F483554

General Info

Members Datasets Scaffolds Average Seq Length
853 465 1706 223

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0001311|Ga0466957_0001311_3737_4537
Length 266
Sequence MLWFFSISVISGKNCFLGKATKRPEQRELRNRSAQRRSRYDCDAMDPDLWTSFDNYVENLLIPRDPVLEAALKTSDAAGLPPIQVSPALGKLLHLLARAQGARKILEIGTLAGYSTIWMARALPPEGKLITLEVDPTHAEVARANFVRAGLASVVELRLGPALETLPALLSEGKGPFDMVFIDADKTSYADYLGWALRLTRRGSLIIADNVVRDGEVANLSSTDVLVQGVRRFNELLAADPRVSATVVQTVGSKGYDGFALAVVVA

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
139 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
211 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
217 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
218 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
228 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
231 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
232 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
238 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
241 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
242 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
243 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
249 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
256 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
266 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
267 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
268 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
269 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
270 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
271 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
272 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
273 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
278 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
279 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
280 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
289 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
303 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
304 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
308 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
313 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
314 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
338 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
343 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
344 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
359 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
360 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
376 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
377 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
378 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
379 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
380 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
389 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
396 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
397 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
398 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
399 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
400 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
401 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
402 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
403 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
404 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
405 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
406 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
407 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
408 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
409 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
410 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
411 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
412 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
413 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
414 2643221630 Microbacterium sp. Root322 Isolate Unclassified
415 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
416 2643221731 Bacillus sp. Root147 Isolate Unclassified
417 2643221732 Bacillus sp. Root239 Isolate Unclassified
418 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
419 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
420 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
421 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
422 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
423 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
424 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
425 2842882022 Bacillus sp. R-71893 Isolate Unclassified
426 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
427 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
428 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
429 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
430 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
431 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
432 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
433 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
434 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
435 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
436 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
437 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
438 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
439 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
440 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
441 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
442 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
443 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
444 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
445 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
446 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
447 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
448 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
449 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
450 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
451 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
452 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
453 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
454 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
455 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
456 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
457 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
458 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
459 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
460 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
461 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
462 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
463 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
464 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
465 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0.47
Isolates 6.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.63
Nodule 2.58
Rhizoplane 4.81
Rhizosphere 78.08
Stem 0
Stem Tuber 0
Unclassified 1.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0001311 3300044842 Bacteria 12996
2 JGI25157J39369_1001102 3300002741 Bacteria 12052
3 JGI25152J39213_1000320 3300002773 Bacteria 30822
4 JGI25151J46595_10014828 3300003187 Bacteria 3459
5 JGI25151J46595_10015707 3300003187 Bacteria 3326
6 JGI25151J46595_10016114 3300003187 Bacteria 3275
7 JGI25406J46586_10002637 3300003203 Bacteria 8454
8 JGI25165J46597_1007854 3300003214 Bacteria 1731
9 JGI25153J46596_10000925 3300003215 Bacteria 17828
10 JGI25153J46596_10002237 3300003215 Bacteria 11292
11 rootH1_10015900 3300003316 Bacteria 9226
12 rootH2_10188135 3300003320 Bacteria 1099
13 rootL2_10052984 3300003322 Bacteria 12875
14 rootH1_10037048 3300003323 Bacteria 4557
15 rootH1_10347230 3300003323 Bacteria 1084
16 Ga0006562J51391_1000651 3300003578 Bacteria 2573
17 Ga0055542_1017402 3300003762 Bacteria 1113
18 Ga0055526_1003784 3300003771 Bacteria 9426
19 Ga0055530_10001188 3300003791 Bacteria 20133
20 Ga0055531_10001182 3300003794 Bacteria 20057
21 Ga0065712_10031557 3300005290 Bacteria 1498
22 Ga0065712_10193796 3300005290 Bacteria 1137
23 Ga0065715_10139949 3300005293 Bacteria 1869
24 Ga0065715_10147823 3300005293 Bacteria 1766
25 Ga0065715_10158249 3300005293 Unclassified 1655
26 Ga0065715_10257247 3300005293 Bacteria 1148
27 Ga0065715_10310250 3300005293 Bacteria 1022
28 Ga0065707_10181530 3300005295 Bacteria 1415
29 Ga0070658_10001049 3300005327 Bacteria 23614
30 Ga0070658_10003841 3300005327 Bacteria 12314
31 Ga0070658_10054338 3300005327 Bacteria 3252
32 Ga0070658_10151036 3300005327 Bacteria 1945
33 Ga0070658_10533623 3300005327 Bacteria 1015
34 Ga0070676_10017108 3300005328 Bacteria 4010
35 Ga0070676_10627309 3300005328 Bacteria 778
36 Ga0070683_100101618 3300005329 Bacteria 2708
37 Ga0070683_100203624 3300005329 Bacteria 1880
38 Ga0070690_100009793 3300005330 Bacteria 5560
39 Ga0070670_100360491 3300005331 Bacteria 1278
40 Ga0070677_10070597 3300005333 Bacteria 1468
41 Ga0068869_100176556 3300005334 Unclassified 1672
42 Ga0070666_10239837 3300005335 Bacteria 1282
43 Ga0070680_100016753 3300005336 Bacteria 5768
44 Ga0070680_100114893 3300005336 Bacteria 2242
45 Ga0070682_100189909 3300005337 Bacteria 1441
46 Ga0068868_100593765 3300005338 Bacteria 980
47 Ga0070660_100100936 3300005339 Bacteria 2286
48 Ga0070689_100003639 3300005340 Bacteria 10285
49 Ga0070689_100020778 3300005340 Bacteria 4877
50 Ga0070691_10088093 3300005341 Bacteria 1527
51 Ga0070687_100002770 3300005343 Bacteria 6658
52 Ga0070661_100021252 3300005344 Bacteria 4632
53 Ga0070661_100054745 3300005344 Bacteria 2922
54 Ga0070661_100201283 3300005344 Bacteria 1522
55 Ga0070669_100018812 3300005353 Bacteria 4938
56 Ga0070669_100325049 3300005353 Bacteria 1243
57 Ga0070675_100045022 3300005354 Bacteria 3610
58 Ga0070675_100112579 3300005354 Bacteria 2304
59 Ga0070675_100387120 3300005354 Bacteria 1245
60 Ga0070674_100043999 3300005356 Bacteria 3041
61 Ga0070674_100083427 3300005356 Bacteria 2289
62 Ga0070674_100194316 3300005356 Bacteria 1563
63 Ga0070674_100448654 3300005356 Unclassified 1064
64 Ga0070688_100569605 3300005365 Bacteria 863
65 Ga0070659_100010573 3300005366 Bacteria 6795
66 Ga0070659_100012944 3300005366 Bacteria 6202
67 Ga0070667_100005914 3300005367 Bacteria 10188
68 Ga0070667_100182486 3300005367 Bacteria 1856
69 Ga0070667_100280732 3300005367 Bacteria 1495
70 Ga0070714_100003326 3300005435 Bacteria 11985
71 Ga0070714_100130034 3300005435 Bacteria 2249
72 Ga0070714_100411417 3300005435 Bacteria 1280
73 Ga0070713_100009544 3300005436 Bacteria 6957
74 Ga0070713_100055000 3300005436 Bacteria 3305
75 Ga0070713_100143876 3300005436 Bacteria 2114
76 Ga0070711_100054894 3300005439 Bacteria 2750
77 Ga0070711_100477908 3300005439 Bacteria 1024
78 Ga0070705_100052273 3300005440 Bacteria 2386
79 Ga0070705_100392777 3300005440 Bacteria 1025
80 Ga0070700_100289442 3300005441 Bacteria 1191
81 Ga0070700_100376385 3300005441 Bacteria 1061
82 Ga0070700_100475340 3300005441 Bacteria 956
83 Ga0070694_100109851 3300005444 Bacteria 1963
84 Ga0070694_100458176 3300005444 Bacteria 1008
85 Ga0070708_100033385 3300005445 Bacteria 4471
86 Ga0070678_100105929 3300005456 Bacteria 2190
87 Ga0070662_100176003 3300005457 Bacteria 1684
88 Ga0070662_100410368 3300005457 Bacteria 1119
89 Ga0070681_10007725 3300005458 Bacteria 10511
90 Ga0070681_10025125 3300005458 Bacteria 5994
91 Ga0070681_10069875 3300005458 Bacteria 3477
92 Ga0070681_10091378 3300005458 Bacteria 2994
93 Ga0070681_10186266 3300005458 Bacteria 1996
94 Ga0070681_10516887 3300005458 Bacteria 1107
95 Ga0068867_100181760 3300005459 Bacteria 1673
96 Ga0070685_10013378 3300005466 Bacteria 4326
97 Ga0070685_10023156 3300005466 Bacteria 3398
98 Ga0070685_10245734 3300005466 Bacteria 1183
99 Ga0070706_100063105 3300005467 Bacteria 3424
100 Ga0070707_100059448 3300005468 Bacteria 3667
101 Ga0070698_100011293 3300005471 Bacteria 9484
102 Ga0070698_100149882 3300005471 Bacteria 2280
103 Ga0070698_100390698 3300005471 Bacteria 1324
104 Ga0070698_100398423 3300005471 Bacteria 1310
105 Ga0070698_100560551 3300005471 Unclassified 1082
106 Ga0070699_100000731 3300005518 Bacteria 30425
107 Ga0070679_100005625 3300005530 Bacteria 11608
108 Ga0070679_100140655 3300005530 Bacteria 2393
109 Ga0070679_100193023 3300005530 Bacteria 2005
110 Ga0070679_100434433 3300005530 Bacteria 1258
111 Ga0070684_100036383 3300005535 Bacteria 4218
112 Ga0070697_100146480 3300005536 Bacteria 1988
113 Ga0068853_100016125 3300005539 Bacteria 6145
114 Ga0068853_100203683 3300005539 Bacteria 1801
115 Ga0068853_100311971 3300005539 Bacteria 1456
116 Ga0068853_100692566 3300005539 Bacteria 972
117 Ga0070672_100205896 3300005543 Bacteria 1646
118 Ga0070672_100297988 3300005543 Bacteria 1366
119 Ga0070672_100414893 3300005543 Bacteria 1155
120 Ga0070672_100494409 3300005543 Bacteria 1058
121 Ga0070686_100050203 3300005544 Bacteria 2650
122 Ga0070695_100006854 3300005545 Bacteria 6748
123 Ga0070696_100000405 3300005546 Bacteria 26769
124 Ga0070693_100037023 3300005547 Bacteria 2717
125 Ga0070693_100067095 3300005547 Bacteria 2102
126 Ga0070665_100211683 3300005548 Unclassified 1939
127 Ga0070665_100231717 3300005548 Bacteria 1847
128 Ga0070665_100382706 3300005548 Bacteria 1414
129 Ga0070665_100494704 3300005548 Bacteria 1234
130 Ga0070704_100014899 3300005549 Bacteria 4867
131 Ga0070704_100668764 3300005549 Bacteria 918
132 Ga0068855_100002514 3300005563 Bacteria 22590
133 Ga0068855_100003233 3300005563 Bacteria 19942
134 Ga0068855_100329717 3300005563 Bacteria 1685
135 Ga0068855_100790308 3300005563 Bacteria 1009
136 Ga0068855_101185706 3300005563 Bacteria 795
137 Ga0070664_100006351 3300005564 Bacteria 9537
138 Ga0070664_100043408 3300005564 Bacteria 3793
139 Ga0070664_100370474 3300005564 Bacteria 1306
140 Ga0068857_100095044 3300005577 Bacteria 2669
141 Ga0068856_100213539 3300005614 Bacteria 1945
142 Ga0068856_100266324 3300005614 Bacteria 1729
143 Ga0068856_100391936 3300005614 Bacteria 1408
144 Ga0070702_100113227 3300005615 Bacteria 1686
145 Ga0068852_100017925 3300005616 Bacteria 5568
146 Ga0068852_100163389 3300005616 Bacteria 2081
147 Ga0068852_100199611 3300005616 Bacteria 1892
148 Ga0068852_100579630 3300005616 Bacteria 1125
149 Ga0068859_100050894 3300005617 Bacteria 4162
150 Ga0068859_100152107 3300005617 Bacteria 2389
151 Ga0068859_100733378 3300005617 Bacteria 1078
152 Ga0068864_100000058 3300005618 Bacteria 125688
153 Ga0068864_100420015 3300005618 Bacteria 1274
154 Ga0068866_10296005 3300005718 Bacteria 1009
155 Ga0068851_10146013 3300005834 Bacteria 1290
156 Ga0068851_10300891 3300005834 Bacteria 922
157 Ga0068870_10017016 3300005840 Bacteria 3489
158 Ga0068863_100000290 3300005841 Bacteria 52019
159 Ga0068863_100447949 3300005841 Bacteria 1267
160 Ga0068858_100000006 3300005842 Bacteria 256011
161 Ga0068858_100050490 3300005842 Bacteria 3850
162 Ga0068858_100069462 3300005842 Bacteria 3265
163 Ga0068858_100849399 3300005842 Bacteria 891
164 Ga0068860_100105447 3300005843 Bacteria 2692
165 Ga0068862_100596329 3300005844 Bacteria 1060
166 Ga0081539_10000136 3300005985 Bacteria 172211
167 Ga0081539_10081646 3300005985 Bacteria 1697
168 Ga0070717_10282082 3300006028 Bacteria 1474
169 Ga0075364_10073308 3300006051 Bacteria 2257
170 Ga0070716_100018048 3300006173 Unclassified 3670
171 Ga0070712_100071091 3300006175 Bacteria 2489
172 Ga0070712_100087240 3300006175 Bacteria 2276
173 Ga0075367_10133037 3300006178 Bacteria 1538
174 Ga0075369_10025404 3300006186 Bacteria 2463
175 Ga0075369_10078055 3300006186 Bacteria 1465
176 Ga0097621_100334233 3300006237 Bacteria 1344
177 Ga0097621_100530386 3300006237 Bacteria 1070
178 Ga0068871_100164571 3300006358 Bacteria 1898
179 Ga0068871_100179035 3300006358 Bacteria 1821
180 Ga0068871_100387679 3300006358 Bacteria 1242
181 Ga0068871_100592583 3300006358 Bacteria 1007
182 Ga0075430_100498493 3300006846 Bacteria 1005
183 Ga0075431_100002067 3300006847 Bacteria 19172
184 Ga0075433_10022523 3300006852 Bacteria 5288
185 Ga0075433_10040582 3300006852 Bacteria 4029
186 Ga0075433_10058214 3300006852 Bacteria 3379
187 Ga0075434_100006720 3300006871 Bacteria 10568
188 Ga0075434_100014125 3300006871 Bacteria 7626
189 Ga0075434_100025938 3300006871 Bacteria 5737
190 Ga0075434_100050591 3300006871 Bacteria 4128
191 Ga0075429_100041371 3300006880 Bacteria 4013
192 Ga0075429_100118232 3300006880 Bacteria 2317
193 Ga0097620_100005022 3300006931 Bacteria 13426
194 Ga0097620_100050893 3300006931 Bacteria 4162
195 Ga0097620_100152112 3300006931 Bacteria 2389
196 Ga0097620_100733388 3300006931 Bacteria 1078
197 Ga0099795_10013624 3300007788 Bacteria 2500
198 Ga0105251_10062533 3300009011 Bacteria 1748
199 Ga0105240_10005331 3300009093 Bacteria 19184
200 Ga0105240_10007898 3300009093 Bacteria 15344
201 Ga0105240_10558592 3300009093 Bacteria 1265
202 Ga0111539_10089221 3300009094 Bacteria 3623
203 Ga0111539_10643826 3300009094 Bacteria 1234
204 Ga0111539_10746609 3300009094 Bacteria 1139
205 Ga0114129_10025246 3300009147 Bacteria 8419
206 Ga0114129_10060030 3300009147 Bacteria 5317
207 Ga0114129_10445198 3300009147 Bacteria 1700
208 Ga0105243_10085413 3300009148 Bacteria 2587
209 Ga0105243_10636504 3300009148 Bacteria 1032
210 Ga0105241_10784268 3300009174 Bacteria 876
211 Ga0105242_10043201 3300009176 Bacteria 3645
212 Ga0105248_10000003 3300009177 Bacteria 1019601
213 Ga0105248_10003436 3300009177 Bacteria 17589
214 Ga0105248_10049070 3300009177 Bacteria 4735
215 Ga0105248_10073158 3300009177 Bacteria 3852
216 Ga0105237_10097199 3300009545 Bacteria 2935
217 Ga0105237_10446861 3300009545 Bacteria 1299
218 Ga0105238_10005467 3300009551 Bacteria 12560
219 Ga0099796_10136087 3300010159 Bacteria 956
220 Ga0105239_10166315 3300010375 Bacteria 2466
221 Ga0105239_10195389 3300010375 Bacteria 2266
222 Ga0105239_10266418 3300010375 Bacteria 1926
223 Ga0105239_10786239 3300010375 Bacteria 1090
224 Ga0105246_10153497 3300011119 Bacteria 1746
225 Ga0105246_10338055 3300011119 Bacteria 1229
226 Ga0105246_10735106 3300011119 Bacteria 869
227 Ga0157373_10030883 3300013100 Bacteria 3855
228 Ga0157373_10122688 3300013100 Bacteria 1826
229 Ga0157373_10281083 3300013100 Bacteria 1179
230 Ga0157370_10012181 3300013104 Bacteria 8941
231 Ga0157370_10430454 3300013104 Bacteria 1213
232 Ga0157370_10494024 3300013104 Bacteria 1124
233 Ga0157369_10000535 3300013105 Bacteria 50270
234 Ga0157369_10008469 3300013105 Bacteria 11795
235 Ga0157369_10014465 3300013105 Bacteria 8908
236 Ga0157369_10245571 3300013105 Bacteria 1869
237 Ga0157369_10247271 3300013105 Bacteria 1862
238 Ga0157369_10251979 3300013105 Bacteria 1842
239 Ga0157369_10264814 3300013105 Bacteria 1792
240 Ga0157374_10016425 3300013296 Bacteria 6506
241 Ga0157374_10104160 3300013296 Bacteria 2724
242 Ga0157374_10197480 3300013296 Bacteria 1969
243 Ga0157374_10516883 3300013296 Unclassified 1200
244 Ga0157374_10595633 3300013296 Bacteria 1115
245 Ga0157378_10512157 3300013297 Bacteria 1200
246 Ga0163162_10682961 3300013306 Bacteria 1149
247 Ga0163162_11133481 3300013306 Bacteria 887
248 Ga0157372_10108444 3300013307 Bacteria 3178
249 Ga0157372_10257281 3300013307 Bacteria 2027
250 Ga0157372_10298291 3300013307 Bacteria 1875
251 Ga0157372_10480621 3300013307 Bacteria 1448
252 Ga0157372_10533564 3300013307 Bacteria 1368
253 Ga0157372_11047666 3300013307 Bacteria 944
254 Ga0157372_11306704 3300013307 Bacteria 837
255 Ga0157375_10091997 3300013308 Bacteria 3096
256 Ga0163163_10042427 3300014325 Bacteria 4456
257 Ga0163163_10083964 3300014325 Bacteria 3190
258 Ga0163163_10386366 3300014325 Bacteria 1457
259 Ga0157380_10120885 3300014326 Bacteria 2218
260 Ga0157380_10142058 3300014326 Bacteria 2064
261 Ga0157377_10021053 3300014745 Bacteria 3425
262 Ga0157377_10412605 3300014745 Bacteria 923
263 Ga0157379_10010729 3300014968 Bacteria 7984
264 Ga0157379_10071315 3300014968 Bacteria 3108
265 Ga0157379_10143771 3300014968 Unclassified 2151
266 Ga0157379_11079329 3300014968 Bacteria 768
267 Ga0157376_10106755 3300014969 Bacteria 2457
268 Ga0157376_10278458 3300014969 Bacteria 1574
269 Ga0206356_10185367 3300020070 Bacteria 1890
270 Ga0206354_10589800 3300020081 Bacteria 3581
271 Ga0206353_11894658 3300020082 Bacteria 5542
272 Ga0213872_10000867 3300021361 Bacteria 21873
273 Ga0213876_10022240 3300021384 Bacteria 3354
274 Ga0213876_10087029 3300021384 Bacteria 1654
275 Ga0213876_10111311 3300021384 Bacteria 1453
276 Ga0213875_10008447 3300021388 Bacteria 5277
277 Ga0209566_100461 3300025225 Bacteria 29354
278 Ga0209147_100408 3300025229 Bacteria 29102
279 Ga0209147_104032 3300025229 Bacteria 2579
280 Ga0207425_1000334 3300025245 Bacteria 33005
281 Ga0209646_1011072 3300025246 Bacteria 1401
282 Ga0209026_1000002 3300025250 Bacteria 1136158
283 Ga0209148_1000472 3300025254 Bacteria 42870
284 Ga0209759_1000822 3300025256 Bacteria 24594
285 Ga0209129_1000027 3300025258 Bacteria 409587
286 Ga0209233_1000293 3300025261 Bacteria 63470
287 Ga0209233_1008421 3300025261 Bacteria 3195
288 Ga0209673_1002898 3300025273 Bacteria 10875
289 Ga0209673_1052501 3300025273 Bacteria 1070
290 Ga0209025_1001477 3300025294 Bacteria 30602
291 Ga0209025_1003193 3300025294 Bacteria 15902
292 Ga0209025_1005241 3300025294 Bacteria 10684
293 Ga0209025_1074896 3300025294 Bacteria 1180
294 Ga0209564_1000014 3300025295 Bacteria 621501
295 Ga0209758_1000307 3300025297 Bacteria 95192
296 Ga0209758_1000524 3300025297 Bacteria 61366
297 Ga0209758_1007965 3300025297 Bacteria 7020
298 Ga0209050_1000010 3300025298 Bacteria 980454
299 Ga0209256_1007862 3300025299 Bacteria 5119
300 Ga0207426_1102357 3300025302 Bacteria 737
301 Ga0209257_1000009 3300025304 Bacteria 1205047
302 Ga0207656_10116788 3300025321 Bacteria 1238
303 Ga0207696_1012584 3300025711 Bacteria 2985
304 Ga0207655_1020440 3300025728 Bacteria 3402
305 Ga0207713_1052725 3300025735 Bacteria 1608
306 Ga0207713_1065700 3300025735 Bacteria 1361
307 Ga0207653_10043249 3300025885 Bacteria 1483
308 Ga0207710_10386923 3300025900 Bacteria 716
309 Ga0207688_10033207 3300025901 Bacteria 2853
310 Ga0207680_10163008 3300025903 Bacteria 1497
311 Ga0207647_10049579 3300025904 Bacteria 2603
312 Ga0207647_10156898 3300025904 Bacteria 1328
313 Ga0207699_10119575 3300025906 Bacteria 1702
314 Ga0207699_10200895 3300025906 Bacteria 1351
315 Ga0207645_10022741 3300025907 Bacteria 4075
316 Ga0207643_10011081 3300025908 Bacteria 4867
317 Ga0207705_10009032 3300025909 Bacteria 7263
318 Ga0207705_10074328 3300025909 Bacteria 2467
319 Ga0207705_10133631 3300025909 Bacteria 1848
320 Ga0207705_10143663 3300025909 Bacteria 1783
321 Ga0207705_10157501 3300025909 Bacteria 1704
322 Ga0207705_10651460 3300025909 Bacteria 819
323 Ga0207684_10053571 3300025910 Bacteria 3424
324 Ga0207707_10000035 3300025912 Bacteria 147299
325 Ga0207707_10019757 3300025912 Bacteria 5881
326 Ga0207707_10039234 3300025912 Bacteria 4140
327 Ga0207707_10082316 3300025912 Bacteria 2810
328 Ga0207695_10003010 3300025913 Bacteria 24221
329 Ga0207695_10010089 3300025913 Bacteria 11599
330 Ga0207695_10037012 3300025913 Bacteria 5268
331 Ga0207695_10066185 3300025913 Bacteria 3712
332 Ga0207693_10084596 3300025915 Bacteria 2486
333 Ga0207693_10591783 3300025915 Bacteria 864
334 Ga0207663_10056620 3300025916 Bacteria 2466
335 Ga0207663_10069188 3300025916 Bacteria 2270
336 Ga0207660_10004182 3300025917 Bacteria 9392
337 Ga0207660_10010368 3300025917 Bacteria 6046
338 Ga0207660_10071607 3300025917 Bacteria 2523
339 Ga0207662_10009685 3300025918 Bacteria 5311
340 Ga0207662_10015118 3300025918 Bacteria 4338
341 Ga0207662_10064955 3300025918 Bacteria 2197
342 Ga0207662_10260522 3300025918 Bacteria 1141
343 Ga0207649_10310733 3300025920 Bacteria 1155
344 Ga0207652_10000591 3300025921 Bacteria 36343
345 Ga0207652_10001126 3300025921 Bacteria 24078
346 Ga0207652_10050325 3300025921 Bacteria 3569
347 Ga0207652_10660189 3300025921 Bacteria 935
348 Ga0207646_10035312 3300025922 Bacteria 4515
349 Ga0207694_10031325 3300025924 Bacteria 4061
350 Ga0207694_10381581 3300025924 Bacteria 1170
351 Ga0207694_10431272 3300025924 Bacteria 1099
352 Ga0207650_10063103 3300025925 Bacteria 2769
353 Ga0207650_10248724 3300025925 Bacteria 1439
354 Ga0207659_10033002 3300025926 Bacteria 3558
355 Ga0207659_10066882 3300025926 Bacteria 2609
356 Ga0207659_10077009 3300025926 Bacteria 2454
357 Ga0207700_10044515 3300025928 Bacteria 3269
358 Ga0207700_10091115 3300025928 Bacteria 2408
359 Ga0207700_10277119 3300025928 Bacteria 1441
360 Ga0207664_10003823 3300025929 Bacteria 10108
361 Ga0207664_10053990 3300025929 Bacteria 3183
362 Ga0207664_10175523 3300025929 Bacteria 1837
363 Ga0207664_10626869 3300025929 Bacteria 966
364 Ga0207644_10165036 3300025931 Bacteria 1725
365 Ga0207690_10171549 3300025932 Bacteria 1626
366 Ga0207709_10322026 3300025935 Bacteria 1157
367 Ga0207670_10004613 3300025936 Bacteria 7454
368 Ga0207670_10034556 3300025936 Bacteria 3269
369 Ga0207670_10270197 3300025936 Bacteria 1321
370 Ga0207669_10005410 3300025937 Bacteria 5726
371 Ga0207669_10013972 3300025937 Bacteria 4010
372 Ga0207669_10279586 3300025937 Bacteria 1258
373 Ga0207669_10313973 3300025937 Unclassified 1197
374 Ga0207691_10030898 3300025940 Bacteria 5001
375 Ga0207691_10045807 3300025940 Bacteria 4020
376 Ga0207711_10000012 3300025941 Bacteria 515147
377 Ga0207711_10000926 3300025941 Bacteria 28264
378 Ga0207711_10006720 3300025941 Bacteria 9675
379 Ga0207711_10790827 3300025941 Bacteria 884
380 Ga0207689_10171634 3300025942 Bacteria 1788
381 Ga0207689_10267991 3300025942 Bacteria 1414
382 Ga0207661_10011528 3300025944 Bacteria 6409
383 Ga0207661_10046796 3300025944 Bacteria 3431
384 Ga0207661_10089986 3300025944 Bacteria 2555
385 Ga0207679_10020342 3300025945 Bacteria 4478
386 Ga0207679_10561606 3300025945 Bacteria 1025
387 Ga0207667_10003162 3300025949 Bacteria 20372
388 Ga0207667_10006203 3300025949 Bacteria 14514
389 Ga0207667_10080810 3300025949 Bacteria 3368
390 Ga0207667_10182956 3300025949 Bacteria 2152
391 Ga0207667_10200836 3300025949 Bacteria 2045
392 Ga0207667_10362965 3300025949 Bacteria 1477
393 Ga0207651_10190747 3300025960 Bacteria 1634
394 Ga0207651_10570993 3300025960 Bacteria 986
395 Ga0207668_10413160 3300025972 Bacteria 1144
396 Ga0207668_10884559 3300025972 Bacteria 794
397 Ga0207658_10058845 3300025986 Bacteria 2861
398 Ga0207658_10761959 3300025986 Bacteria 877
399 Ga0207677_10261515 3300026023 Bacteria 1411
400 Ga0207703_10000027 3300026035 Bacteria 209608
401 Ga0207703_10132203 3300026035 Bacteria 2156
402 Ga0207703_10506918 3300026035 Bacteria 1133
403 Ga0207639_10010438 3300026041 Bacteria 6434
404 Ga0207678_10576039 3300026067 Bacteria 986
405 Ga0207708_10258786 3300026075 Bacteria 1404
406 Ga0207702_10037671 3300026078 Bacteria 4049
407 Ga0207702_10304540 3300026078 Bacteria 1513
408 Ga0207702_10474199 3300026078 Bacteria 1217
409 Ga0207641_10000003 3300026088 Bacteria 496984
410 Ga0207641_10020753 3300026088 Bacteria 5400
411 Ga0207641_10245512 3300026088 Bacteria 1670
412 Ga0207641_10782583 3300026088 Bacteria 943
413 Ga0207641_11407520 3300026088 Bacteria 698
414 Ga0207648_10018656 3300026089 Bacteria 6278
415 Ga0207648_10088897 3300026089 Bacteria 2697
416 Ga0207676_10089866 3300026095 Bacteria 2518
417 Ga0207674_10008507 3300026116 Bacteria 11847
418 Ga0207674_10054746 3300026116 Bacteria 4060
419 Ga0207683_10181910 3300026121 Bacteria 1906
420 Ga0207698_10021421 3300026142 Bacteria 4470
421 Ga0209970_1025808 3300027614 Bacteria 1007
422 Ga0209966_1004235 3300027695 Unclassified 2428
423 Ga0209998_10000368 3300027717 Bacteria 13064
424 Ga0209974_10016256 3300027876 Bacteria 2471
425 Ga0268266_10442641 3300028379 Bacteria 1234
426 Ga0268266_10660721 3300028379 Bacteria 1006
427 Ga0268265_10054046 3300028380 Bacteria 3045
428 Ga0268265_10413816 3300028380 Bacteria 1250
429 Ga0268264_10088915 3300028381 Bacteria 2659
430 Ga0265337_1022538 3300028556 Bacteria 1949
431 Ga0265319_1006241 3300028563 Bacteria 5549
432 Ga0265318_10100822 3300028577 Bacteria 1062
433 Ga0265322_10047540 3300028654 Bacteria 1220
434 Ga0307515_10123685 3300028794 Bacteria 2908
435 Ga0307515_10206900 3300028794 Bacteria 1819
436 Ga0265338_10000030 3300028800 Bacteria 260974
437 Ga0265338_10016484 3300028800 Bacteria 8035
438 Ga0265338_10021736 3300028800 Bacteria 6674
439 Ga0265338_10022638 3300028800 Bacteria 6494
440 Ga0265338_10034301 3300028800 Bacteria 4908
441 Ga0265338_10056155 3300028800 Bacteria 3495
442 Ga0265338_10166708 3300028800 Bacteria 1695
443 Ga0265324_10003044 3300029957 Bacteria 8187
444 Ga0265324_10007067 3300029957 Bacteria 4604
445 Ga0265324_10109742 3300029957 Bacteria 937
446 Ga0265328_10081474 3300031239 Bacteria 1193
447 Ga0265320_10038708 3300031240 Bacteria 2390
448 Ga0265320_10045925 3300031240 Bacteria 2144
449 Ga0265325_10059605 3300031241 Bacteria 1940
450 Ga0265325_10086205 3300031241 Bacteria 1554
451 Ga0265339_10000238 3300031249 Bacteria 44271
452 Ga0265339_10000314 3300031249 Bacteria 39563
453 Ga0265339_10083992 3300031249 Bacteria 1679
454 Ga0265339_10094849 3300031249 Bacteria 1559
455 Ga0265339_10138767 3300031249 Bacteria 1238
456 Ga0265327_10002493 3300031251 Bacteria 19292
457 Ga0265327_10031169 3300031251 Bacteria 3000
458 Ga0265316_10002250 3300031344 Bacteria 20224
459 Ga0265316_10004799 3300031344 Bacteria 13333
460 Ga0265316_10015567 3300031344 Bacteria 6643
461 Ga0265316_10056903 3300031344 Bacteria 3051
462 Ga0265316_10089979 3300031344 Bacteria 2342
463 Ga0265316_10153435 3300031344 Bacteria 1725
464 Ga0307408_100003037 3300031548 Bacteria 11592
465 Ga0307408_100011794 3300031548 Bacteria 5781
466 Ga0307408_100172427 3300031548 Bacteria 1728
467 Ga0307408_100466105 3300031548 Bacteria 1099
468 Ga0265313_10020091 3300031595 Bacteria 3696
469 Ga0265313_10178297 3300031595 Bacteria 894
470 Ga0316579_10132858 3300031691 Bacteria 1199
471 Ga0265314_10000002 3300031711 Bacteria 2092193
472 Ga0265314_10001242 3300031711 Bacteria 29082
473 Ga0265314_10201037 3300031711 Bacteria 1178
474 Ga0316576_10059445 3300031727 Bacteria 2798
475 Ga0316578_10066557 3300031728 Bacteria 2128
476 Ga0316578_10319478 3300031728 Bacteria 927
477 Ga0307405_10385110 3300031731 Bacteria 1093
478 Ga0316577_10011138 3300031733 Bacteria 4866
479 Ga0307413_10000790 3300031824 Bacteria 10991
480 Ga0307413_10014289 3300031824 Bacteria 4026
481 Ga0307413_10671705 3300031824 Bacteria 857
482 Ga0307518_10000705 3300031838 Bacteria 25097
483 Ga0307406_10000065 3300031901 Bacteria 58903
484 Ga0307406_10070599 3300031901 Bacteria 2287
485 Ga0307406_10098647 3300031901 Bacteria 1984
486 Ga0307407_10001593 3300031903 Bacteria 8366
487 Ga0307407_10207230 3300031903 Bacteria 1318
488 Ga0307409_100063805 3300031995 Bacteria 2890
489 Ga0307409_100064807 3300031995 Bacteria 2872
490 Ga0307416_100050170 3300032002 Bacteria 3324
491 Ga0307416_100252853 3300032002 Bacteria 1716
492 Ga0307416_100257622 3300032002 Bacteria 1703
493 Ga0307416_100407854 3300032002 Bacteria 1399
494 Ga0307414_10080170 3300032004 Bacteria 2386
495 Ga0307411_10095024 3300032005 Bacteria 2091
496 Ga0307411_10245795 3300032005 Bacteria 1404
497 Ga0307415_100343647 3300032126 Bacteria 1253
498 Ga0307507_10000073 3300033179 Bacteria 157894
499 Ga0307510_10152333 3300033180 Bacteria 1928
500 Ga0373934_0000566 3300035086 Bacteria 13038
501 Ga0373923_0016397 3300035111 Bacteria 2814
502 Ga0373954_0023702 3300035118 Bacteria 2794
503 Ga0373956_0002246 3300035119 Bacteria 7955
504 Ga0373957_0004805 3300035120 Bacteria 4139
505 Ga0373955_0001004 3300035172 Bacteria 11991
506 Ga0373955_0216004 3300035172 Bacteria 1144
507 Ga0316574_0016164 3300035398 Bacteria 4343
508 Ga0316574_0124455 3300035398 Bacteria 1656
509 Ga0373924_0005948 3300035410 Bacteria 4348
510 Ga0373935_0014842 3300035692 Bacteria 4703
511 Ga0373935_0077389 3300035692 Bacteria 2156
512 Ga0373927_0002638 3300035695 Bacteria 13067
513 Ga0373933_0146001 3300035724 Bacteria 1496
514 Ga0373947_0008267 3300035725 Bacteria 5999
515 Ga0373937_0038132 3300036401 Bacteria 4380
516 Ga0373937_0068779 3300036401 Bacteria 3264
517 Ga0316582_0291076 3300036647 Bacteria 1121
518 Ga0316584_0009576 3300036712 Bacteria 6731
519 Ga0316584_0089119 3300036712 Bacteria 2310
520 Ga0316584_0244827 3300036712 Bacteria 1311
521 Ga0373925_0009218 3300037068 Bacteria 7183
522 Ga0395899_0010289 3300037312 Bacteria 7171
523 Ga0395900_0010056 3300037418 Bacteria 9678
524 Ga0395900_0041699 3300037418 Bacteria 4731
525 Ga0395898_0054498 3300037466 Bacteria 3902
526 Ga0395898_0066232 3300037466 Bacteria 3501
527 Ga0395898_0228305 3300037466 Bacteria 1775
528 Ga0395898_0234822 3300037466 Bacteria 1749
529 Ga0395898_0522766 3300037466 Bacteria 1128
530 Ga0395905_0004435 3300037471 Bacteria 14588
531 Ga0436364_0384550 3300037853 Bacteria 2001
532 Ga0436364_1398442 3300037853 Bacteria 5162
533 Ga0436364_1440964 3300037853 Bacteria 854
534 Ga0395901_0003600 3300038443 Bacteria 15631
535 Ga0395901_0893071 3300038443 Bacteria 871
536 Ga0436365_0508157 3300039437 Bacteria 1644
537 Ga0436365_1303365 3300039437 Bacteria 1848
538 Ga0436365_1549812 3300039437 Bacteria 8631
539 Ga0436365_1843484 3300039437 Bacteria 2468
540 Ga0436360_0089116 3300039438 Bacteria 2552
541 Ga0439438_096057 3300041405 Bacteria 720
542 Ga0451791_0335438 3300041451 Bacteria 2064
543 Ga0451807_1240055 3300041486 Bacteria 1410
544 Ga0451807_2178566 3300041486 Bacteria 1117
545 Ga0451841_0526181 3300041498 Bacteria 1682
546 Ga0439433_0020869 3300041999 Bacteria 1463
547 Ga0439449_0001108 3300042007 Bacteria 10596
548 Ga0466972_0006647 3300044658 Bacteria 5803
549 Ga0466972_0021015 3300044658 Bacteria 3258
550 Ga0466972_0149646 3300044658 Bacteria 1098
551 Ga0466965_0007707 3300044683 Bacteria 4954
552 Ga0466965_0017242 3300044683 Bacteria 3450
553 Ga0466965_0167688 3300044683 Bacteria 1154
554 Ga0466966_0007605 3300044684 Bacteria 7179
555 Ga0466966_0112086 3300044684 Bacteria 1681
556 Ga0466966_0288018 3300044684 Bacteria 987
557 Ga0466961_0002450 3300044693 Bacteria 11512
558 Ga0466963_0030300 3300044694 Bacteria 3490
559 Ga0466963_0213915 3300044694 Bacteria 1349
560 Ga0466963_0760077 3300044694 Bacteria 684
561 Ga0453684_0000658 3300044712 Bacteria 124108
562 Ga0466971_0027067 3300044719 Bacteria 2567
563 Ga0466971_0092146 3300044719 Bacteria 1388
564 Ga0466968_0006860 3300044735 Bacteria 4309
565 Ga0466957_0135019 3300044842 Bacteria 1585
566 Ga0466957_0141270 3300044842 Unclassified 1551
567 Ga0466960_0006891 3300044901 Bacteria 4582
568 Ga0466960_0254987 3300044901 Bacteria 976
569 Ga0466959_0022785 3300045049 Bacteria 4630
570 Ga0451576_0005189 3300045051 Bacteria 16464
571 Ga0451576_0011337 3300045051 Bacteria 10144
572 Ga0466958_0177772 3300045836 Unclassified 1350
573 Ga0466958_0396813 3300045836 Bacteria 890
574 Ga0466967_0356448 3300045976 Bacteria 1417
575 Ga0466967_0492676 3300045976 Bacteria 1202
576 Ga0495592_0004652 3300046454 Bacteria 10054
577 Ga0495603_0025152 3300046455 Bacteria 3600
578 Ga0495629_0144217 3300046459 Bacteria 1656
579 Ga0495629_0288617 3300046459 Bacteria 1125
580 Ga0495651_0051741 3300046462 Bacteria 3165
581 Ga0495651_0062422 3300046462 Bacteria 2850
582 Ga0495653_0057568 3300046463 Bacteria 2957
583 Ga0495653_0099898 3300046463 Bacteria 2104
584 Ga0495580_0061013 3300046472 Bacteria 2648
585 Ga0495662_0231574 3300046476 Bacteria 911
586 Ga0495664_0003139 3300046477 Bacteria 8972
587 Ga0495585_0148939 3300046492 Bacteria 1221
588 Ga0495596_0011574 3300046500 Bacteria 3800
589 Ga0495596_0039619 3300046500 Bacteria 1861
590 Ga0495607_0047161 3300046501 Bacteria 2526
591 Ga0495583_0078008 3300046506 Bacteria 1443
592 Ga0495608_0000967 3300046511 Bacteria 20282
593 Ga0495608_0002751 3300046511 Bacteria 12635
594 Ga0495608_0123181 3300046511 Bacteria 1662
595 Ga0495618_0040432 3300046514 Bacteria 2935
596 Ga0495618_0097155 3300046514 Bacteria 1884
597 Ga0495620_0018352 3300046515 Bacteria 3465
598 Ga0495620_0061421 3300046515 Bacteria 1563
599 Ga0495628_0006447 3300046516 Bacteria 10244
600 Ga0495628_0156398 3300046516 Bacteria 1734
601 Ga0495630_0046813 3300046517 Bacteria 3233
602 Ga0495630_0115594 3300046517 Bacteria 2033
603 Ga0495637_0077804 3300046520 Bacteria 1327
604 Ga0495644_0003380 3300046523 Bacteria 6309
605 Ga0495652_0025103 3300046529 Bacteria 5274
606 Ga0495665_0006035 3300046531 Bacteria 6530
607 Ga0495665_0065286 3300046531 Bacteria 1921
608 Ga0495640_0001890 3300046533 Bacteria 16677
609 Ga0495640_0045029 3300046533 Bacteria 3063
610 Ga0495586_0076843 3300046535 Bacteria 1830
611 Ga0495621_0124516 3300046539 Bacteria 998
612 Ga0495645_0010194 3300046543 Bacteria 6584
613 Ga0495667_0001198 3300046559 Bacteria 16942
614 Ga0495656_0366998 3300046615 Bacteria 748
615 Ga0495668_0094714 3300046616 Bacteria 1634
616 Ga0495634_0028800 3300046642 Bacteria 3851
617 Ga0495611_0023791 3300046648 Bacteria 2660
618 Ga0495625_0289099 3300046660 Bacteria 1052
619 Ga0495635_0002177 3300046663 Bacteria 13322
620 Ga0495661_0053078 3300046665 Bacteria 2440
621 Ga0495661_0144993 3300046665 Bacteria 1288
622 Ga0495588_0006504 3300046674 Bacteria 5269
623 Ga0495657_0003411 3300046675 Bacteria 12969
624 Ga0495657_0288828 3300046675 Bacteria 980
625 Ga0495599_0001407 3300046678 Bacteria 13756
626 Ga0495623_0002030 3300046679 Bacteria 13591
627 Ga0495623_0027253 3300046679 Bacteria 3674
628 Ga0495646_0004635 3300046680 Bacteria 8650
629 Ga0495646_0213177 3300046680 Bacteria 1047
630 Ga0495658_0117668 3300046683 Bacteria 1604
631 Ga0495613_0018721 3300046689 Bacteria 5163
632 Ga0495613_0044414 3300046689 Bacteria 3288
633 Ga0495613_0642150 3300046689 Bacteria 703
634 Ga0495624_0104535 3300046690 Bacteria 1743
635 Ga0495649_0054456 3300046694 Bacteria 2163
636 Ga0495649_0132356 3300046694 Bacteria 1316
637 Ga0495589_0018937 3300046794 Bacteria 3531
638 Ga0495589_0083309 3300046794 Bacteria 1554
639 Ga0495600_0000211 3300046809 Bacteria 33185
640 Ga0495600_0031035 3300046809 Bacteria 3461
641 Ga0495600_0063952 3300046809 Bacteria 2404
642 Ga0495581_0209730 3300047315 Unclassified 1139
643 Ga0495604_0001370 3300047317 Bacteria 19949
644 Ga0495604_0004566 3300047317 Bacteria 10971
645 Ga0495604_0053262 3300047317 Bacteria 3129
646 Ga0495604_0174545 3300047317 Bacteria 1508
647 Ga0495636_0035465 3300047318 Bacteria 2055
648 Ga0495636_0048180 3300047318 Bacteria 1780
649 Ga0495674_0004178 3300047319 Bacteria 13923
650 Ga0495674_0026524 3300047319 Bacteria 5301
651 Ga0495674_0081976 3300047319 Bacteria 2766
652 Ga0495676_0051054 3300047321 Bacteria 3311
653 Ga0495680_0365452 3300047322 Bacteria 1002
654 Ga0495683_0056683 3300047323 Bacteria 1949
655 Ga0495675_0015641 3300047444 Bacteria 4796
656 Ga0495675_0086994 3300047444 Bacteria 1964
657 Ga0495675_0108743 3300047444 Bacteria 1731
658 Ga0495685_000927 3300047447 Bacteria 8892
659 Ga0495685_010221 3300047447 Bacteria 3146
660 Ga0495685_078597 3300047447 Bacteria 1100
661 Ga0495673_0004876 3300047469 Bacteria 8286
662 Ga0495684_0002748 3300047471 Bacteria 13906
663 Ga0495684_0137153 3300047471 Bacteria 1836
664 Ga0495684_0551651 3300047471 Bacteria 784
665 Ga0495686_0000008 3300047472 Bacteria 727479
666 Ga0495686_0003234 3300047472 Bacteria 14307
667 Ga0495686_0015426 3300047472 Bacteria 5216
668 Ga0495686_0031826 3300047472 Bacteria 3417
669 Ga0495686_0087171 3300047472 Bacteria 1899
670 Ga0495602_0054476 3300048088 Bacteria 3530
671 Ga0495602_0061003 3300048088 Bacteria 3282
672 Ga0495626_0119701 3300048091 Bacteria 1133
673 Ga0496100_0024209 3300048903 Bacteria 3699
674 Ga0496100_0473902 3300048903 Unclassified 962
675 Ga0496101_0011535 3300048904 Bacteria 5867
676 Ga0496102_0003727 3300048905 Bacteria 12880
677 Ga0496102_0024550 3300048905 Bacteria 5360
678 Ga0496102_0198882 3300048905 Bacteria 1889
679 Ga0496103_0002797 3300048906 Bacteria 10852
680 Ga0496103_0065942 3300048906 Bacteria 2259
681 Ga0496104_0004210 3300048907 Bacteria 12491
682 Ga0496104_0091340 3300048907 Bacteria 2910
683 Ga0496104_0119215 3300048907 Bacteria 2534
684 Ga0496104_0157384 3300048907 Bacteria 2180
685 Ga0496104_0654096 3300048907 Bacteria 960
686 Ga0496105_0000459 3300048908 Bacteria 26767
687 Ga0496105_0069112 3300048908 Bacteria 2919
688 Ga0496105_0478426 3300048908 Unclassified 980
689 Ga0496106_0043228 3300048909 Bacteria 3380
690 Ga0496106_0227238 3300048909 Bacteria 1489
691 Ga0496107_0007340 3300048910 Bacteria 7600
692 Ga0496107_0299293 3300048910 Bacteria 1197
693 Ga0496108_0006635 3300048911 Bacteria 9378
694 Ga0496109_0002270 3300048912 Bacteria 15979
695 Ga0496110_0001502 3300048913 Bacteria 16928
696 Ga0496110_0062042 3300048913 Bacteria 3301
697 Ga0496110_0268437 3300048913 Bacteria 1553
698 Ga0496111_0002408 3300048914 Bacteria 11290
699 Ga0496111_0003574 3300048914 Bacteria 9634
700 Ga0496112_0003180 3300048915 Bacteria 13497
701 Ga0496112_0027824 3300048915 Bacteria 5453
702 Ga0496112_0445636 3300048915 Bacteria 1233
703 Ga0496112_0704606 3300048915 Bacteria 937
704 Ga0496112_0830228 3300048915 Bacteria 848
705 Ga0496113_0039370 3300048916 Bacteria 3479
706 Ga0496113_0154190 3300048916 Bacteria 1813
707 Ga0496114_0171199 3300048917 Bacteria 1893
708 Ga0496114_0240549 3300048917 Bacteria 1592
709 Ga0496115_0348223 3300048918 Bacteria 1209
710 Ga0496115_0381928 3300048918 Bacteria 1145
711 Ga0496116_0004911 3300048919 Bacteria 12597
712 Ga0496116_0326863 3300048919 Bacteria 715
713 Ga0496117_0004827 3300048920 Bacteria 14574
714 Ga0496117_0028672 3300048920 Bacteria 4308
715 Ga0496117_0297024 3300048920 Bacteria 857
716 Ga0496118_0006612 3300048921 Bacteria 12659
717 Ga0496118_0108884 3300048921 Bacteria 1845
718 Ga0496118_0149391 3300048921 Bacteria 1465
719 Ga0496119_0004301 3300048922 Bacteria 14237
720 Ga0496119_0039960 3300048922 Bacteria 3008
721 Ga0496119_0043465 3300048922 Bacteria 2838
722 Ga0496119_0332969 3300048922 Bacteria 740
723 Ga0496121_0000042 3300048924 Bacteria 342304
724 Ga0496121_0219033 3300048924 Bacteria 1342
725 Ga0496121_0355456 3300048924 Bacteria 974
726 Ga0496122_0006151 3300048925 Bacteria 13957
727 Ga0496122_0040065 3300048925 Bacteria 3729
728 Ga0496125_0006855 3300048928 Bacteria 12216
729 Ga0496125_0026194 3300048928 Bacteria 5320
730 Ga0496125_0265618 3300048928 Bacteria 1073
731 Ga0496126_0004899 3300048929 Bacteria 15641
732 Ga0496126_0008315 3300048929 Bacteria 11205
733 Ga0496126_0088674 3300048929 Bacteria 2724
734 Ga0496126_0727529 3300048929 Bacteria 768
735 Ga0501032_0004892 3300049569 Bacteria 10026
736 Ga0501034_0208617 3300049571 Bacteria 1909
737 Ga0501034_0273042 3300049571 Bacteria 1631
738 Ga0501034_0924612 3300049571 Bacteria 759
739 Ga0501038_0030626 3300049574 Bacteria 4758
740 Ga0501038_0126448 3300049574 Bacteria 2103
741 Ga0501043_0021252 3300049579 Bacteria 5088
742 Ga0501047_0000351 3300049581 Bacteria 52112
743 Ga0501047_0040642 3300049581 Bacteria 4497
744 Ga0501047_0108508 3300049581 Bacteria 2658
745 Ga0501047_0118019 3300049581 Bacteria 2535
746 Ga0501047_0293290 3300049581 Bacteria 1470
747 Ga0501047_0693069 3300049581 Bacteria 836
748 Ga0501070_0061540 3300049586 Bacteria 3110
749 Ga0501071_0459296 3300049587 Bacteria 975
750 Ga0501073_0041754 3300049589 Bacteria 3240
751 Ga0501073_0062276 3300049589 Bacteria 2602
752 Ga0501209_000712 3300049656 Bacteria 4194
753 Ga0501216_002867 3300049660 Bacteria 2478
754 Ga0501235_000891 3300049669 Bacteria 6146
755 Ga0501243_001147 3300049675 Bacteria 3767
756 Ga0501249_001176 3300049679 Bacteria 5511
757 Ga0501225_0006102 3300049705 Bacteria 3519
758 Ga0501079_0070684 3300049741 Bacteria 2696
759 Ga0501080_0021953 3300049742 Bacteria 5912
760 Ga0501080_0029032 3300049742 Bacteria 5149
761 Ga0501083_0002308 3300049744 Bacteria 13036
762 Ga0501035_0402309 3300049822 Bacteria 1139
763 Ga0501044_0094473 3300049823 Bacteria 3015
764 nmdc:mga06z11_72546_c1 3300050494 Bacteria 1825
765 nmdc:mga05p37_4189_c1 3300050507 Bacteria 16859
766 nmdc:mga05p37_5693_c1 3300050507 Bacteria 14645
767 nmdc:mga05p37_91963_c1 3300050507 Bacteria 3738
768 nmdc:mga09592_232145_c1 3300050508 Bacteria 1599
769 nmdc:mga09592_46077_c1 3300050508 Bacteria 3673
770 nmdc:mga0qj67_263441_c1 3300050509 Bacteria 1398
771 nmdc:mga08y16_326080_c1 3300050511 Bacteria 1580
772 nmdc:mga0n895_26408_c1 3300050512 Bacteria 5499
773 nmdc:mga0n895_68370_c1 3300050512 Bacteria 3519
774 nmdc:mga0n895_9249_c1 3300050512 Bacteria 8609
775 nmdc:mga0a205_48955_c1 3300050515 Bacteria 4079
776 nmdc:mga0a205_68073_c1 3300050515 Bacteria 3439
777 nmdc:mga0a205_7639_c1 3300050515 Bacteria 9805
778 Ga0495601_0010383 3300053077 Bacteria 5540
779 Ga0495601_0112853 3300053077 Bacteria 1761
780 Ga0495612_0012000 3300053078 Bacteria 3491
781 Ga0500635_0000399 3300053080 Bacteria 13188
782 Ga0495619_0007812 3300053085 Bacteria 6770
783 Ga0495619_0045797 3300053085 Bacteria 2874
784 Ga0495619_0345041 3300053085 Bacteria 1030
785 Ga0500643_017661 3300053087 Bacteria 2384
786 Ga0500595_050668 3300053119 Bacteria 1288
787 Ga0500608_055449 3300053122 Bacteria 1900
788 Ga0500652_000111 3300053131 Bacteria 32099
789 Ga0500568_0056311 3300053139 Bacteria 1533
790 Ga0500588_0022281 3300053146 Bacteria 1723
791 Ga0500638_156351 3300053162 Bacteria 1008
792 Ga0500636_0016608 3300053177 Bacteria 4341
793 Ga0500645_000485 3300053730 Bacteria 26881
794 Ga0466962_0216561 3300061719 Bacteria 937
795 2513612142 2513237090 Bacteria 7096802
796 2515853070 2515154155 Bacteria 7985436
797 2563927531 2563366752 Bacteria 4961801
798 2586059173 2585427649 Bacteria 9053857
799 2588295125 2588253510 Bacteria 6901809
800 2643732139 2643221542 Bacteria 3563959
801 2644016862 2643221601 Bacteria 7493239
802 2644170952 2643221630 Bacteria 3601215
803 2644177903 2643221631 Bacteria 8168043
804 2644717964 2643221731 Bacteria 5623886
805 2644724862 2643221732 Bacteria 5756404
806 2738702096 2738541274 Bacteria 6909446
807 2739335071 2738543028 Bacteria 6917070
808 2747953355 2747842429 Bacteria 3914386
809 2817619872 2816332336 Bacteria 5207640
810 2819707124 2818991465 Bacteria 5388835
811 2819746742 2818991472 Bacteria 10089953
812 2837271767 2837268691 Bacteria 7850704
813 2842882563 2842882022 Bacteria 6158489
814 2847670781 2847670302 Bacteria 6165597
815 2847687082 2847686936 Bacteria 6278406
816 2856316238 2856314179 Bacteria 6477897
817 2871450624 2871444079 Bacteria 6423508
818 2874107226 2874102143 Bacteria 6342645
819 2878041561 2878035449 Bacteria 6555736
820 2885310691 2885305155 Bacteria 7348390
821 2885326497 2885326080 Bacteria 7134805
822 2885338402 2885334103 Bacteria 7216818
823 2888583073 2888578766 Bacteria 6743310
824 2899362582 2899359706 Bacteria 10940472
825 2904526771 2904524088 Bacteria 5887454
826 2906330939 2906328253 Bacteria 6585166
827 2906416375 2906414383 Bacteria 6580790
828 2908670324 2908669403 Bacteria 5740494
829 2915773229 2915768154 Bacteria 8424322
830 2919144637 2919143609 Bacteria 6219228
831 2919391962 2919391150 Bacteria 4884741
832 2919519828 2919517244 Bacteria 5858162
833 2922159648 2922158528 Bacteria 6573167
834 2924727591 2924726620 Bacteria 6271473
835 2928095284 2928093941 Bacteria 5965005
836 2937898223 2937891427 Bacteria 6357007
837 2958122482 2958115193 Bacteria 6923548
838 2960324942 2960319331 Bacteria 5502575
839 2960377514 2960375949 Bacteria 5361395
840 2965069309 2965062239 Bacteria 7412989
841 2968092518 2968091066 Bacteria 6052692
842 2968102474 2968097103 Bacteria 6107094
843 2968128751 2968128360 Bacteria 6270294
844 2977254434 2977251589 Bacteria 2952848
845 2977858915 2977858184 Bacteria 6215359
846 2979781378 2979779861 Bacteria 6219781
847 2990060537 2990059506 Bacteria 9321252
848 637073546 637000159 Bacteria 7596297
849 8002061321 8002060224 Bacteria 4026565
850 8004183766 8004182704 Bacteria 3391155
851 8004451601 8004445564 Bacteria 6322258
852 8004714442 8004703790 Bacteria 8006957
853 8054164671 8054160619 Bacteria 7783213
854 Ga0466957_0001311
855 JGI25157J39369_1001102
856 JGI25152J39213_1000320
857 JGI25151J46595_10014828
858 JGI25151J46595_10015707
859 JGI25151J46595_10016114
860 JGI25406J46586_10002637
861 JGI25165J46597_1007854
862 JGI25153J46596_10000925
863 JGI25153J46596_10002237
864 rootH1_10015900
865 rootH2_10188135
866 rootL2_10052984
867 rootH1_10037048
868 rootH1_10347230
869 Ga0006562J51391_1000651
870 Ga0055542_1017402
871 Ga0055526_1003784
872 Ga0055530_10001188
873 Ga0055531_10001182
874 Ga0065712_10031557
875 Ga0065712_10193796
876 Ga0065715_10139949
877 Ga0065715_10147823
878 Ga0065715_10158249
879 Ga0065715_10257247
880 Ga0065715_10310250
881 Ga0065707_10181530
882 Ga0070658_10001049
883 Ga0070658_10003841
884 Ga0070658_10054338
885 Ga0070658_10151036
886 Ga0070658_10533623
887 Ga0070676_10017108
888 Ga0070676_10627309
889 Ga0070683_100101618
890 Ga0070683_100203624
891 Ga0070690_100009793
892 Ga0070670_100360491
893 Ga0070677_10070597
894 Ga0068869_100176556
895 Ga0070666_10239837
896 Ga0070680_100016753
897 Ga0070680_100114893
898 Ga0070682_100189909
899 Ga0068868_100593765
900 Ga0070660_100100936
901 Ga0070689_100003639
902 Ga0070689_100020778
903 Ga0070691_10088093
904 Ga0070687_100002770
905 Ga0070661_100021252
906 Ga0070661_100054745
907 Ga0070661_100201283
908 Ga0070669_100018812
909 Ga0070669_100325049
910 Ga0070675_100045022
911 Ga0070675_100112579
912 Ga0070675_100387120
913 Ga0070674_100043999
914 Ga0070674_100083427
915 Ga0070674_100194316
916 Ga0070674_100448654
917 Ga0070688_100569605
918 Ga0070659_100010573
919 Ga0070659_100012944
920 Ga0070667_100005914
921 Ga0070667_100182486
922 Ga0070667_100280732
923 Ga0070714_100003326
924 Ga0070714_100130034
925 Ga0070714_100411417
926 Ga0070713_100009544
927 Ga0070713_100055000
928 Ga0070713_100143876
929 Ga0070711_100054894
930 Ga0070711_100477908
931 Ga0070705_100052273
932 Ga0070705_100392777
933 Ga0070700_100289442
934 Ga0070700_100376385
935 Ga0070700_100475340
936 Ga0070694_100109851
937 Ga0070694_100458176
938 Ga0070708_100033385
939 Ga0070678_100105929
940 Ga0070662_100176003
941 Ga0070662_100410368
942 Ga0070681_10007725
943 Ga0070681_10025125
944 Ga0070681_10069875
945 Ga0070681_10091378
946 Ga0070681_10186266
947 Ga0070681_10516887
948 Ga0068867_100181760
949 Ga0070685_10013378
950 Ga0070685_10023156
951 Ga0070685_10245734
952 Ga0070706_100063105
953 Ga0070707_100059448
954 Ga0070698_100011293
955 Ga0070698_100149882
956 Ga0070698_100390698
957 Ga0070698_100398423
958 Ga0070698_100560551
959 Ga0070699_100000731
960 Ga0070679_100005625
961 Ga0070679_100140655
962 Ga0070679_100193023
963 Ga0070679_100434433
964 Ga0070684_100036383
965 Ga0070697_100146480
966 Ga0068853_100016125
967 Ga0068853_100203683
968 Ga0068853_100311971
969 Ga0068853_100692566
970 Ga0070672_100205896
971 Ga0070672_100297988
972 Ga0070672_100414893
973 Ga0070672_100494409
974 Ga0070686_100050203
975 Ga0070695_100006854
976 Ga0070696_100000405
977 Ga0070693_100037023
978 Ga0070693_100067095
979 Ga0070665_100211683
980 Ga0070665_100231717
981 Ga0070665_100382706
982 Ga0070665_100494704
983 Ga0070704_100014899
984 Ga0070704_100668764
985 Ga0068855_100002514
986 Ga0068855_100003233
987 Ga0068855_100329717
988 Ga0068855_100790308
989 Ga0068855_101185706
990 Ga0070664_100006351
991 Ga0070664_100043408
992 Ga0070664_100370474
993 Ga0068857_100095044
994 Ga0068856_100213539
995 Ga0068856_100266324
996 Ga0068856_100391936
997 Ga0070702_100113227
998 Ga0068852_100017925
999 Ga0068852_100163389
1000 Ga0068852_100199611
1001 Ga0068852_100579630
1002 Ga0068859_100050894
1003 Ga0068859_100152107
1004 Ga0068859_100733378
1005 Ga0068864_100000058
1006 Ga0068864_100420015
1007 Ga0068866_10296005
1008 Ga0068851_10146013
1009 Ga0068851_10300891
1010 Ga0068870_10017016
1011 Ga0068863_100000290
1012 Ga0068863_100447949
1013 Ga0068858_100000006
1014 Ga0068858_100050490
1015 Ga0068858_100069462
1016 Ga0068858_100849399
1017 Ga0068860_100105447
1018 Ga0068862_100596329
1019 Ga0081539_10000136
1020 Ga0081539_10081646
1021 Ga0070717_10282082
1022 Ga0075364_10073308
1023 Ga0070716_100018048
1024 Ga0070712_100071091
1025 Ga0070712_100087240
1026 Ga0075367_10133037
1027 Ga0075369_10025404
1028 Ga0075369_10078055
1029 Ga0097621_100334233
1030 Ga0097621_100530386
1031 Ga0068871_100164571
1032 Ga0068871_100179035
1033 Ga0068871_100387679
1034 Ga0068871_100592583
1035 Ga0075430_100498493
1036 Ga0075431_100002067
1037 Ga0075433_10022523
1038 Ga0075433_10040582
1039 Ga0075433_10058214
1040 Ga0075434_100006720
1041 Ga0075434_100014125
1042 Ga0075434_100025938
1043 Ga0075434_100050591
1044 Ga0075429_100041371
1045 Ga0075429_100118232
1046 Ga0097620_100005022
1047 Ga0097620_100050893
1048 Ga0097620_100152112
1049 Ga0097620_100733388
1050 Ga0099795_10013624
1051 Ga0105251_10062533
1052 Ga0105240_10005331
1053 Ga0105240_10007898
1054 Ga0105240_10558592
1055 Ga0111539_10089221
1056 Ga0111539_10643826
1057 Ga0111539_10746609
1058 Ga0114129_10025246
1059 Ga0114129_10060030
1060 Ga0114129_10445198
1061 Ga0105243_10085413
1062 Ga0105243_10636504
1063 Ga0105241_10784268
1064 Ga0105242_10043201
1065 Ga0105248_10000003
1066 Ga0105248_10003436
1067 Ga0105248_10049070
1068 Ga0105248_10073158
1069 Ga0105237_10097199
1070 Ga0105237_10446861
1071 Ga0105238_10005467
1072 Ga0099796_10136087
1073 Ga0105239_10166315
1074 Ga0105239_10195389
1075 Ga0105239_10266418
1076 Ga0105239_10786239
1077 Ga0105246_10153497
1078 Ga0105246_10338055
1079 Ga0105246_10735106
1080 Ga0157373_10030883
1081 Ga0157373_10122688
1082 Ga0157373_10281083
1083 Ga0157370_10012181
1084 Ga0157370_10430454
1085 Ga0157370_10494024
1086 Ga0157369_10000535
1087 Ga0157369_10008469
1088 Ga0157369_10014465
1089 Ga0157369_10245571
1090 Ga0157369_10247271
1091 Ga0157369_10251979
1092 Ga0157369_10264814
1093 Ga0157374_10016425
1094 Ga0157374_10104160
1095 Ga0157374_10197480
1096 Ga0157374_10516883
1097 Ga0157374_10595633
1098 Ga0157378_10512157
1099 Ga0163162_10682961
1100 Ga0163162_11133481
1101 Ga0157372_10108444
1102 Ga0157372_10257281
1103 Ga0157372_10298291
1104 Ga0157372_10480621
1105 Ga0157372_10533564
1106 Ga0157372_11047666
1107 Ga0157372_11306704
1108 Ga0157375_10091997
1109 Ga0163163_10042427
1110 Ga0163163_10083964
1111 Ga0163163_10386366
1112 Ga0157380_10120885
1113 Ga0157380_10142058
1114 Ga0157377_10021053
1115 Ga0157377_10412605
1116 Ga0157379_10010729
1117 Ga0157379_10071315
1118 Ga0157379_10143771
1119 Ga0157379_11079329
1120 Ga0157376_10106755
1121 Ga0157376_10278458
1122 Ga0206356_10185367
1123 Ga0206354_10589800
1124 Ga0206353_11894658
1125 Ga0213872_10000867
1126 Ga0213876_10022240
1127 Ga0213876_10087029
1128 Ga0213876_10111311
1129 Ga0213875_10008447
1130 Ga0209566_100461
1131 Ga0209147_100408
1132 Ga0209147_104032
1133 Ga0207425_1000334
1134 Ga0209646_1011072
1135 Ga0209026_1000002
1136 Ga0209148_1000472
1137 Ga0209759_1000822
1138 Ga0209129_1000027
1139 Ga0209233_1000293
1140 Ga0209233_1008421
1141 Ga0209673_1002898
1142 Ga0209673_1052501
1143 Ga0209025_1001477
1144 Ga0209025_1003193
1145 Ga0209025_1005241
1146 Ga0209025_1074896
1147 Ga0209564_1000014
1148 Ga0209758_1000307
1149 Ga0209758_1000524
1150 Ga0209758_1007965
1151 Ga0209050_1000010
1152 Ga0209256_1007862
1153 Ga0207426_1102357
1154 Ga0209257_1000009
1155 Ga0207656_10116788
1156 Ga0207696_1012584
1157 Ga0207655_1020440
1158 Ga0207713_1052725
1159 Ga0207713_1065700
1160 Ga0207653_10043249
1161 Ga0207710_10386923
1162 Ga0207688_10033207
1163 Ga0207680_10163008
1164 Ga0207647_10049579
1165 Ga0207647_10156898
1166 Ga0207699_10119575
1167 Ga0207699_10200895
1168 Ga0207645_10022741
1169 Ga0207643_10011081
1170 Ga0207705_10009032
1171 Ga0207705_10074328
1172 Ga0207705_10133631
1173 Ga0207705_10143663
1174 Ga0207705_10157501
1175 Ga0207705_10651460
1176 Ga0207684_10053571
1177 Ga0207707_10000035
1178 Ga0207707_10019757
1179 Ga0207707_10039234
1180 Ga0207707_10082316
1181 Ga0207695_10003010
1182 Ga0207695_10010089
1183 Ga0207695_10037012
1184 Ga0207695_10066185
1185 Ga0207693_10084596
1186 Ga0207693_10591783
1187 Ga0207663_10056620
1188 Ga0207663_10069188
1189 Ga0207660_10004182
1190 Ga0207660_10010368
1191 Ga0207660_10071607
1192 Ga0207662_10009685
1193 Ga0207662_10015118
1194 Ga0207662_10064955
1195 Ga0207662_10260522
1196 Ga0207649_10310733
1197 Ga0207652_10000591
1198 Ga0207652_10001126
1199 Ga0207652_10050325
1200 Ga0207652_10660189
1201 Ga0207646_10035312
1202 Ga0207694_10031325
1203 Ga0207694_10381581
1204 Ga0207694_10431272
1205 Ga0207650_10063103
1206 Ga0207650_10248724
1207 Ga0207659_10033002
1208 Ga0207659_10066882
1209 Ga0207659_10077009
1210 Ga0207700_10044515
1211 Ga0207700_10091115
1212 Ga0207700_10277119
1213 Ga0207664_10003823
1214 Ga0207664_10053990
1215 Ga0207664_10175523
1216 Ga0207664_10626869
1217 Ga0207644_10165036
1218 Ga0207690_10171549
1219 Ga0207709_10322026
1220 Ga0207670_10004613
1221 Ga0207670_10034556
1222 Ga0207670_10270197
1223 Ga0207669_10005410
1224 Ga0207669_10013972
1225 Ga0207669_10279586
1226 Ga0207669_10313973
1227 Ga0207691_10030898
1228 Ga0207691_10045807
1229 Ga0207711_10000012
1230 Ga0207711_10000926
1231 Ga0207711_10006720
1232 Ga0207711_10790827
1233 Ga0207689_10171634
1234 Ga0207689_10267991
1235 Ga0207661_10011528
1236 Ga0207661_10046796
1237 Ga0207661_10089986
1238 Ga0207679_10020342
1239 Ga0207679_10561606
1240 Ga0207667_10003162
1241 Ga0207667_10006203
1242 Ga0207667_10080810
1243 Ga0207667_10182956
1244 Ga0207667_10200836
1245 Ga0207667_10362965
1246 Ga0207651_10190747
1247 Ga0207651_10570993
1248 Ga0207668_10413160
1249 Ga0207668_10884559
1250 Ga0207658_10058845
1251 Ga0207658_10761959
1252 Ga0207677_10261515
1253 Ga0207703_10000027
1254 Ga0207703_10132203
1255 Ga0207703_10506918
1256 Ga0207639_10010438
1257 Ga0207678_10576039
1258 Ga0207708_10258786
1259 Ga0207702_10037671
1260 Ga0207702_10304540
1261 Ga0207702_10474199
1262 Ga0207641_10000003
1263 Ga0207641_10020753
1264 Ga0207641_10245512
1265 Ga0207641_10782583
1266 Ga0207641_11407520
1267 Ga0207648_10018656
1268 Ga0207648_10088897
1269 Ga0207676_10089866
1270 Ga0207674_10008507
1271 Ga0207674_10054746
1272 Ga0207683_10181910
1273 Ga0207698_10021421
1274 Ga0209970_1025808
1275 Ga0209966_1004235
1276 Ga0209998_10000368
1277 Ga0209974_10016256
1278 Ga0268266_10442641
1279 Ga0268266_10660721
1280 Ga0268265_10054046
1281 Ga0268265_10413816
1282 Ga0268264_10088915
1283 Ga0265337_1022538
1284 Ga0265319_1006241
1285 Ga0265318_10100822
1286 Ga0265322_10047540
1287 Ga0307515_10123685
1288 Ga0307515_10206900
1289 Ga0265338_10000030
1290 Ga0265338_10016484
1291 Ga0265338_10021736
1292 Ga0265338_10022638
1293 Ga0265338_10034301
1294 Ga0265338_10056155
1295 Ga0265338_10166708
1296 Ga0265324_10003044
1297 Ga0265324_10007067
1298 Ga0265324_10109742
1299 Ga0265328_10081474
1300 Ga0265320_10038708
1301 Ga0265320_10045925
1302 Ga0265325_10059605
1303 Ga0265325_10086205
1304 Ga0265339_10000238
1305 Ga0265339_10000314
1306 Ga0265339_10083992
1307 Ga0265339_10094849
1308 Ga0265339_10138767
1309 Ga0265327_10002493
1310 Ga0265327_10031169
1311 Ga0265316_10002250
1312 Ga0265316_10004799
1313 Ga0265316_10015567
1314 Ga0265316_10056903
1315 Ga0265316_10089979
1316 Ga0265316_10153435
1317 Ga0307408_100003037
1318 Ga0307408_100011794
1319 Ga0307408_100172427
1320 Ga0307408_100466105
1321 Ga0265313_10020091
1322 Ga0265313_10178297
1323 Ga0316579_10132858
1324 Ga0265314_10000002
1325 Ga0265314_10001242
1326 Ga0265314_10201037
1327 Ga0316576_10059445
1328 Ga0316578_10066557
1329 Ga0316578_10319478
1330 Ga0307405_10385110
1331 Ga0316577_10011138
1332 Ga0307413_10000790
1333 Ga0307413_10014289
1334 Ga0307413_10671705
1335 Ga0307518_10000705
1336 Ga0307406_10000065
1337 Ga0307406_10070599
1338 Ga0307406_10098647
1339 Ga0307407_10001593
1340 Ga0307407_10207230
1341 Ga0307409_100063805
1342 Ga0307409_100064807
1343 Ga0307416_100050170
1344 Ga0307416_100252853
1345 Ga0307416_100257622
1346 Ga0307416_100407854
1347 Ga0307414_10080170
1348 Ga0307411_10095024
1349 Ga0307411_10245795
1350 Ga0307415_100343647
1351 Ga0307507_10000073
1352 Ga0307510_10152333
1353 Ga0373934_0000566
1354 Ga0373923_0016397
1355 Ga0373954_0023702
1356 Ga0373956_0002246
1357 Ga0373957_0004805
1358 Ga0373955_0001004
1359 Ga0373955_0216004
1360 Ga0316574_0016164
1361 Ga0316574_0124455
1362 Ga0373924_0005948
1363 Ga0373935_0014842
1364 Ga0373935_0077389
1365 Ga0373927_0002638
1366 Ga0373933_0146001
1367 Ga0373947_0008267
1368 Ga0373937_0038132
1369 Ga0373937_0068779
1370 Ga0316582_0291076
1371 Ga0316584_0009576
1372 Ga0316584_0089119
1373 Ga0316584_0244827
1374 Ga0373925_0009218
1375 Ga0395899_0010289
1376 Ga0395900_0010056
1377 Ga0395900_0041699
1378 Ga0395898_0054498
1379 Ga0395898_0066232
1380 Ga0395898_0228305
1381 Ga0395898_0234822
1382 Ga0395898_0522766
1383 Ga0395905_0004435
1384 Ga0436364_0384550
1385 Ga0436364_1398442
1386 Ga0436364_1440964
1387 Ga0395901_0003600
1388 Ga0395901_0893071
1389 Ga0436365_0508157
1390 Ga0436365_1303365
1391 Ga0436365_1549812
1392 Ga0436365_1843484
1393 Ga0436360_0089116
1394 Ga0439438_096057
1395 Ga0451791_0335438
1396 Ga0451807_1240055
1397 Ga0451807_2178566
1398 Ga0451841_0526181
1399 Ga0439433_0020869
1400 Ga0439449_0001108
1401 Ga0466972_0006647
1402 Ga0466972_0021015
1403 Ga0466972_0149646
1404 Ga0466965_0007707
1405 Ga0466965_0017242
1406 Ga0466965_0167688
1407 Ga0466966_0007605
1408 Ga0466966_0112086
1409 Ga0466966_0288018
1410 Ga0466961_0002450
1411 Ga0466963_0030300
1412 Ga0466963_0213915
1413 Ga0466963_0760077
1414 Ga0453684_0000658
1415 Ga0466971_0027067
1416 Ga0466971_0092146
1417 Ga0466968_0006860
1418 Ga0466957_0135019
1419 Ga0466957_0141270
1420 Ga0466960_0006891
1421 Ga0466960_0254987
1422 Ga0466959_0022785
1423 Ga0451576_0005189
1424 Ga0451576_0011337
1425 Ga0466958_0177772
1426 Ga0466958_0396813
1427 Ga0466967_0356448
1428 Ga0466967_0492676
1429 Ga0495592_0004652
1430 Ga0495603_0025152
1431 Ga0495629_0144217
1432 Ga0495629_0288617
1433 Ga0495651_0051741
1434 Ga0495651_0062422
1435 Ga0495653_0057568
1436 Ga0495653_0099898
1437 Ga0495580_0061013
1438 Ga0495662_0231574
1439 Ga0495664_0003139
1440 Ga0495585_0148939
1441 Ga0495596_0011574
1442 Ga0495596_0039619
1443 Ga0495607_0047161
1444 Ga0495583_0078008
1445 Ga0495608_0000967
1446 Ga0495608_0002751
1447 Ga0495608_0123181
1448 Ga0495618_0040432
1449 Ga0495618_0097155
1450 Ga0495620_0018352
1451 Ga0495620_0061421
1452 Ga0495628_0006447
1453 Ga0495628_0156398
1454 Ga0495630_0046813
1455 Ga0495630_0115594
1456 Ga0495637_0077804
1457 Ga0495644_0003380
1458 Ga0495652_0025103
1459 Ga0495665_0006035
1460 Ga0495665_0065286
1461 Ga0495640_0001890
1462 Ga0495640_0045029
1463 Ga0495586_0076843
1464 Ga0495621_0124516
1465 Ga0495645_0010194
1466 Ga0495667_0001198
1467 Ga0495656_0366998
1468 Ga0495668_0094714
1469 Ga0495634_0028800
1470 Ga0495611_0023791
1471 Ga0495625_0289099
1472 Ga0495635_0002177
1473 Ga0495661_0053078
1474 Ga0495661_0144993
1475 Ga0495588_0006504
1476 Ga0495657_0003411
1477 Ga0495657_0288828
1478 Ga0495599_0001407
1479 Ga0495623_0002030
1480 Ga0495623_0027253
1481 Ga0495646_0004635
1482 Ga0495646_0213177
1483 Ga0495658_0117668
1484 Ga0495613_0018721
1485 Ga0495613_0044414
1486 Ga0495613_0642150
1487 Ga0495624_0104535
1488 Ga0495649_0054456
1489 Ga0495649_0132356
1490 Ga0495589_0018937
1491 Ga0495589_0083309
1492 Ga0495600_0000211
1493 Ga0495600_0031035
1494 Ga0495600_0063952
1495 Ga0495581_0209730
1496 Ga0495604_0001370
1497 Ga0495604_0004566
1498 Ga0495604_0053262
1499 Ga0495604_0174545
1500 Ga0495636_0035465
1501 Ga0495636_0048180
1502 Ga0495674_0004178
1503 Ga0495674_0026524
1504 Ga0495674_0081976
1505 Ga0495676_0051054
1506 Ga0495680_0365452
1507 Ga0495683_0056683
1508 Ga0495675_0015641
1509 Ga0495675_0086994
1510 Ga0495675_0108743
1511 Ga0495685_000927
1512 Ga0495685_010221
1513 Ga0495685_078597
1514 Ga0495673_0004876
1515 Ga0495684_0002748
1516 Ga0495684_0137153
1517 Ga0495684_0551651
1518 Ga0495686_0000008
1519 Ga0495686_0003234
1520 Ga0495686_0015426
1521 Ga0495686_0031826
1522 Ga0495686_0087171
1523 Ga0495602_0054476
1524 Ga0495602_0061003
1525 Ga0495626_0119701
1526 Ga0496100_0024209
1527 Ga0496100_0473902
1528 Ga0496101_0011535
1529 Ga0496102_0003727
1530 Ga0496102_0024550
1531 Ga0496102_0198882
1532 Ga0496103_0002797
1533 Ga0496103_0065942
1534 Ga0496104_0004210
1535 Ga0496104_0091340
1536 Ga0496104_0119215
1537 Ga0496104_0157384
1538 Ga0496104_0654096
1539 Ga0496105_0000459
1540 Ga0496105_0069112
1541 Ga0496105_0478426
1542 Ga0496106_0043228
1543 Ga0496106_0227238
1544 Ga0496107_0007340
1545 Ga0496107_0299293
1546 Ga0496108_0006635
1547 Ga0496109_0002270
1548 Ga0496110_0001502
1549 Ga0496110_0062042
1550 Ga0496110_0268437
1551 Ga0496111_0002408
1552 Ga0496111_0003574
1553 Ga0496112_0003180
1554 Ga0496112_0027824
1555 Ga0496112_0445636
1556 Ga0496112_0704606
1557 Ga0496112_0830228
1558 Ga0496113_0039370
1559 Ga0496113_0154190
1560 Ga0496114_0171199
1561 Ga0496114_0240549
1562 Ga0496115_0348223
1563 Ga0496115_0381928
1564 Ga0496116_0004911
1565 Ga0496116_0326863
1566 Ga0496117_0004827
1567 Ga0496117_0028672
1568 Ga0496117_0297024
1569 Ga0496118_0006612
1570 Ga0496118_0108884
1571 Ga0496118_0149391
1572 Ga0496119_0004301
1573 Ga0496119_0039960
1574 Ga0496119_0043465
1575 Ga0496119_0332969
1576 Ga0496121_0000042
1577 Ga0496121_0219033
1578 Ga0496121_0355456
1579 Ga0496122_0006151
1580 Ga0496122_0040065
1581 Ga0496125_0006855
1582 Ga0496125_0026194
1583 Ga0496125_0265618
1584 Ga0496126_0004899
1585 Ga0496126_0008315
1586 Ga0496126_0088674
1587 Ga0496126_0727529
1588 Ga0501032_0004892
1589 Ga0501034_0208617
1590 Ga0501034_0273042
1591 Ga0501034_0924612
1592 Ga0501038_0030626
1593 Ga0501038_0126448
1594 Ga0501043_0021252
1595 Ga0501047_0000351
1596 Ga0501047_0040642
1597 Ga0501047_0108508
1598 Ga0501047_0118019
1599 Ga0501047_0293290
1600 Ga0501047_0693069
1601 Ga0501070_0061540
1602 Ga0501071_0459296
1603 Ga0501073_0041754
1604 Ga0501073_0062276
1605 Ga0501209_000712
1606 Ga0501216_002867
1607 Ga0501235_000891
1608 Ga0501243_001147
1609 Ga0501249_001176
1610 Ga0501225_0006102
1611 Ga0501079_0070684
1612 Ga0501080_0021953
1613 Ga0501080_0029032
1614 Ga0501083_0002308
1615 Ga0501035_0402309
1616 Ga0501044_0094473
1617 nmdc:mga06z11_72546_c1
1618 nmdc:mga05p37_4189_c1
1619 nmdc:mga05p37_5693_c1
1620 nmdc:mga05p37_91963_c1
1621 nmdc:mga09592_232145_c1
1622 nmdc:mga09592_46077_c1
1623 nmdc:mga0qj67_263441_c1
1624 nmdc:mga08y16_326080_c1
1625 nmdc:mga0n895_26408_c1
1626 nmdc:mga0n895_68370_c1
1627 nmdc:mga0n895_9249_c1
1628 nmdc:mga0a205_48955_c1
1629 nmdc:mga0a205_68073_c1
1630 nmdc:mga0a205_7639_c1
1631 Ga0495601_0010383
1632 Ga0495601_0112853
1633 Ga0495612_0012000
1634 Ga0500635_0000399
1635 Ga0495619_0007812
1636 Ga0495619_0045797
1637 Ga0495619_0345041
1638 Ga0500643_017661
1639 Ga0500595_050668
1640 Ga0500608_055449
1641 Ga0500652_000111
1642 Ga0500568_0056311
1643 Ga0500588_0022281
1644 Ga0500638_156351
1645 Ga0500636_0016608
1646 Ga0500645_000485
1647 Ga0466962_0216561
1648 2513612142
1649 2515853070
1650 2563927531
1651 2586059173
1652 2588295125
1653 2643732139
1654 2644016862
1655 2644170952
1656 2644177903
1657 2644717964
1658 2644724862
1659 2738702096
1660 2739335071
1661 2747953355
1662 2817619872
1663 2819707124
1664 2819746742
1665 2837271767
1666 2842882563
1667 2847670781
1668 2847687082
1669 2856316238
1670 2871450624
1671 2874107226
1672 2878041561
1673 2885310691
1674 2885326497
1675 2885338402
1676 2888583073
1677 2899362582
1678 2904526771
1679 2906330939
1680 2906416375
1681 2908670324
1682 2915773229
1683 2919144637
1684 2919391962
1685 2919519828
1686 2922159648
1687 2924727591
1688 2928095284
1689 2937898223
1690 2958122482
1691 2960324942
1692 2960377514
1693 2965069309
1694 2968092518
1695 2968102474
1696 2968128751
1697 2977254434
1698 2977858915
1699 2979781378
1700 2990060537
1701 637073546
1702 8002061321
1703 8004183766
1704 8004451601
1705 8004714442
1706 8054164671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01596

Methyltransf_3

O-methyltransferase

63

263

0.92

PF13578

Methyltransf_24

Methyltransferase domain

106

211

0.89

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

82

188

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3duw-assembly1.cif.gz_B crystal structural analysis of the o-methyltransferase from bacillus cereus in complex sah 0.9909 2 221
3tfw-assembly1.cif.gz_B-2 crystal structure of a putative o-methyltransferase from klebsiella pneumoniae 0.9867 3 221
3duw-assembly1.cif.gz_B crystal structural analysis of the o-methyltransferase from bacillus cereus in complex sah 0.9864 2 221
8c9t-assembly2.cif.gz_B catechol o-methyltransferase from streptomyces avermitilis 0.9806 2 220
7cvv-assembly1.cif.gz_A crystal structure of catechol o-methyl transferase (comt) from niastella koreensis 0.9768 4 221
ID Description Score Start End Superfamily
af_O07431_3_220_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9766 7 221 3.40.50.150
af_O07431_3_220_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9414 7 221 3.40.50.150
3dulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.933 6 221 3.40.50.150
af_Q9M266_77_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9268 8 221 3.40.50.150
3dulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9241 6 221 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1U9YUW5-F1-model_v4 deleted 0.9937 25 121
AF-A0A7T4ZVG2-F1-model_v4 deleted 0.9932 2 221
AF-B9Y3Q2-F1-model_v4 O-methyltransferase 0.9919 2 221 GO:0008171
GO:0008757
GO:0032259
AF-A0A2T7STZ3-F1-model_v4 O-methyltransferase 0.9915 1 220 GO:0008171
GO:0008757
GO:0032259
AF-W1DRQ0-F1-model_v4 O-methyltransferase 0.9915 75 221 GO:0008171
GO:0008757
GO:0032259

Map