055532_1000214 | |||
| 881 | Ga0055525_1000087 | |||
| 882 | Ga0055525_1000129 | |||
| 883 | Ga0055525_1000287 | |||
| 884 | Ga0055527_1000781 | |||
| 885 | Ga0055535_1001921 | |||
| 886 | Ga0055535_1001925 | |||
| 887 | Ga0055542_1001738 | |||
| 888 | Ga0055542_1003477 | |||
| 889 | Ga0055529_1000493 | |||
| 890 | Ga0055536_1000046 | |||
| 891 | Ga0055530_10000133 | |||
| 892 | Ga0055530_10000136 | |||
| 893 | Ga0055530_10006501 | |||
| 894 | Ga0055540_1000070 | |||
| 895 | Ga0055540_1000168 | |||
| 896 | Ga0055540_1000303 | |||
| 897 | Ga0055531_10002895 | |||
| 898 | Ga0055531_10004152 | |||
| 899 | Ga0055541_1000001 | |||
| 900 | Ga0055541_1000059 | |||
| 901 | Ga0055541_1000067 | |||
| 902 | Ga0065165_1004047 | |||
| 903 | Ga0065714_10011647 | |||
| 904 | Ga0065714_10064673 | |||
| 905 | Ga0065714_10084986 | |||
| 906 | Ga0065704_10070740 | |||
| 907 | Ga0065712_10067765 | |||
| 908 | Ga0065712_10079941 | |||
| 909 | Ga0070658_10007195 | |||
| 910 | Ga0070670_100043450 | |||
| 911 | Ga0070660_100000080 | |||
| 912 | Ga0070661_100000399 | |||
| 913 | Ga0070661_100033882 | |||
| 914 | Ga0070668_100048034 | |||
| 915 | Ga0070659_100000068 | |||
| 916 | Ga0070708_100048922 | |||
| 917 | Ga0070678_100009561 | |||
| 918 | Ga0070662_100000595 | |||
| 919 | Ga0070662_100006829 | |||
| 920 | Ga0070662_100013868 | |||
| 921 | Ga0070685_10000935 | |||
| 922 | Ga0068853_100030852 | |||
| 923 | Ga0070665_100000786 | |||
| 924 | Ga0070665_100045492 | |||
| 925 | Ga0068855_100000112 | |||
| 926 | Ga0070664_100000824 | |||
| 927 | Ga0068854_100002880 | |||
| 928 | Ga0068851_10000857 | |||
| 929 | Ga0068851_10009790 | |||
| 930 | Ga0068858_100005634 | |||
| 931 | Ga0068862_100005745 | |||
| 932 | Ga0081538_10012237 | |||
| 933 | Ga0081540_1009283 | |||
| 934 | Ga0081539_10001562 | |||
| 935 | Ga0079104_1000823 | |||
| 936 | Ga0099826_10025336 | |||
| 937 | Ga0105251_10000215 | |||
| 938 | Ga0105251_10000924 | |||
| 939 | Ga0105251_10012316 | |||
| 940 | Ga0105251_10017057 | |||
| 941 | Ga0105244_10000564 | |||
| 942 | Ga0105244_10001338 | |||
| 943 | Ga0105244_10002323 | |||
| 944 | Ga0105244_10009100 | |||
| 945 | Ga0105244_10013244 | |||
| 946 | Ga0105244_10016000 | |||
| 947 | Ga0105244_10024178 | |||
| 948 | Ga0105244_10044264 | |||
| 949 | Ga0105250_10000370 | |||
| 950 | Ga0105250_10001079 | |||
| 951 | Ga0105250_10003522 | |||
| 952 | Ga0105240_10002080 | |||
| 953 | Ga0105240_10005298 | |||
| 954 | Ga0105240_10006245 | |||
| 955 | Ga0105240_10006631 | |||
| 956 | Ga0105240_10022023 | |||
| 957 | Ga0105240_10027693 | |||
| 958 | Ga0105247_10000745 | |||
| 959 | Ga0105243_10000045 | |||
| 960 | Ga0105242_10004232 | |||
| 961 | Ga0105248_10001036 | |||
| 962 | Ga0105237_10001264 | |||
| 963 | Ga0105237_10008385 | |||
| 964 | Ga0105238_10001781 | |||
| 965 | Ga0105238_10007435 | |||
| 966 | Ga0105238_10014906 | |||
| 967 | Ga0105238_10043229 | |||
| 968 | Ga0105249_10005339 | |||
| 969 | Ga0105239_10004940 | |||
| 970 | Ga0105239_10013785 | |||
| 971 | Ga0105246_10005991 | |||
| 972 | Ga0157373_10000819 | |||
| 973 | Ga0157373_10008189 | |||
| 974 | Ga0157373_10011579 | |||
| 975 | Ga0157371_10000359 | |||
| 976 | Ga0157371_10002766 | |||
| 977 | Ga0157370_10000127 | |||
| 978 | Ga0157370_10070231 | |||
| 979 | Ga0157370_10101181 | |||
| 980 | Ga0157369_10026879 | |||
| 981 | Ga0157369_10040412 | |||
| 982 | Ga0157372_10097213 | |||
| 983 | Ga0182008_10021402 | |||
| 984 | Ga0182008_10031554 | |||
| 985 | Ga0157376_10016268 | |||
| 986 | Ga0182006_1000034 | |||
| 987 | Ga0182006_1000342 | |||
| 988 | Ga0182006_1005976 | |||
| 989 | Ga0182006_1009981 | |||
| 990 | Ga0182006_1011544 | |||
| 991 | Ga0182007_10000177 | |||
| 992 | Ga0182007_10005023 | |||
| 993 | Ga0182005_1000045 | |||
| 994 | Ga0182005_1000613 | |||
| 995 | Ga0182005_1001311 | |||
| 996 | Ga0182005_1004405 | |||
| 997 | Ga0182005_1004528 | |||
| 998 | Ga0163161_10004619 | |||
| 999 | Ga0209760_100023 | |||
| 1000 | Ga0209760_100025 | |||
| 1001 | Ga0209760_100710 | |||
| 1002 | Ga0209784_100004 | |||
| 1003 | Ga0209784_100009 | |||
| 1004 | Ga0209784_100058 | |||
| 1005 | Ga0209566_100004 | |||
| 1006 | Ga0209566_100007 | |||
| 1007 | Ga0209566_100045 | |||
| 1008 | Ga0209566_101309 | |||
| 1009 | Ga0209674_100006 | |||
| 1010 | Ga0209674_100018 | |||
| 1011 | Ga0209674_100096 | |||
| 1012 | Ga0209674_100443 | |||
| 1013 | Ga0209674_103427 | |||
| 1014 | Ga0209672_100019 | |||
| 1015 | Ga0209672_100065 | |||
| 1016 | Ga0209147_100026 | |||
| 1017 | Ga0209147_100056 | |||
| 1018 | Ga0209147_100180 | |||
| 1019 | Ga0209563_100009 | |||
| 1020 | Ga0209563_100020 | |||
| 1021 | Ga0209563_100064 | |||
| 1022 | Ga0207427_100003 | |||
| 1023 | Ga0207427_100018 | |||
| 1024 | Ga0207427_102581 | |||
| 1025 | Ga0209437_100002 | |||
| 1026 | Ga0209437_100004 | |||
| 1027 | Ga0209437_100031 | |||
| 1028 | Ga0209437_105108 | |||
| 1029 | Ga0209258_100031 | |||
| 1030 | Ga0209258_100079 | |||
| 1031 | Ga0209258_100446 | |||
| 1032 | Ga0209646_1000147 | |||
| 1033 | Ga0209677_100005 | |||
| 1034 | Ga0209677_100010 | |||
| 1035 | Ga0209677_100053 | |||
| 1036 | Ga0209148_1000027 | |||
| 1037 | Ga0209148_1001323 | |||
| 1038 | Ga0209148_1001500 | |||
| 1039 | Ga0209129_1001032 | |||
| 1040 | Ga0209233_1000004 | |||
| 1041 | Ga0209233_1000005 | |||
| 1042 | Ga0209233_1000012 | |||
| 1043 | Ga0209455_1000058 | |||
| 1044 | Ga0209455_1001897 | |||
| 1045 | Ga0209673_1000420 | |||
| 1046 | Ga0209676_1000003 | |||
| 1047 | Ga0209676_1000055 | |||
| 1048 | Ga0209564_1011024 | |||
| 1049 | Ga0209758_1000060 | |||
| 1050 | Ga0209050_1000004 | |||
| 1051 | Ga0209050_1000043 | |||
| 1052 | Ga0209050_1000231 | |||
| 1053 | Ga0209050_1002798 | |||
| 1054 | Ga0209051_1000030 | |||
| 1055 | Ga0209051_1000052 | |||
| 1056 | Ga0209051_1000165 | |||
| 1057 | Ga0209257_1000297 | |||
| 1058 | Ga0209257_1000767 | |||
| 1059 | Ga0209257_1001804 | |||
| 1060 | Ga0209257_1012816 | |||
| 1061 | Ga0207656_10002350 | |||
| 1062 | Ga0207656_10005547 | |||
| 1063 | Ga0207696_1000011 | |||
| 1064 | Ga0207696_1000041 | |||
| 1065 | Ga0207696_1000628 | |||
| 1066 | Ga0207655_1000085 | |||
| 1067 | Ga0207655_1000137 | |||
| 1068 | Ga0207655_1000141 | |||
| 1069 | Ga0207655_1001565 | |||
| 1070 | Ga0207655_1009316 | |||
| 1071 | Ga0207655_1031660 | |||
| 1072 | Ga0207713_1000042 | |||
| 1073 | Ga0207713_1000162 | |||
| 1074 | Ga0207713_1001279 | |||
| 1075 | Ga0207713_1003516 | |||
| 1076 | Ga0207713_1012405 | |||
| 1077 | Ga0207713_1016476 | |||
| 1078 | Ga0207713_1035283 | |||
| 1079 | Ga0207647_10002292 | |||
| 1080 | Ga0207647_10009895 | |||
| 1081 | Ga0207695_10000033 | |||
| 1082 | Ga0207695_10000961 | |||
| 1083 | Ga0207695_10001626 | |||
| 1084 | Ga0207695_10018930 | |||
| 1085 | Ga0207695_10103482 | |||
| 1086 | Ga0207671_10000394 | |||
| 1087 | Ga0207671_10004277 | |||
| 1088 | Ga0207657_10000494 | |||
| 1089 | Ga0207649_10000251 | |||
| 1090 | Ga0207681_10003143 | |||
| 1091 | Ga0207694_10001986 | |||
| 1092 | Ga0207694_10015424 | |||
| 1093 | Ga0207650_10000384 | |||
| 1094 | Ga0207650_10023751 | |||
| 1095 | Ga0207650_10040682 | |||
| 1096 | Ga0207690_10000026 | |||
| 1097 | Ga0207706_10003456 | |||
| 1098 | Ga0207706_10011479 | |||
| 1099 | Ga0207706_10031620 | |||
| 1100 | Ga0207709_10000011 | |||
| 1101 | Ga0207711_10000819 | |||
| 1102 | Ga0207679_10000016 | |||
| 1103 | Ga0207667_10000032 | |||
| 1104 | Ga0207667_10025283 | |||
| 1105 | Ga0207712_10000288 | |||
| 1106 | Ga0207658_10010889 | |||
| 1107 | Ga0207703_10001081 | |||
| 1108 | Ga0207639_10000448 | |||
| 1109 | Ga0207639_10089134 | |||
| 1110 | Ga0207639_10109651 | |||
| 1111 | Ga0207678_10001257 | |||
| 1112 | Ga0207678_10014945 | |||
| 1113 | Ga0207648_10012176 | |||
| 1114 | Ga0207648_10077781 | |||
| 1115 | Ga0207683_10036062 | |||
| 1116 | Ga0209281_1000009 | |||
| 1117 | Ga0209371_1000858 | |||
| 1118 | Ga0268266_10000006 | |||
| 1119 | Ga0307517_10001421 | |||
| 1120 | Ga0307515_10006095 | |||
| 1121 | Ga0307515_10023797 | |||
| 1122 | Ga0307515_10025906 | |||
| 1123 | Ga0268256_1000477 | |||
| 1124 | Ga0307513_10005067 | |||
| 1125 | Ga0307408_100015782 | |||
| 1126 | Ga0307408_100046021 | |||
| 1127 | Ga0307508_10000096 | |||
| 1128 | Ga0307508_10063396 | |||
| 1129 | Ga0307508_10067003 | |||
| 1130 | Ga0307514_10001862 | |||
| 1131 | Ga0307516_10002913 | |||
| 1132 | Ga0307405_10000390 | |||
| 1133 | Ga0307405_10004963 | |||
| 1134 | Ga0307405_10014951 | |||
| 1135 | Ga0307405_10026124 | |||
| 1136 | Ga0307413_10000009 | |||
| 1137 | Ga0307413_10000598 | |||
| 1138 | Ga0307413_10011428 | |||
| 1139 | Ga0307413_10016640 | |||
| 1140 | Ga0307413_10025758 | |||
| 1141 | Ga0307410_10000430 | |||
| 1142 | Ga0307410_10034585 | |||
| 1143 | Ga0307406_10020193 | |||
| 1144 | Ga0307412_10000720 | |||
| 1145 | Ga0307409_100011807 | |||
| 1146 | Ga0307409_100090202 | |||
| 1147 | Ga0307414_10000718 | |||
| 1148 | Ga0307414_10037648 | |||
| 1149 | Ga0307411_10000058 | |||
| 1150 | Ga0307411_10007373 | |||
| 1151 | Ga0307411_10007688 | |||
| 1152 | Ga0307411_10025119 | |||
| 1153 | Ga0307411_10032964 | |||
| 1154 | Ga0307411_10040216 | |||
| 1155 | Ga0307415_100009328 | |||
| 1156 | Ga0307510_10000006 | |||
| 1157 | Ga0373937_0190751 | |||
| 1158 | Ga0395901_0030901 | |||
| 1159 | Ga0436361_0513552 | |||
| 1160 | Ga0439436_0000015 | |||
| 1161 | Ga0439438_001800 | |||
| 1162 | Ga0439447_002071 | |||
| 1163 | Ga0439466_0004012 | |||
| 1164 | Ga0439466_0010241 | |||
| 1165 | Ga0439465_0000091 | |||
| 1166 | Ga0451853_0587720 | |||
| 1167 | Ga0439432_001119 | |||
| 1168 | Ga0439432_022622 | |||
| 1169 | Ga0439451_003923 | |||
| 1170 | Ga0439452_006659 | |||
| 1171 | Ga0439456_008021 | |||
| 1172 | Ga0450907_000010 | |||
| 1173 | Ga0450908_000273 | |||
| 1174 | Ga0450909_000696 | |||
| 1175 | Ga0451577_0027187 | |||
| 1176 | Ga0466972_0000754 | |||
| 1177 | Ga0453683_0025830 | |||
| 1178 | Ga0453684_0009221 | |||
| 1179 | Ga0466968_0002276 | |||
| 1180 | Ga0451576_0001244 | |||
| 1181 | Ga0495617_000024 | |||
| 1182 | Ga0495617_000054 | |||
| 1183 | Ga0495617_000144 | |||
| 1184 | Ga0495617_000476 | |||
| 1185 | Ga0495627_000120 | |||
| 1186 | Ga0495627_000308 | |||
| 1187 | Ga0495627_012417 | |||
| 1188 | Ga0495592_0011881 | |||
| 1189 | Ga0495603_0001986 | |||
| 1190 | Ga0495590_0000364 | |||
| 1191 | Ga0495590_0001495 | |||
| 1192 | Ga0495590_0005545 | |||
| 1193 | Ga0495591_000064 | |||
| 1194 | Ga0495591_000315 | |||
| 1195 | Ga0495591_001261 | |||
| 1196 | Ga0495591_003301 | |||
| 1197 | Ga0495638_0000363 | |||
| 1198 | Ga0495638_0017737 | |||
| 1199 | Ga0495638_0020356 | |||
| 1200 | Ga0495638_0026643 | |||
| 1201 | Ga0495638_0038691 | |||
| 1202 | Ga0495651_0007096 | |||
| 1203 | Ga0495653_0001170 | |||
| 1204 | Ga0495653_0009203 | |||
| 1205 | Ga0495650_0000557 | |||
| 1206 | Ga0495650_0000881 | |||
| 1207 | Ga0495650_0001501 | |||
| 1208 | Ga0495650_0003204 | |||
| 1209 | Ga0495650_0008186 | |||
| 1210 | Ga0495605_0000057 | |||
| 1211 | Ga0495605_0000191 | |||
| 1212 | Ga0495605_0000794 | |||
| 1213 | Ga0495605_0003323 | |||
| 1214 | Ga0495605_0032845 | |||
| 1215 | Ga0495639_0000032 | |||
| 1216 | Ga0495584_0000409 | |||
| 1217 | Ga0495584_0000547 | |||
| 1218 | Ga0495584_0002662 | |||
| 1219 | Ga0495584_0014174 | |||
| 1220 | Ga0495585_0000082 | |||
| 1221 | Ga0495585_0013643 | |||
| 1222 | Ga0495594_0044447 | |||
| 1223 | Ga0495607_0000008 | |||
| 1224 | Ga0495607_0000058 | |||
| 1225 | Ga0495607_0000185 | |||
| 1226 | Ga0495607_0000266 | |||
| 1227 | Ga0495607_0000290 | |||
| 1228 | Ga0495607_0000617 | |||
| 1229 | Ga0495607_0003284 | |||
| 1230 | Ga0495607_0011010 | |||
| 1231 | Ga0495607_0016974 | |||
| 1232 | Ga0495607_0027186 | |||
| 1233 | Ga0495607_0071375 | |||
| 1234 | Ga0495583_0000483 | |||
| 1235 | Ga0495583_0001110 | |||
| 1236 | Ga0495583_0003663 | |||
| 1237 | Ga0495583_0004945 | |||
| 1238 | Ga0495583_0010911 | |||
| 1239 | Ga0495583_0014279 | |||
| 1240 | Ga0495606_0000136 | |||
| 1241 | Ga0495606_0000633 | |||
| 1242 | Ga0495606_0001206 | |||
| 1243 | Ga0495606_0001286 | |||
| 1244 | Ga0495606_0001714 | |||
| 1245 | Ga0495606_0003155 | |||
| 1246 | Ga0495608_0018050 | |||
| 1247 | Ga0495608_0040254 | |||
| 1248 | Ga0495610_0002898 | |||
| 1249 | Ga0495610_0004604 | |||
| 1250 | Ga0495610_0040400 | |||
| 1251 | Ga0495616_0000003 | |||
| 1252 | Ga0495616_0000226 | |||
| 1253 | Ga0495616_0000661 | |||
| 1254 | Ga0495616_0003952 | |||
| 1255 | Ga0495616_0004101 | |||
| 1256 | Ga0495616_0004782 | |||
| 1257 | Ga0495618_0002091 | |||
| 1258 | Ga0495618_0071780 | |||
| 1259 | Ga0495620_0000102 | |||
| 1260 | Ga0495620_0000166 | |||
| 1261 | Ga0495620_0000537 | |||
| 1262 | Ga0495620_0003457 | |||
| 1263 | Ga0495620_0011683 | |||
| 1264 | Ga0495620_0014405 | |||
| 1265 | Ga0495628_0001001 | |||
| 1266 | Ga0495628_0004631 | |||
| 1267 | Ga0495631_0000267 | |||
| 1268 | Ga0495631_0000489 | |||
| 1269 | Ga0495631_0001295 | |||
| 1270 | Ga0495631_0006742 | |||
| 1271 | Ga0495631_0015307 | |||
| 1272 | Ga0495632_0000008 | |||
| 1273 | Ga0495632_0000754 | |||
| 1274 | Ga0495632_0001740 | |||
| 1275 | Ga0495632_0002380 | |||
| 1276 | Ga0495632_0028117 | |||
| 1277 | Ga0495632_0028591 | |||
| 1278 | Ga0495632_0035967 | |||
| 1279 | Ga0495637_0000037 | |||
| 1280 | Ga0495637_0000977 | |||
| 1281 | Ga0495637_0001374 | |||
| 1282 | Ga0495637_0003424 | |||
| 1283 | Ga0495637_0017095 | |||
| 1284 | Ga0495643_0024936 | |||
| 1285 | Ga0495643_0030373 | |||
| 1286 | Ga0495643_0045146 | |||
| 1287 | Ga0495648_0000194 | |||
| 1288 | Ga0495648_0000377 | |||
| 1289 | Ga0495648_0001717 | |||
| 1290 | Ga0495648_0010178 | |||
| 1291 | Ga0495642_0000316 | |||
| 1292 | Ga0495652_0012335 | |||
| 1293 | Ga0495652_0026645 | |||
| 1294 | Ga0495654_0000211 | |||
| 1295 | Ga0495654_0000288 | |||
| 1296 | Ga0495654_0000306 | |||
| 1297 | Ga0495654_0001477 | |||
| 1298 | Ga0495654_0001887 | |||
| 1299 | Ga0495654_0002069 | |||
| 1300 | Ga0495654_0006785 | |||
| 1301 | Ga0495587_0014470 | |||
| 1302 | Ga0495609_0000011 | |||
| 1303 | Ga0495609_0000075 | |||
| 1304 | Ga0495609_0001756 | |||
| 1305 | Ga0495645_0008523 | |||
| 1306 | Ga0495645_0025652 | |||
| 1307 | Ga0495622_0000590 | |||
| 1308 | Ga0495622_0001201 | |||
| 1309 | Ga0495622_0001396 | |||
| 1310 | Ga0495668_0005182 | |||
| 1311 | Ga0495634_0000025 | |||
| 1312 | Ga0495611_0000004 | |||
| 1313 | Ga0495611_0000113 | |||
| 1314 | Ga0495611_0000349 | |||
| 1315 | Ga0495625_0000024 | |||
| 1316 | Ga0495625_0000089 | |||
| 1317 | Ga0495625_0000847 | |||
| 1318 | Ga0495625_0009172 | |||
| 1319 | Ga0495635_0000298 | |||
| 1320 | Ga0495659_0000123 | |||
| 1321 | Ga0495661_0000018 | |||
| 1322 | Ga0495661_0000028 | |||
| 1323 | Ga0495661_0000083 | |||
| 1324 | Ga0495661_0000101 | |||
| 1325 | Ga0495661_0001798 | |||
| 1326 | Ga0495661_0004052 | |||
| 1327 | Ga0495661_0031298 | |||
| 1328 | Ga0495588_0007463 | |||
| 1329 | Ga0495623_0006329 | |||
| 1330 | Ga0495623_0014890 | |||
| 1331 | Ga0495646_0001211 | |||
| 1332 | Ga0495646_0003303 | |||
| 1333 | Ga0495669_0003084 | |||
| 1334 | Ga0495670_0000168 | |||
| 1335 | Ga0495670_0000332 | |||
| 1336 | Ga0495670_0014042 | |||
| 1337 | Ga0495671_0000295 | |||
| 1338 | Ga0495671_0000960 | |||
| 1339 | Ga0495671_0001060 | |||
| 1340 | Ga0495671_0001565 | |||
| 1341 | Ga0495671_0004195 | |||
| 1342 | Ga0495671_0029739 | |||
| 1343 | Ga0495649_0000013 | |||
| 1344 | Ga0495649_0000909 | |||
| 1345 | Ga0495649_0027968 | |||
| 1346 | Ga0495589_0000038 | |||
| 1347 | Ga0495589_0000141 | |||
| 1348 | Ga0495589_0000846 | |||
| 1349 | Ga0495660_0000052 | |||
| 1350 | Ga0495660_0000064 | |||
| 1351 | Ga0495660_0003252 | |||
| 1352 | Ga0495581_0013045 | |||
| 1353 | Ga0495604_0002087 | |||
| 1354 | Ga0495604_0002922 | |||
| 1355 | Ga0495636_0002282 | |||
| 1356 | Ga0495674_0054405 | |||
| 1357 | Ga0495672_0000419 | |||
| 1358 | Ga0495672_0001510 | |||
| 1359 | Ga0495672_0003661 | |||
| 1360 | Ga0495672_0013150 | |||
| 1361 | Ga0495676_0000020 | |||
| 1362 | Ga0495680_0047968 | |||
| 1363 | Ga0495683_0000482 | |||
| 1364 | Ga0495683_0031829 | |||
| 1365 | Ga0495687_000715 | |||
| 1366 | Ga0495687_001973 | |||
| 1367 | Ga0495687_004068 | |||
| 1368 | Ga0495687_009189 | |||
| 1369 | Ga0495675_0019279 | |||
| 1370 | Ga0495679_000011 | |||
| 1371 | Ga0495679_000079 | |||
| 1372 | Ga0495679_000711 | |||
| 1373 | Ga0495679_004366 | |||
| 1374 | Ga0495673_0000036 | |||
| 1375 | Ga0495673_0000101 | |||
| 1376 | Ga0495673_0000190 | |||
| 1377 | Ga0495673_0000421 | |||
| 1378 | Ga0495673_0000833 | |||
| 1379 | Ga0495673_0002842 | |||
| 1380 | Ga0495673_0004301 | |||
| 1381 | Ga0495673_0012840 | |||
| 1382 | Ga0495673_0017156 | |||
| 1383 | Ga0495673_0018027 | |||
| 1384 | Ga0495673_0031214 | |||
| 1385 | Ga0495681_0000027 | |||
| 1386 | Ga0495681_0000237 | |||
| 1387 | Ga0495686_0001651 | |||
| 1388 | Ga0495593_0000310 | |||
| 1389 | Ga0495593_0008619 | |||
| 1390 | Ga0495626_0000041 | |||
| 1391 | Ga0495626_0000352 | |||
| 1392 | Ga0495626_0000583 | |||
| 1393 | Ga0496101_0015206 | |||
| 1394 | Ga0496102_0000038 | |||
| 1395 | Ga0496102_0001378 | |||
| 1396 | Ga0496102_0006765 | |||
| 1397 | Ga0496104_0018269 | |||
| 1398 | Ga0496106_0000402 | |||
| 1399 | Ga0496109_0077812 | |||
| 1400 | Ga0496110_0012406 | |||
| 1401 | Ga0496114_0080632 | |||
| 1402 | Ga0496116_0000221 | |||
| 1403 | Ga0496116_0000984 | |||
| 1404 | Ga0496116_0010423 | |||
| 1405 | Ga0496116_0031228 | |||
| 1406 | Ga0496116_0043318 | |||
| 1407 | Ga0496117_0000090 | |||
| 1408 | Ga0496117_0001257 | |||
| 1409 | Ga0496117_0007657 | |||
| 1410 | Ga0496117_0046008 | |||
| 1411 | Ga0496118_0000032 | |||
| 1412 | Ga0496118_0001081 | |||
| 1413 | Ga0496118_0008451 | |||
| 1414 | Ga0496118_0019747 | |||
| 1415 | Ga0496118_0028393 | |||
| 1416 | Ga0496119_0012436 | |||
| 1417 | Ga0496119_0018617 | |||
| 1418 | Ga0496119_0047360 | |||
| 1419 | Ga0496120_0005377 | |||
| 1420 | Ga0496121_0000071 | |||
| 1421 | Ga0496121_0000307 | |||
| 1422 | Ga0496121_0004753 | |||
| 1423 | Ga0496121_0005910 | |||
| 1424 | Ga0496121_0015170 | |||
| 1425 | Ga0496121_0018989 | |||
| 1426 | Ga0496121_0044422 | |||
| 1427 | Ga0496122_0000285 | |||
| 1428 | Ga0496122_0001763 | |||
| 1429 | Ga0496122_0010175 | |||
| 1430 | Ga0496123_0000232 | |||
| 1431 | Ga0496124_0001091 | |||
| 1432 | Ga0496124_0003813 | |||
| 1433 | Ga0496124_0003909 | |||
| 1434 | Ga0496124_0045951 | |||
| 1435 | Ga0496124_0058092 | |||
| 1436 | Ga0496125_0003672 | |||
| 1437 | Ga0496125_0007498 | |||
| 1438 | Ga0496125_0011347 | |||
| 1439 | Ga0496125_0056129 | |||
| 1440 | Ga0496126_0082985 | |||
| 1441 | Ga0495678_000062 | |||
| 1442 | Ga0495678_000724 | |||
| 1443 | Ga0495678_001110 | |||
| 1444 | Ga0495678_002200 | |||
| 1445 | Ga0495678_003441 | |||
| 1446 | Ga0495678_007111 | |||
| 1447 | Ga0495678_035745 | |||
| 1448 | Ga0495682_0000020 | |||
| 1449 | Ga0495682_0000065 | |||
| 1450 | Ga0495682_0001332 | |||
| 1451 | Ga0495682_0001951 | |||
| 1452 | Ga0501033_0001677 | |||
| 1453 | Ga0501037_0001520 | |||
| 1454 | Ga0501038_0013715 | |||
| 1455 | Ga0501038_0038734 | |||
| 1456 | Ga0501043_0006058 | |||
| 1457 | Ga0501043_0018299 | |||
| 1458 | Ga0501046_0000935 | |||
| 1459 | Ga0501047_0015518 | |||
| 1460 | Ga0501048_0020942 | |||
| 1461 | Ga0501067_0014551 | |||
| 1462 | Ga0501070_0139977 | |||
| 1463 | Ga0501073_0003385 | |||
| 1464 | Ga0501074_0030331 | |||
| 1465 | Ga0501077_0004582 | |||
| 1466 | Ga0501079_0009603 | |||
| 1467 | Ga0501080_0011968 | |||
| 1468 | Ga0501080_0042311 | |||
| 1469 | Ga0501081_0007747 | |||
| 1470 | Ga0501083_0001250 | |||
| 1471 | Ga0501083_0029113 | |||
| 1472 | Ga0501083_0068523 | |||
| 1473 | Ga0501083_0074209 | |||
| 1474 | Ga0501035_0024051 | |||
| 1475 | Ga0501035_0024682 | |||
| 1476 | Ga0501035_0105841 | |||
| 1477 | Ga0501044_0044309 | |||
| 1478 | nmdc:mga0qj67_12876_c1 | |||
| 1479 | nmdc:mga0n895_138900_c1 | |||
| 1480 | Ga0495601_0008699 | |||
| 1481 | Ga0500643_000012 | |||
| 1482 | Ga0500646_0009564 | |||
| 1483 | Ga0500651_0016231 | |||
| 1484 | Ga0500555_000233 | |||
| 1485 | Ga0500595_014824 | |||
| 1486 | Ga0500595_023197 | |||
| 1487 | Ga0500642_0006822 | |||
| 1488 | Ga0500658_0005620 | |||
| 1489 | Ga0500574_001090 | |||
| 1490 | Ga0500616_0000708 | |||
| 1491 | Ga0500619_000066 | |||
| 1492 | Ga0500633_0001497 | |||
| 1493 | Ga0500645_000884 | |||
| 1494 | Ga0500609_000357 | |||
| 1495 | Ga0501084_0070918 | |||
| 1496 | Ga0501082_0008394 | |||
| 1497 | 2510284531 | |||
| 1498 | 2510295981 | |||
| 1499 | 2510311909 | |||
| 1500 | 2511272552 | |||
| 1501 | 2511290767 | |||
| 1502 | 2511313841 | |||
| 1503 | 2511323324 | |||
| 1504 | 2511327785 | |||
| 1505 | 2511343841 | |||
| 1506 | 2511359761 | |||
| 1507 | 2511362420 | |||
| 1508 | 2511824363 | |||
| 1509 | 2512328373 | |||
| 1510 | 2519458507 | |||
| 1511 | 2555669594 | |||
| 1512 | 2583792845 | |||
| 1513 | 2585292913 | |||
| 1514 | 2587756688 | |||
| 1515 | 2595447386 | |||
| 1516 | 2595450158 | |||
| 1517 | 2597857598 | |||
| 1518 | 2597864251 | |||
| 1519 | 2597869496 | |||
| 1520 | 2599330601 | |||
| 1521 | 2599353409 | |||
| 1522 | 2599363802 | |||
| 1523 | 2599370122 | |||
| 1524 | 2599372429 | |||
| 1525 | 2599378517 | |||
| 1526 | 2599384106 | |||
| 1527 | 2599391288 | |||
| 1528 | 2599399238 | |||
| 1529 | 2599407533 | |||
| 1530 | 2599453661 | |||
| 1531 | 2599460243 | |||
| 1532 | 2599470635 | |||
| 1533 | 2599484467 | |||
| 1534 | 2599489264 | |||
| 1535 | 2599502196 | |||
| 1536 | 2599509107 | |||
| 1537 | 2599513730 | |||
| 1538 | 2599518910 | |||
| 1539 | 2599616061 | |||
| 1540 | 2599737440 | |||
| 1541 | 2599748709 | |||
| 1542 | 2599772664 | |||
| 1543 | 2599802261 | |||
| 1544 | 2599881037 | |||
| 1545 | 2599885074 | |||
| 1546 | 2599892787 | |||
| 1547 | 2599899799 | |||
| 1548 | 2599932744 | |||
| 1549 | 2599945259 | |||
| 1550 | 2599949681 | |||
| 1551 | 2599955389 | |||
| 1552 | 2599960890 | |||
| 1553 | 2599965495 | |||
| 1554 | 2599976610 | |||
| 1555 | 2599984434 | |||
| 1556 | 2599990395 | |||
| 1557 | 2599992836 | |||
| 1558 | 2600001663 | |||
| 1559 | 2600008918 | |||
| 1560 | 2600010645 | |||
| 1561 | 2600018384 | |||
| 1562 | 2600023314 | |||
| 1563 | 2600028227 | |||
| 1564 | 2600034165 | |||
| 1565 | 2600040323 | |||
| 1566 | 2600049243 | |||
| 1567 | 2600052904 | |||
| 1568 | 2600056986 | |||
| 1569 | 2600066812 | |||
| 1570 | 2600074064 | |||
| 1571 | 2600077529 | |||
| 1572 | 2600210620 | |||
| 1573 | 2600212852 | |||
| 1574 | 2600357324 | |||
| 1575 | 2600366916 | |||
| 1576 | 2601625303 | |||
| 1577 | 2601690397 | |||
| 1578 | 2601773020 | |||
| 1579 | 2621300200 | |||
| 1580 | 2624491482 | |||
| 1581 | 2643871073 | |||
| 1582 | 2644190355 | |||
| 1583 | 2644284926 | |||
| 1584 | 2644622514 | |||
| 1585 | 2652548246 | |||
| 1586 | 2671094662 | |||
| 1587 | 2671095024 | |||
| 1588 | 2671124815 | |||
| 1589 | 2671770120 | |||
| 1590 | 2676746870 | |||
| 1591 | 2677901169 | |||
| 1592 | 2678263891 | |||
| 1593 | 2721028871 | |||
| 1594 | 2723249078 | |||
| 1595 | 2738675104 | |||
| 1596 | 2738690750 | |||
| 1597 | 2738753394 | |||
| 1598 | 2738810544 | |||
| 1599 | 2738862306 | |||
| 1600 | 2738897904 | |||
| 1601 | 2739257992 | |||
| 1602 | 2739266524 | |||
| 1603 | 2743737033 | |||
| 1604 | 2745004344 | |||
| 1605 | 2774123117 | |||
| 1606 | 2774130788 | |||
| 1607 | 2784315477 | |||
| 1608 | 2794594719 | |||
| 1609 | 2808854888 | |||
| 1610 | 2808926330 | |||
| 1611 | 2808932744 | |||
| 1612 | 2808934917 | |||
| 1613 | 2808948431 | |||
| 1614 | 2808954866 | |||
| 1615 | 2808963314 | |||
| 1616 | 2808978547 | |||
| 1617 | 2808993926 | |||
| 1618 | 2808998281 | |||
| 1619 | 2817260731 | |||
| 1620 | 2817278369 | |||
| 1621 | 2817456345 | |||
| 1622 | 2817491545 | |||
| 1623 | 2819544991 | |||
| 1624 | 2819637154 | |||
| 1625 | 2819705621 | |||
| 1626 | 2825657323 | |||
| 1627 | 2826585164 | |||
| 1628 | 2834030248 | |||
| 1629 | 2842818698 | |||
| 1630 | 2842831861 | |||
| 1631 | 2842840208 | |||
| 1632 | 2842853637 | |||
| 1633 | 2842858376 | |||
| 1634 | 2842920467 | |||
| 1635 | 2844670096 | |||
| 1636 | 2852617423 | |||
| 1637 | 2852672458 | |||
| 1638 | 2860342516 | |||
| 1639 | 2860870370 | |||
| 1640 | 2863427689 | |||
| 1641 | 2870071797 | |||
| 1642 | 2904571166 | |||
| 1643 | 2904578259 | |||
| 1644 | 2908450193 | |||
| 1645 | 2913039284 | |||
| 1646 | 2917073407 | |||
| 1647 | 2917833662 | |||
| 1648 | 2919087110 | |||
| 1649 | 2919128061 | |||
| 1650 | 2919406707 | |||
| 1651 | 2919456646 | |||
| 1652 | 2919485284 | |||
| 1653 | 2919537665 | |||
| 1654 | 2919700959 | |||
| 1655 | 2923156065 | |||
| 1656 | 2923586589 | |||
| 1657 | 2928131601 | |||
| 1658 | 2928163785 | |||
| 1659 | 2928164783 | |||
| 1660 | 2928172973 | |||
| 1661 | 2928540947 | |||
| 1662 | 2929147889 | |||
| 1663 | 2929192841 | |||
| 1664 | 2931369753 | |||
| 1665 | 2931394365 | |||
| 1666 | 2931402600 | |||
| 1667 | 2935357595 | |||
| 1668 | 2945933881 | |||
| 1669 | 2945964229 | |||
| 1670 | 2946010312 | |||
| 1671 | 2946030619 | |||
| 1672 | 2947237415 | |||
| 1673 | 2953995748 | |||
| 1674 | 2974298358 | |||
| 1675 | 2981996350 | |||
| 1676 | 2984289959 | |||
| 1677 | 2984504264 | |||
| 1678 | 2984505959 | |||
| 1679 | 2988729470 | |||
| 1680 | 3007401595 | |||
| 1681 | 3007869751 | |||
| 1682 | 637319925 | |||
| 1683 | 642417896 | |||
| 1684 | 8015690282 | |||
| 1685 | 8018845715 | |||
| 1686 | 8019772539 | |||
| 1687 | 8019778375 | |||
| 1688 | 8020813696 | |||
| 1689 | 8020942295 | |||
| 1690 | 8020947519 | |||
| 1691 | 8020958152 | |||
| 1692 | 8021124133 | |||
| 1693 | 8039104026 | |||
| 1694 | 8040171624 | |||
| 1695 | 8040177825 | |||
| 1696 | 8054286281 | |||
| 1697 | 8054348239 | |||
| 1698 | 8054505797 | |||
| 1699 | 8055773411 | |||
| 1700 | 8055820410 | |||
| 1701 | 8056134363 | |||
| 1702 | 8056145529 | |||
| 1703 | 8056149806 | |||
| 1704 | 8056156905 | |||
| 1705 | 8056166490 | |||
| 1706 | 8057800885 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v19-assembly1.cif.gz_A | 2-keto-3-deoxygluconate kinase from thermus thermophilus | 0.9208 | 11 | 334 |
| 3iq0-assembly1.cif.gz_B | crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.coli | 0.9201 | 12 | 334 |
| 3k9e-assembly1.cif.gz_B | crystal structure of a putative ribokinase ii (apo form) from e.coli | 0.9196 | 12 | 334 |
| 2qcv-assembly1.cif.gz_A | crystal structure of a putative 5-dehydro-2-deoxygluconokinase (iolc) from bacillus halodurans c-125 at 1.90 a resolution | 0.9181 | 4 | 332 |
| 3pl2-assembly2.cif.gz_D | crystal structure of a 5-keto-2-deoxygluconokinase (ncgl0155, cgl0158) from corynebacterium glutamicum atcc 13032 kitasato at 1.89 a resolution | 0.9177 | 12 | 334 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v1aA00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9344 | 11 | 333 | 3.40.1190.20 |
| 1v1aA00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9225 | 11 | 333 | 3.40.1190.20 |
| 3iq0B00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9146 | 12 | 334 | 3.40.1190.20 |
| 3pl2D01 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9028 | 11 | 334 | 3.40.1190.20 |
| 4du5C00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.8998 | 12 | 332 | 3.40.1190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656K0A8-F1-model_v4 | IolC protein | 0.9929 | 84 | 240 |
GO:0006796
GO:0016301 |
| AF-A0A6N6XG16-F1-model_v4 | deleted | 0.9922 | 10 | 257 |
|
| AF-A0A5C6RNF6-F1-model_v4 | 5-dehydro-2-deoxygluconokinase | 0.9915 | 9 | 107 |
GO:0016301
|
| AF-F3C2G5-F1-model_v4 | IolC protein | 0.9867 | 1 | 362 |
GO:0006796
GO:0016301 |
| AF-A0A2X2TAV0-F1-model_v4 | 5-dehydro-2-deoxygluconokinase (EC 2.7.1.92) | 0.9847 | 63 | 312 |
GO:0006796
GO:0047590 |