F483564
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 853 | 410 | 1706 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300053079|Ga0500610_0093299|Ga0500610_0093299_23_991 |
| Length | 313 |
| Sequence | MPFEFDTPTLIVICTAISVVLFAEAVYLLGFSGASYRKNVNRRLKISQVQPDREAILIQLRRERGLTSDGLFSFGLHWVNRLILESGMTGGRLKLALAALIGTLTESLLQAXXAGLFAALLFPFIMLIIARKRRHGKFGAQFPDAMDIIVRSLRAGHPVPVAIGLVAQELADPIGTEFGIAADEITYGADVETAMRNLYFRVGQEDLPLFVTAVAIQGSTGGNLSEILSNLSAVIRQRFKMRRKIRALAAEGKFSALFLSGLPIAVFFLLNVMTPDYYASIWKYDLTKIGLGVAAGWMMMGNVLMYKMCNFRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 26 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 117 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 134 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 150 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 237 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 239 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 247 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 249 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 251 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 252 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 255 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 265 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 271 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 278 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 279 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 282 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 284 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 287 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 288 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 289 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 290 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 291 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 292 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 293 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 294 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 295 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 296 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 297 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 298 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 299 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 300 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 347 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 348 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 383 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 384 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 398 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 399 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 400 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 401 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 403 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 405 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 407 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 410 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.12 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.4 |
| Nodule | 0 |
| Rhizoplane | 6.8 |
| Rhizosphere | 89.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500610_0093299 | 3300053079 | Bacteria | 1563 |
| 2 | SwRhRL2b_contig_211530 | 2162886007 | Unclassified | 1451 |
| 3 | 2214939638 | 2209111006 | Bacteria | 6466 |
| 4 | ARcpr5oldR_c000200 | 3300000041 | Bacteria | 10080 |
| 5 | ARSoilYngRDRAFT_c00112 | 3300000042 | Bacteria | 13838 |
| 6 | ARcpr5yngRDRAFT_c000099 | 3300000043 | Bacteria | 13598 |
| 7 | ARSoilOldRDRAFT_c000057 | 3300000044 | Bacteria | 23572 |
| 8 | ARCol0yngRDRAFT_1000002 | 3300000652 | Bacteria | 55259 |
| 9 | JGI24752J21851_1000687 | 3300001976 | Bacteria | 4515 |
| 10 | JGI24746J21847_1003277 | 3300001977 | Bacteria | 2549 |
| 11 | JGI24747J21853_1000005 | 3300001978 | Bacteria | 12190 |
| 12 | JGI24740J21852_10023436 | 3300001979 | Bacteria | 2108 |
| 13 | JGI24739J22299_10002265 | 3300001989 | Bacteria | 7399 |
| 14 | JGI24737J22298_10001491 | 3300001990 | Bacteria | 8349 |
| 15 | JGI24737J22298_10007538 | 3300001990 | Bacteria | 3668 |
| 16 | JGI24737J22298_10011929 | 3300001990 | Bacteria | 2839 |
| 17 | JGI24743J22301_10003125 | 3300001991 | Bacteria | 2583 |
| 18 | JGI24735J21928_10059680 | 3300002067 | Bacteria | 1096 |
| 19 | JGI24750J21931_1000421 | 3300002070 | Bacteria | 6970 |
| 20 | JGI24738J21930_10001595 | 3300002075 | Bacteria | 6246 |
| 21 | JGI24744J21845_10000953 | 3300002077 | Bacteria | 5510 |
| 22 | JGI24035J26624_1000120 | 3300002126 | Bacteria | 6822 |
| 23 | JGI24033J26618_1000561 | 3300002155 | Bacteria | 3585 |
| 24 | JGI24034J26672_10005293 | 3300002239 | Bacteria | 1847 |
| 25 | JGI24742J22300_10002020 | 3300002244 | Bacteria | 3240 |
| 26 | JGI24751J29686_10003524 | 3300002459 | Bacteria | 3152 |
| 27 | JGI25404J52841_10003033 | 3300003659 | Bacteria | 3270 |
| 28 | Ga0065717_1002163 | 3300005276 | Bacteria | 2667 |
| 29 | Ga0065704_10093895 | 3300005289 | Bacteria | 2572 |
| 30 | Ga0065712_10000677 | 3300005290 | Bacteria | 11212 |
| 31 | Ga0065715_10089460 | 3300005293 | Bacteria | 10071 |
| 32 | Ga0065715_10146056 | 3300005293 | Unclassified | 1787 |
| 33 | Ga0070658_10001079 | 3300005327 | Bacteria | 23302 |
| 34 | Ga0070658_10027129 | 3300005327 | Bacteria | 4598 |
| 35 | Ga0070676_10000332 | 3300005328 | Bacteria | 21434 |
| 36 | Ga0070683_100004171 | 3300005329 | Bacteria | 11837 |
| 37 | Ga0070683_100166798 | 3300005329 | Bacteria | 2090 |
| 38 | Ga0070670_100014416 | 3300005331 | Bacteria | 6783 |
| 39 | Ga0070670_100079111 | 3300005331 | Bacteria | 2825 |
| 40 | Ga0070677_10000258 | 3300005333 | Bacteria | 18304 |
| 41 | Ga0068869_100000510 | 3300005334 | Bacteria | 21648 |
| 42 | Ga0068869_100093650 | 3300005334 | Bacteria | 2264 |
| 43 | Ga0070666_10006735 | 3300005335 | Bacteria | 7074 |
| 44 | Ga0070680_100001476 | 3300005336 | Bacteria | 17088 |
| 45 | Ga0070680_100014316 | 3300005336 | Bacteria | 6194 |
| 46 | Ga0070680_100045368 | 3300005336 | Bacteria | 3573 |
| 47 | Ga0070680_100046304 | 3300005336 | Bacteria | 3538 |
| 48 | Ga0070680_100149189 | 3300005336 | Bacteria | 1963 |
| 49 | Ga0070680_100168351 | 3300005336 | Bacteria | 1843 |
| 50 | Ga0070682_100000800 | 3300005337 | Bacteria | 18467 |
| 51 | Ga0070682_100040937 | 3300005337 | Bacteria | 2853 |
| 52 | Ga0070682_100076282 | 3300005337 | Bacteria | 2157 |
| 53 | Ga0068868_100000148 | 3300005338 | Bacteria | 45833 |
| 54 | Ga0070660_100001314 | 3300005339 | Bacteria | 16922 |
| 55 | Ga0070660_100005629 | 3300005339 | Bacteria | 8682 |
| 56 | Ga0070660_100043853 | 3300005339 | Bacteria | 3419 |
| 57 | Ga0070660_100051330 | 3300005339 | Bacteria | 3176 |
| 58 | Ga0070689_100009190 | 3300005340 | Bacteria | 6996 |
| 59 | Ga0070689_100025871 | 3300005340 | Bacteria | 4412 |
| 60 | Ga0070689_100041732 | 3300005340 | Bacteria | 3522 |
| 61 | Ga0070691_10001528 | 3300005341 | Bacteria | 9952 |
| 62 | Ga0070687_100000318 | 3300005343 | Bacteria | 16315 |
| 63 | Ga0070661_100000768 | 3300005344 | Bacteria | 23141 |
| 64 | Ga0070692_10000347 | 3300005345 | Bacteria | 13504 |
| 65 | Ga0070668_100004879 | 3300005347 | Bacteria | 9938 |
| 66 | Ga0070675_100001491 | 3300005354 | Bacteria | 17261 |
| 67 | Ga0070671_100001416 | 3300005355 | Bacteria | 17934 |
| 68 | Ga0070671_100410283 | 3300005355 | Bacteria | 1159 |
| 69 | Ga0070674_100001355 | 3300005356 | Bacteria | 12909 |
| 70 | Ga0070673_100000670 | 3300005364 | Bacteria | 18859 |
| 71 | Ga0070673_100066154 | 3300005364 | Bacteria | 2886 |
| 72 | Ga0070688_100001144 | 3300005365 | Bacteria | 13256 |
| 73 | Ga0070688_100060334 | 3300005365 | Bacteria | 2395 |
| 74 | Ga0070659_100001400 | 3300005366 | Bacteria | 17383 |
| 75 | Ga0070659_100045780 | 3300005366 | Bacteria | 3428 |
| 76 | Ga0070659_100077702 | 3300005366 | Bacteria | 2648 |
| 77 | Ga0070667_100002340 | 3300005367 | Bacteria | 16596 |
| 78 | Ga0070667_100009705 | 3300005367 | Bacteria | 7978 |
| 79 | Ga0070709_10052829 | 3300005434 | Bacteria | 2556 |
| 80 | Ga0070709_10068694 | 3300005434 | Bacteria | 2280 |
| 81 | Ga0070714_100058449 | 3300005435 | Bacteria | 3303 |
| 82 | Ga0070713_100000838 | 3300005436 | Bacteria | 19660 |
| 83 | Ga0070713_100052496 | 3300005436 | Bacteria | 3375 |
| 84 | Ga0070713_100139281 | 3300005436 | Bacteria | 2147 |
| 85 | Ga0070710_10014664 | 3300005437 | Bacteria | 3948 |
| 86 | Ga0070710_10045772 | 3300005437 | Unclassified | 2434 |
| 87 | Ga0070710_10162031 | 3300005437 | Bacteria | 1388 |
| 88 | Ga0070710_10184638 | 3300005437 | Bacteria | 1308 |
| 89 | Ga0070701_10000066 | 3300005438 | Bacteria | 28271 |
| 90 | Ga0070711_100020031 | 3300005439 | Bacteria | 4304 |
| 91 | Ga0070711_100044002 | 3300005439 | Bacteria | 3028 |
| 92 | Ga0070711_100098409 | 3300005439 | Bacteria | 2123 |
| 93 | Ga0070711_100267340 | 3300005439 | Bacteria | 1348 |
| 94 | Ga0070711_100283973 | 3300005439 | Bacteria | 1310 |
| 95 | Ga0070705_100001500 | 3300005440 | Bacteria | 12285 |
| 96 | Ga0070663_100292869 | 3300005455 | Bacteria | 1300 |
| 97 | Ga0070678_100000391 | 3300005456 | Bacteria | 20585 |
| 98 | Ga0070678_100000533 | 3300005456 | Bacteria | 18526 |
| 99 | Ga0070662_100001285 | 3300005457 | Bacteria | 15435 |
| 100 | Ga0070662_100074764 | 3300005457 | Bacteria | 2507 |
| 101 | Ga0070662_100117199 | 3300005457 | Bacteria | 2037 |
| 102 | Ga0070681_10002720 | 3300005458 | Bacteria | 16283 |
| 103 | Ga0070681_10070625 | 3300005458 | Bacteria | 3457 |
| 104 | Ga0070681_10084411 | 3300005458 | Bacteria | 3128 |
| 105 | Ga0070681_10140043 | 3300005458 | Bacteria | 2349 |
| 106 | Ga0070681_10168379 | 3300005458 | Bacteria | 2113 |
| 107 | Ga0070681_10216735 | 3300005458 | Bacteria | 1830 |
| 108 | Ga0070681_10233082 | 3300005458 | Bacteria | 1755 |
| 109 | Ga0070681_10285042 | 3300005458 | Bacteria | 1562 |
| 110 | Ga0068867_100001688 | 3300005459 | Bacteria | 15398 |
| 111 | Ga0070685_10000496 | 3300005466 | Bacteria | 22749 |
| 112 | Ga0074259_11597102 | 3300005507 | Bacteria | 2654 |
| 113 | Ga0070699_100401292 | 3300005518 | Bacteria | 1240 |
| 114 | Ga0070679_100007687 | 3300005530 | Bacteria | 10092 |
| 115 | Ga0070679_100032306 | 3300005530 | Bacteria | 5176 |
| 116 | Ga0070679_100048607 | 3300005530 | Bacteria | 4226 |
| 117 | Ga0070679_100130409 | 3300005530 | Bacteria | 2495 |
| 118 | Ga0070684_100000101 | 3300005535 | Bacteria | 55960 |
| 119 | Ga0068853_100005490 | 3300005539 | Bacteria | 9938 |
| 120 | Ga0070672_100000016 | 3300005543 | Bacteria | 71848 |
| 121 | Ga0070686_100002195 | 3300005544 | Bacteria | 10783 |
| 122 | Ga0070695_100000225 | 3300005545 | Bacteria | 27760 |
| 123 | Ga0070695_100109868 | 3300005545 | Unclassified | 1869 |
| 124 | Ga0070696_100251546 | 3300005546 | Bacteria | 1336 |
| 125 | Ga0070693_100000138 | 3300005547 | Bacteria | 32988 |
| 126 | Ga0070693_100139635 | 3300005547 | Bacteria | 1524 |
| 127 | Ga0070665_100009456 | 3300005548 | Bacteria | 9865 |
| 128 | Ga0068855_100004983 | 3300005563 | Bacteria | 16204 |
| 129 | Ga0068855_100008651 | 3300005563 | Bacteria | 12299 |
| 130 | Ga0068855_100061527 | 3300005563 | Bacteria | 4386 |
| 131 | Ga0068855_100079557 | 3300005563 | Bacteria | 3801 |
| 132 | Ga0068855_100103490 | 3300005563 | Bacteria | 3275 |
| 133 | Ga0068855_100547901 | 3300005563 | Bacteria | 1252 |
| 134 | Ga0070664_100000067 | 3300005564 | Bacteria | 65201 |
| 135 | Ga0070664_100042919 | 3300005564 | Bacteria | 3816 |
| 136 | Ga0070664_100086949 | 3300005564 | Bacteria | 2701 |
| 137 | Ga0070664_100205626 | 3300005564 | Bacteria | 1758 |
| 138 | Ga0068857_100000275 | 3300005577 | Bacteria | 35176 |
| 139 | Ga0068857_100344642 | 3300005577 | Bacteria | 1379 |
| 140 | Ga0068854_100002271 | 3300005578 | Bacteria | 11828 |
| 141 | Ga0068856_100001016 | 3300005614 | Bacteria | 29871 |
| 142 | Ga0068856_100072079 | 3300005614 | Bacteria | 3420 |
| 143 | Ga0068856_100152568 | 3300005614 | Bacteria | 2320 |
| 144 | Ga0070702_100000175 | 3300005615 | Bacteria | 20470 |
| 145 | Ga0068852_100000611 | 3300005616 | Bacteria | 23441 |
| 146 | Ga0068852_100107719 | 3300005616 | Bacteria | 2528 |
| 147 | Ga0068852_100231389 | 3300005616 | Bacteria | 1762 |
| 148 | Ga0068859_100002948 | 3300005617 | Bacteria | 17261 |
| 149 | Ga0068859_100153834 | 3300005617 | Bacteria | 2376 |
| 150 | Ga0068864_100000234 | 3300005618 | Bacteria | 49663 |
| 151 | Ga0068866_10002176 | 3300005718 | Bacteria | 8161 |
| 152 | Ga0068861_100000317 | 3300005719 | Bacteria | 27073 |
| 153 | Ga0068870_10000009 | 3300005840 | Bacteria | 70353 |
| 154 | Ga0068863_100001729 | 3300005841 | Bacteria | 21634 |
| 155 | Ga0068863_100243537 | 3300005841 | Bacteria | 1736 |
| 156 | Ga0068858_100001059 | 3300005842 | Bacteria | 28468 |
| 157 | Ga0068858_100146326 | 3300005842 | Bacteria | 2219 |
| 158 | Ga0068860_100003167 | 3300005843 | Bacteria | 16980 |
| 159 | Ga0068860_100054184 | 3300005843 | Bacteria | 3812 |
| 160 | Ga0068860_100105226 | 3300005843 | Bacteria | 2695 |
| 161 | Ga0068862_100059326 | 3300005844 | Bacteria | 3285 |
| 162 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 163 | Ga0081455_10008146 | 3300005937 | Bacteria | 10932 |
| 164 | Ga0081455_10050343 | 3300005937 | Bacteria | 3584 |
| 165 | Ga0081455_10155291 | 3300005937 | Bacteria | 1760 |
| 166 | Ga0081455_10246077 | 3300005937 | Bacteria | 1311 |
| 167 | Ga0081540_1002418 | 3300005983 | Bacteria | 15215 |
| 168 | Ga0081540_1023338 | 3300005983 | Bacteria | 3620 |
| 169 | Ga0081539_10000785 | 3300005985 | Bacteria | 61844 |
| 170 | Ga0070717_10038117 | 3300006028 | Bacteria | 3906 |
| 171 | Ga0075365_10081588 | 3300006038 | Bacteria | 2191 |
| 172 | Ga0075368_10031688 | 3300006042 | Bacteria | 2051 |
| 173 | Ga0075363_100110530 | 3300006048 | Bacteria | 1527 |
| 174 | Ga0070716_100027805 | 3300006173 | Bacteria | 3042 |
| 175 | Ga0070716_100206395 | 3300006173 | Bacteria | 1310 |
| 176 | Ga0075367_10011527 | 3300006178 | Bacteria | 4682 |
| 177 | Ga0075367_10178443 | 3300006178 | Bacteria | 1324 |
| 178 | Ga0075369_10013674 | 3300006186 | Bacteria | 3228 |
| 179 | Ga0097621_100008493 | 3300006237 | Bacteria | 7396 |
| 180 | Ga0097621_100086650 | 3300006237 | Bacteria | 2614 |
| 181 | Ga0097621_100152886 | 3300006237 | Bacteria | 1979 |
| 182 | Ga0068871_100000012 | 3300006358 | Bacteria | 105267 |
| 183 | Ga0068871_100015699 | 3300006358 | Bacteria | 5680 |
| 184 | Ga0068871_100043549 | 3300006358 | Bacteria | 3605 |
| 185 | Ga0075428_100054583 | 3300006844 | Bacteria | 4378 |
| 186 | Ga0075428_100389056 | 3300006844 | Bacteria | 1495 |
| 187 | Ga0075430_100000006 | 3300006846 | Bacteria | 103592 |
| 188 | Ga0075430_100008278 | 3300006846 | Bacteria | 8782 |
| 189 | Ga0075430_100034169 | 3300006846 | Bacteria | 4315 |
| 190 | Ga0075431_100026174 | 3300006847 | Bacteria | 5984 |
| 191 | Ga0075431_100066569 | 3300006847 | Bacteria | 3719 |
| 192 | Ga0075431_100316811 | 3300006847 | Bacteria | 1573 |
| 193 | Ga0075433_10000072 | 3300006852 | Bacteria | 45390 |
| 194 | Ga0075433_10050916 | 3300006852 | Bacteria | 3606 |
| 195 | Ga0075433_10158706 | 3300006852 | Bacteria | 2013 |
| 196 | Ga0075434_100000756 | 3300006871 | Bacteria | 25483 |
| 197 | Ga0075434_100001819 | 3300006871 | Bacteria | 18406 |
| 198 | Ga0075434_100084317 | 3300006871 | Bacteria | 3177 |
| 199 | Ga0075434_100716338 | 3300006871 | Bacteria | 1018 |
| 200 | Ga0075429_100001133 | 3300006880 | Bacteria | 21502 |
| 201 | Ga0068865_100000355 | 3300006881 | Bacteria | 25325 |
| 202 | Ga0068865_100139673 | 3300006881 | Bacteria | 1825 |
| 203 | Ga0075436_100008407 | 3300006914 | Bacteria | 7058 |
| 204 | Ga0075436_100065193 | 3300006914 | Bacteria | 2518 |
| 205 | Ga0097620_100002948 | 3300006931 | Bacteria | 17261 |
| 206 | Ga0097620_100153828 | 3300006931 | Bacteria | 2376 |
| 207 | Ga0075435_100096777 | 3300007076 | Bacteria | 2442 |
| 208 | Ga0075435_100171763 | 3300007076 | Bacteria | 1829 |
| 209 | Ga0099795_10002070 | 3300007788 | Bacteria | 4606 |
| 210 | Ga0105250_10020383 | 3300009092 | Bacteria | 2680 |
| 211 | Ga0105240_10011929 | 3300009093 | Bacteria | 12050 |
| 212 | Ga0105240_10035122 | 3300009093 | Bacteria | 6464 |
| 213 | Ga0105240_10079667 | 3300009093 | Bacteria | 4030 |
| 214 | Ga0105240_10488059 | 3300009093 | Bacteria | 1372 |
| 215 | Ga0105240_10564559 | 3300009093 | Bacteria | 1257 |
| 216 | Ga0111539_10001688 | 3300009094 | Bacteria | 29450 |
| 217 | Ga0111539_10002781 | 3300009094 | Bacteria | 23232 |
| 218 | Ga0111539_10135968 | 3300009094 | Bacteria | 2878 |
| 219 | Ga0111539_10241105 | 3300009094 | Bacteria | 2105 |
| 220 | Ga0105245_10000409 | 3300009098 | Bacteria | 39920 |
| 221 | Ga0105245_10199203 | 3300009098 | Bacteria | 1922 |
| 222 | Ga0105247_10009989 | 3300009101 | Bacteria | 5748 |
| 223 | Ga0105247_10032107 | 3300009101 | Bacteria | 3189 |
| 224 | Ga0105247_10106695 | 3300009101 | Bacteria | 1797 |
| 225 | Ga0114129_10002643 | 3300009147 | Bacteria | 24932 |
| 226 | Ga0114129_10026034 | 3300009147 | Bacteria | 8283 |
| 227 | Ga0114129_10027930 | 3300009147 | Bacteria | 7990 |
| 228 | Ga0114129_10407405 | 3300009147 | Bacteria | 1791 |
| 229 | Ga0105243_10005740 | 3300009148 | Bacteria | 9637 |
| 230 | Ga0105243_10016932 | 3300009148 | Bacteria | 5512 |
| 231 | Ga0105243_10057268 | 3300009148 | Bacteria | 3103 |
| 232 | Ga0105241_10000053 | 3300009174 | Bacteria | 94578 |
| 233 | Ga0105242_10001586 | 3300009176 | Bacteria | 17880 |
| 234 | Ga0105242_10004359 | 3300009176 | Bacteria | 11011 |
| 235 | Ga0105242_10594591 | 3300009176 | Unclassified | 1068 |
| 236 | Ga0105248_10000309 | 3300009177 | Bacteria | 58008 |
| 237 | Ga0105248_10005691 | 3300009177 | Bacteria | 13695 |
| 238 | Ga0105237_10005630 | 3300009545 | Bacteria | 14111 |
| 239 | Ga0105237_10069335 | 3300009545 | Bacteria | 3521 |
| 240 | Ga0105238_10034257 | 3300009551 | Bacteria | 5167 |
| 241 | Ga0105238_10036638 | 3300009551 | Bacteria | 4988 |
| 242 | Ga0105238_10073165 | 3300009551 | Bacteria | 3422 |
| 243 | Ga0105249_10003451 | 3300009553 | Bacteria | 13696 |
| 244 | Ga0105249_10069622 | 3300009553 | Bacteria | 3247 |
| 245 | Ga0105249_10451484 | 3300009553 | Bacteria | 1324 |
| 246 | Ga0099796_10000271 | 3300010159 | Bacteria | 8194 |
| 247 | Ga0105239_10007939 | 3300010375 | Bacteria | 12129 |
| 248 | Ga0105246_10002040 | 3300011119 | Bacteria | 12194 |
| 249 | Ga0105246_10020203 | 3300011119 | Bacteria | 4271 |
| 250 | Ga0105246_10056119 | 3300011119 | Bacteria | 2721 |
| 251 | Ga0157326_1002526 | 3300012513 | Bacteria | 1953 |
| 252 | Ga0157373_10111448 | 3300013100 | Bacteria | 1924 |
| 253 | Ga0157373_10151823 | 3300013100 | Bacteria | 1629 |
| 254 | Ga0157371_10006362 | 3300013102 | Bacteria | 9768 |
| 255 | Ga0157370_10052583 | 3300013104 | Bacteria | 3888 |
| 256 | Ga0157370_10083529 | 3300013104 | Bacteria | 3002 |
| 257 | Ga0157370_10324210 | 3300013104 | Bacteria | 1420 |
| 258 | Ga0157369_10138350 | 3300013105 | Bacteria | 2577 |
| 259 | Ga0157374_10000452 | 3300013296 | Bacteria | 37355 |
| 260 | Ga0157378_10006920 | 3300013297 | Bacteria | 9903 |
| 261 | Ga0157378_10090405 | 3300013297 | Bacteria | 2782 |
| 262 | Ga0163162_10000796 | 3300013306 | Bacteria | 29342 |
| 263 | Ga0157372_10103618 | 3300013307 | Bacteria | 3251 |
| 264 | Ga0157372_10223771 | 3300013307 | Bacteria | 2181 |
| 265 | Ga0157372_10350520 | 3300013307 | Bacteria | 1720 |
| 266 | Ga0157375_10004563 | 3300013308 | Bacteria | 12034 |
| 267 | Ga0157375_10109964 | 3300013308 | Unclassified | 2853 |
| 268 | Ga0163163_10001104 | 3300014325 | Bacteria | 22905 |
| 269 | Ga0163163_10011726 | 3300014325 | Bacteria | 7963 |
| 270 | Ga0157380_10011668 | 3300014326 | Bacteria | 6353 |
| 271 | Ga0157380_10343125 | 3300014326 | Bacteria | 1394 |
| 272 | Ga0157377_10000538 | 3300014745 | Bacteria | 16011 |
| 273 | Ga0157379_10014950 | 3300014968 | Bacteria | 6807 |
| 274 | Ga0157379_10052646 | 3300014968 | Bacteria | 3636 |
| 275 | Ga0157379_10054659 | 3300014968 | Bacteria | 3568 |
| 276 | Ga0157376_10002295 | 3300014969 | Bacteria | 12921 |
| 277 | Ga0157376_10075778 | 3300014969 | Bacteria | 2872 |
| 278 | Ga0163161_10000499 | 3300017792 | Bacteria | 32280 |
| 279 | Ga0163161_10031075 | 3300017792 | Bacteria | 3803 |
| 280 | Ga0163161_10044297 | 3300017792 | Bacteria | 3205 |
| 281 | Ga0224572_1007664 | 3300024225 | Bacteria | 1981 |
| 282 | Ga0207666_1000214 | 3300025271 | Bacteria | 8607 |
| 283 | Ga0207673_1000709 | 3300025290 | Bacteria | 3564 |
| 284 | Ga0209758_1002068 | 3300025297 | Bacteria | 21433 |
| 285 | Ga0207697_10000252 | 3300025315 | Bacteria | 29548 |
| 286 | Ga0207696_1028499 | 3300025711 | Bacteria | 1712 |
| 287 | Ga0207713_1040532 | 3300025735 | Bacteria | 1953 |
| 288 | Ga0207653_10009760 | 3300025885 | Bacteria | 2993 |
| 289 | Ga0207682_10000029 | 3300025893 | Bacteria | 57930 |
| 290 | Ga0207692_10036813 | 3300025898 | Bacteria | 2389 |
| 291 | Ga0207692_10121642 | 3300025898 | Unclassified | 1462 |
| 292 | Ga0207692_10169707 | 3300025898 | Bacteria | 1264 |
| 293 | Ga0207642_10000713 | 3300025899 | Bacteria | 10287 |
| 294 | Ga0207710_10002958 | 3300025900 | Bacteria | 7692 |
| 295 | Ga0207710_10017381 | 3300025900 | Bacteria | 3050 |
| 296 | Ga0207688_10000020 | 3300025901 | Bacteria | 51200 |
| 297 | Ga0207680_10016808 | 3300025903 | Bacteria | 3851 |
| 298 | Ga0207647_10004529 | 3300025904 | Bacteria | 10300 |
| 299 | Ga0207685_10035152 | 3300025905 | Bacteria | 1826 |
| 300 | Ga0207699_10014685 | 3300025906 | Bacteria | 4046 |
| 301 | Ga0207699_10087595 | 3300025906 | Bacteria | 1947 |
| 302 | Ga0207645_10000108 | 3300025907 | Bacteria | 61630 |
| 303 | Ga0207645_10013858 | 3300025907 | Bacteria | 5410 |
| 304 | Ga0207643_10000044 | 3300025908 | Bacteria | 82217 |
| 305 | Ga0207705_10003898 | 3300025909 | Bacteria | 11350 |
| 306 | Ga0207705_10019149 | 3300025909 | Bacteria | 4896 |
| 307 | Ga0207654_10000143 | 3300025911 | Bacteria | 45654 |
| 308 | Ga0207707_10002475 | 3300025912 | Bacteria | 16630 |
| 309 | Ga0207707_10025926 | 3300025912 | Bacteria | 5126 |
| 310 | Ga0207707_10059362 | 3300025912 | Bacteria | 3328 |
| 311 | Ga0207707_10061972 | 3300025912 | Bacteria | 3254 |
| 312 | Ga0207707_10098330 | 3300025912 | Bacteria | 2558 |
| 313 | Ga0207707_10223325 | 3300025912 | Bacteria | 1640 |
| 314 | Ga0207695_10049621 | 3300025913 | Bacteria | 4422 |
| 315 | Ga0207695_10242068 | 3300025913 | Bacteria | 1705 |
| 316 | Ga0207695_10335084 | 3300025913 | Bacteria | 1401 |
| 317 | Ga0207671_10055301 | 3300025914 | Bacteria | 2941 |
| 318 | Ga0207671_10068359 | 3300025914 | Bacteria | 2647 |
| 319 | Ga0207693_10000831 | 3300025915 | Bacteria | 27450 |
| 320 | Ga0207693_10013903 | 3300025915 | Bacteria | 6482 |
| 321 | Ga0207693_10202602 | 3300025915 | Bacteria | 1560 |
| 322 | Ga0207693_10212051 | 3300025915 | Bacteria | 1522 |
| 323 | Ga0207663_10038034 | 3300025916 | Bacteria | 2905 |
| 324 | Ga0207663_10048191 | 3300025916 | Bacteria | 2636 |
| 325 | Ga0207663_10139926 | 3300025916 | Bacteria | 1684 |
| 326 | Ga0207663_10228913 | 3300025916 | Bacteria | 1357 |
| 327 | Ga0207660_10000543 | 3300025917 | Bacteria | 25357 |
| 328 | Ga0207660_10034302 | 3300025917 | Bacteria | 3516 |
| 329 | Ga0207660_10063418 | 3300025917 | Bacteria | 2664 |
| 330 | Ga0207660_10132428 | 3300025917 | Bacteria | 1899 |
| 331 | Ga0207662_10000104 | 3300025918 | Bacteria | 40365 |
| 332 | Ga0207657_10001453 | 3300025919 | Bacteria | 25334 |
| 333 | Ga0207657_10026514 | 3300025919 | Bacteria | 5324 |
| 334 | Ga0207657_10072420 | 3300025919 | Bacteria | 2915 |
| 335 | Ga0207649_10000057 | 3300025920 | Bacteria | 102314 |
| 336 | Ga0207652_10000916 | 3300025921 | Bacteria | 27831 |
| 337 | Ga0207652_10003429 | 3300025921 | Bacteria | 13085 |
| 338 | Ga0207652_10054911 | 3300025921 | Bacteria | 3425 |
| 339 | Ga0207652_10079222 | 3300025921 | Bacteria | 2870 |
| 340 | Ga0207652_10467625 | 3300025921 | Bacteria | 1136 |
| 341 | Ga0207681_10000154 | 3300025923 | Bacteria | 57555 |
| 342 | Ga0207694_10021575 | 3300025924 | Bacteria | 4880 |
| 343 | Ga0207650_10001534 | 3300025925 | Bacteria | 16557 |
| 344 | Ga0207650_10056507 | 3300025925 | Bacteria | 2916 |
| 345 | Ga0207659_10000028 | 3300025926 | Bacteria | 130804 |
| 346 | Ga0207687_10000061 | 3300025927 | Bacteria | 84113 |
| 347 | Ga0207687_10046165 | 3300025927 | Bacteria | 3015 |
| 348 | Ga0207700_10040958 | 3300025928 | Bacteria | 3385 |
| 349 | Ga0207700_10409139 | 3300025928 | Bacteria | 1190 |
| 350 | Ga0207664_10021268 | 3300025929 | Bacteria | 4820 |
| 351 | Ga0207644_10000194 | 3300025931 | Bacteria | 43567 |
| 352 | Ga0207690_10000225 | 3300025932 | Bacteria | 42706 |
| 353 | Ga0207706_10001293 | 3300025933 | Bacteria | 25199 |
| 354 | Ga0207706_10005469 | 3300025933 | Bacteria | 11844 |
| 355 | Ga0207706_10073685 | 3300025933 | Bacteria | 3003 |
| 356 | Ga0207686_10000530 | 3300025934 | Bacteria | 24694 |
| 357 | Ga0207686_10348480 | 3300025934 | Unclassified | 1114 |
| 358 | Ga0207709_10000291 | 3300025935 | Bacteria | 56621 |
| 359 | Ga0207709_10023592 | 3300025935 | Bacteria | 3503 |
| 360 | Ga0207709_10148386 | 3300025935 | Unclassified | 1621 |
| 361 | Ga0207669_10000019 | 3300025937 | Bacteria | 111630 |
| 362 | Ga0207704_10000438 | 3300025938 | Bacteria | 18608 |
| 363 | Ga0207665_10001846 | 3300025939 | Bacteria | 14257 |
| 364 | Ga0207665_10113391 | 3300025939 | Bacteria | 1907 |
| 365 | Ga0207691_10001047 | 3300025940 | Bacteria | 27463 |
| 366 | Ga0207711_10007089 | 3300025941 | Bacteria | 9389 |
| 367 | Ga0207689_10015750 | 3300025942 | Bacteria | 6403 |
| 368 | Ga0207661_10000126 | 3300025944 | Bacteria | 48665 |
| 369 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 370 | Ga0207679_10086651 | 3300025945 | Bacteria | 2410 |
| 371 | Ga0207679_10112071 | 3300025945 | Bacteria | 2155 |
| 372 | Ga0207679_10131573 | 3300025945 | Bacteria | 2008 |
| 373 | Ga0207679_10238480 | 3300025945 | Unclassified | 1539 |
| 374 | Ga0207679_10331066 | 3300025945 | Bacteria | 1322 |
| 375 | Ga0207667_10061340 | 3300025949 | Bacteria | 3933 |
| 376 | Ga0207667_10074595 | 3300025949 | Bacteria | 3523 |
| 377 | Ga0207667_10082366 | 3300025949 | Bacteria | 3333 |
| 378 | Ga0207651_10048815 | 3300025960 | Unclassified | 2864 |
| 379 | Ga0207712_10206909 | 3300025961 | Bacteria | 1560 |
| 380 | Ga0207668_10000049 | 3300025972 | Bacteria | 99391 |
| 381 | Ga0207640_10014520 | 3300025981 | Bacteria | 4538 |
| 382 | Ga0207658_10001093 | 3300025986 | Bacteria | 21888 |
| 383 | Ga0207658_10033212 | 3300025986 | Bacteria | 3679 |
| 384 | Ga0207677_10000229 | 3300026023 | Bacteria | 44154 |
| 385 | Ga0207677_10192346 | 3300026023 | Bacteria | 1615 |
| 386 | Ga0207703_10000780 | 3300026035 | Bacteria | 31340 |
| 387 | Ga0207703_10016660 | 3300026035 | Bacteria | 5732 |
| 388 | Ga0207703_10129175 | 3300026035 | Bacteria | 2180 |
| 389 | Ga0207639_10002735 | 3300026041 | Bacteria | 11838 |
| 390 | Ga0207639_10062341 | 3300026041 | Bacteria | 2883 |
| 391 | Ga0207639_10425821 | 3300026041 | Unclassified | 1201 |
| 392 | Ga0207678_10000403 | 3300026067 | Bacteria | 39172 |
| 393 | Ga0207678_10025638 | 3300026067 | Bacteria | 5146 |
| 394 | Ga0207708_10000669 | 3300026075 | Bacteria | 26302 |
| 395 | Ga0207708_10122623 | 3300026075 | Bacteria | 2026 |
| 396 | Ga0207702_10006536 | 3300026078 | Bacteria | 10027 |
| 397 | Ga0207702_10105775 | 3300026078 | Bacteria | 2493 |
| 398 | Ga0207641_10000542 | 3300026088 | Bacteria | 42352 |
| 399 | Ga0207648_10001244 | 3300026089 | Bacteria | 28553 |
| 400 | Ga0207648_10046575 | 3300026089 | Bacteria | 3803 |
| 401 | Ga0207676_10000672 | 3300026095 | Bacteria | 27349 |
| 402 | Ga0207676_10023535 | 3300026095 | Bacteria | 4546 |
| 403 | Ga0207676_10237431 | 3300026095 | Bacteria | 1633 |
| 404 | Ga0207674_10001968 | 3300026116 | Bacteria | 26001 |
| 405 | Ga0207674_10344210 | 3300026116 | Bacteria | 1441 |
| 406 | Ga0207675_100001274 | 3300026118 | Bacteria | 25219 |
| 407 | Ga0207675_100281680 | 3300026118 | Unclassified | 1615 |
| 408 | Ga0207683_10000034 | 3300026121 | Bacteria | 101817 |
| 409 | Ga0207683_10000880 | 3300026121 | Bacteria | 27550 |
| 410 | Ga0207683_10056924 | 3300026121 | Bacteria | 3431 |
| 411 | Ga0207683_10161311 | 3300026121 | Bacteria | 2027 |
| 412 | Ga0207698_10001780 | 3300026142 | Bacteria | 12577 |
| 413 | Ga0207698_10299548 | 3300026142 | Bacteria | 1496 |
| 414 | Ga0209973_1001377 | 3300027252 | Bacteria | 2119 |
| 415 | Ga0209967_1004729 | 3300027364 | Bacteria | 1816 |
| 416 | Ga0209983_1009493 | 3300027665 | Bacteria | 1990 |
| 417 | Ga0209971_1006197 | 3300027682 | Bacteria | 2832 |
| 418 | Ga0209971_1029894 | 3300027682 | Bacteria | 1305 |
| 419 | Ga0209966_1001368 | 3300027695 | Bacteria | 4266 |
| 420 | Ga0209966_1003718 | 3300027695 | Bacteria | 2576 |
| 421 | Ga0209998_10000899 | 3300027717 | Bacteria | 7635 |
| 422 | Ga0209998_10004893 | 3300027717 | Bacteria | 2819 |
| 423 | Ga0209813_10068327 | 3300027866 | Bacteria | 1150 |
| 424 | Ga0209974_10000698 | 3300027876 | Bacteria | 11446 |
| 425 | Ga0207428_10000082 | 3300027907 | Bacteria | 133684 |
| 426 | Ga0207428_10000130 | 3300027907 | Bacteria | 104457 |
| 427 | Ga0207428_10000701 | 3300027907 | Bacteria | 38862 |
| 428 | Ga0207428_10125640 | 3300027907 | Bacteria | 1965 |
| 429 | Ga0268266_10055440 | 3300028379 | Bacteria | 3407 |
| 430 | Ga0268266_10233963 | 3300028379 | Unclassified | 1693 |
| 431 | Ga0268265_10000410 | 3300028380 | Bacteria | 45939 |
| 432 | Ga0268265_10070504 | 3300028380 | Bacteria | 2718 |
| 433 | Ga0268264_10047713 | 3300028381 | Bacteria | 3560 |
| 434 | Ga0268264_10211197 | 3300028381 | Bacteria | 1782 |
| 435 | Ga0265337_1002200 | 3300028556 | Bacteria | 9090 |
| 436 | Ga0265338_10012066 | 3300028800 | Bacteria | 9882 |
| 437 | Ga0265338_10037538 | 3300028800 | Bacteria | 4608 |
| 438 | Ga0265338_10064827 | 3300028800 | Bacteria | 3174 |
| 439 | Ga0265338_10125989 | 3300028800 | Bacteria | 2032 |
| 440 | Ga0265338_10174362 | 3300028800 | Bacteria | 1645 |
| 441 | Ga0265760_10029698 | 3300031090 | Bacteria | 1608 |
| 442 | Ga0265332_10001889 | 3300031238 | Bacteria | 11112 |
| 443 | Ga0265320_10017995 | 3300031240 | Bacteria | 3904 |
| 444 | Ga0265325_10000011 | 3300031241 | Bacteria | 150631 |
| 445 | Ga0265325_10003321 | 3300031241 | Bacteria | 10578 |
| 446 | Ga0265325_10004383 | 3300031241 | Bacteria | 8929 |
| 447 | Ga0265325_10011637 | 3300031241 | Bacteria | 5053 |
| 448 | Ga0265325_10116311 | 3300031241 | Bacteria | 1294 |
| 449 | Ga0265329_10013032 | 3300031242 | Bacteria | 2974 |
| 450 | Ga0265340_10054151 | 3300031247 | Bacteria | 1935 |
| 451 | Ga0265340_10085969 | 3300031247 | Bacteria | 1475 |
| 452 | Ga0265339_10000126 | 3300031249 | Bacteria | 63942 |
| 453 | Ga0265339_10004269 | 3300031249 | Bacteria | 9771 |
| 454 | Ga0265339_10012362 | 3300031249 | Bacteria | 5216 |
| 455 | Ga0265339_10042013 | 3300031249 | Bacteria | 2533 |
| 456 | Ga0265331_10012691 | 3300031250 | Bacteria | 4554 |
| 457 | Ga0265331_10026975 | 3300031250 | Bacteria | 2883 |
| 458 | Ga0265331_10032880 | 3300031250 | Bacteria | 2567 |
| 459 | Ga0265316_10149939 | 3300031344 | Bacteria | 1747 |
| 460 | Ga0265313_10000229 | 3300031595 | Bacteria | 60627 |
| 461 | Ga0265313_10000844 | 3300031595 | Bacteria | 30856 |
| 462 | Ga0265313_10002765 | 3300031595 | Bacteria | 14796 |
| 463 | Ga0265313_10007706 | 3300031595 | Bacteria | 7293 |
| 464 | Ga0265313_10019159 | 3300031595 | Bacteria | 3820 |
| 465 | Ga0265313_10029774 | 3300031595 | Bacteria | 2819 |
| 466 | Ga0265313_10039013 | 3300031595 | Bacteria | 2360 |
| 467 | Ga0265314_10005927 | 3300031711 | Bacteria | 10928 |
| 468 | Ga0265314_10023751 | 3300031711 | Bacteria | 4666 |
| 469 | Ga0265314_10072504 | 3300031711 | Bacteria | 2300 |
| 470 | Ga0265342_10000034 | 3300031712 | Bacteria | 145074 |
| 471 | Ga0265342_10000912 | 3300031712 | Bacteria | 29335 |
| 472 | Ga0265342_10007941 | 3300031712 | Bacteria | 7697 |
| 473 | Ga0265342_10014143 | 3300031712 | Bacteria | 5309 |
| 474 | Ga0265342_10015093 | 3300031712 | Bacteria | 5096 |
| 475 | Ga0307409_100245549 | 3300031995 | Unclassified | 1633 |
| 476 | Ga0316583_10001418 | 3300032133 | Bacteria | 7980 |
| 477 | Ga0373930_0009859 | 3300034816 | Bacteria | 1697 |
| 478 | Ga0373948_0005133 | 3300034817 | Bacteria | 2105 |
| 479 | Ga0373950_0001937 | 3300034818 | Bacteria | 2791 |
| 480 | Ga0373950_0003659 | 3300034818 | Bacteria | 2212 |
| 481 | Ga0373958_0009944 | 3300034819 | Bacteria | 1576 |
| 482 | Ga0373959_0000655 | 3300034820 | Bacteria | 5950 |
| 483 | Ga0373938_0006040 | 3300034957 | Bacteria | 2077 |
| 484 | Ga0373928_0005065 | 3300035084 | Bacteria | 2511 |
| 485 | Ga0373929_0000658 | 3300035085 | Bacteria | 6649 |
| 486 | Ga0373934_0016930 | 3300035086 | Bacteria | 2776 |
| 487 | Ga0373940_0001526 | 3300035088 | Bacteria | 4221 |
| 488 | Ga0373944_0019216 | 3300035089 | Bacteria | 1959 |
| 489 | Ga0373949_0001017 | 3300035090 | Bacteria | 8644 |
| 490 | Ga0373949_0001292 | 3300035090 | Bacteria | 7292 |
| 491 | Ga0373951_0002056 | 3300035091 | Bacteria | 5154 |
| 492 | Ga0373951_0003873 | 3300035091 | Unclassified | 3596 |
| 493 | Ga0373952_0000144 | 3300035092 | Bacteria | 10452 |
| 494 | Ga0373952_0000281 | 3300035092 | Bacteria | 8425 |
| 495 | Ga0373923_0001046 | 3300035111 | Bacteria | 7565 |
| 496 | Ga0373932_0002464 | 3300035112 | Bacteria | 4673 |
| 497 | Ga0373936_0022240 | 3300035113 | Bacteria | 2469 |
| 498 | Ga0373936_0034754 | 3300035113 | Bacteria | 2004 |
| 499 | Ga0373936_0062816 | 3300035113 | Bacteria | 1519 |
| 500 | Ga0373939_0000683 | 3300035114 | Bacteria | 8411 |
| 501 | Ga0373941_0001013 | 3300035115 | Bacteria | 5839 |
| 502 | Ga0373945_0000920 | 3300035116 | Bacteria | 8741 |
| 503 | Ga0373945_0027656 | 3300035116 | Bacteria | 1982 |
| 504 | Ga0373953_0010000 | 3300035117 | Bacteria | 3288 |
| 505 | Ga0373953_0012506 | 3300035117 | Bacteria | 3008 |
| 506 | Ga0373954_0002745 | 3300035118 | Bacteria | 7410 |
| 507 | Ga0373956_0045122 | 3300035119 | Bacteria | 1966 |
| 508 | Ga0373956_0076282 | 3300035119 | Unclassified | 1534 |
| 509 | Ga0373957_0033236 | 3300035120 | Bacteria | 1905 |
| 510 | Ga0373960_0002351 | 3300035121 | Bacteria | 4249 |
| 511 | Ga0373943_0009555 | 3300035170 | Bacteria | 4348 |
| 512 | Ga0373946_0007038 | 3300035171 | Bacteria | 4102 |
| 513 | Ga0373946_0041336 | 3300035171 | Bacteria | 1890 |
| 514 | Ga0373955_0000056 | 3300035172 | Bacteria | 44375 |
| 515 | Ga0373955_0000744 | 3300035172 | Bacteria | 14004 |
| 516 | Ga0373955_0002809 | 3300035172 | Bacteria | 7652 |
| 517 | Ga0373955_0027811 | 3300035172 | Unclassified | 2928 |
| 518 | Ga0373942_0000425 | 3300035207 | Bacteria | 11867 |
| 519 | Ga0373961_0001258 | 3300035241 | Bacteria | 7742 |
| 520 | Ga0373961_0046999 | 3300035241 | Bacteria | 1267 |
| 521 | Ga0373962_0002220 | 3300035242 | Bacteria | 4639 |
| 522 | Ga0373924_0002988 | 3300035410 | Bacteria | 5754 |
| 523 | Ga0373931_0001019 | 3300035691 | Bacteria | 11824 |
| 524 | Ga0373931_0005216 | 3300035691 | Bacteria | 5993 |
| 525 | Ga0373931_0051425 | 3300035691 | Unclassified | 2194 |
| 526 | Ga0373931_0146419 | 3300035691 | Bacteria | 1373 |
| 527 | Ga0373935_0000102 | 3300035692 | Bacteria | 38295 |
| 528 | Ga0373935_0172706 | 3300035692 | Bacteria | 1479 |
| 529 | Ga0373927_0000676 | 3300035695 | Bacteria | 25964 |
| 530 | Ga0373927_0102440 | 3300035695 | Bacteria | 1862 |
| 531 | Ga0373933_0004846 | 3300035724 | Bacteria | 7350 |
| 532 | Ga0373933_0008943 | 3300035724 | Bacteria | 5462 |
| 533 | Ga0373933_0072568 | 3300035724 | Bacteria | 2097 |
| 534 | Ga0373933_0074080 | 3300035724 | Bacteria | 2075 |
| 535 | Ga0373947_0000139 | 3300035725 | Bacteria | 37679 |
| 536 | Ga0373947_0033535 | 3300035725 | Bacteria | 3032 |
| 537 | Ga0373937_0000041 | 3300036401 | Bacteria | 108866 |
| 538 | Ga0373937_0002444 | 3300036401 | Bacteria | 15436 |
| 539 | Ga0373937_0004304 | 3300036401 | Bacteria | 12068 |
| 540 | Ga0373937_0038071 | 3300036401 | Bacteria | 4384 |
| 541 | Ga0373937_0195906 | 3300036401 | Bacteria | 1899 |
| 542 | Ga0373937_0239559 | 3300036401 | Bacteria | 1709 |
| 543 | Ga0373925_0000048 | 3300037068 | Bacteria | 129615 |
| 544 | Ga0373925_0037002 | 3300037068 | Bacteria | 3602 |
| 545 | Ga0395899_0006309 | 3300037312 | Bacteria | 9176 |
| 546 | Ga0395899_0011575 | 3300037312 | Bacteria | 6753 |
| 547 | Ga0395900_0020934 | 3300037418 | Bacteria | 6683 |
| 548 | Ga0395900_0066824 | 3300037418 | Bacteria | 3695 |
| 549 | Ga0395900_0140664 | 3300037418 | Bacteria | 2471 |
| 550 | Ga0395900_0383535 | 3300037418 | Bacteria | 1373 |
| 551 | Ga0395898_0003040 | 3300037466 | Bacteria | 19011 |
| 552 | Ga0395898_0005216 | 3300037466 | Bacteria | 14048 |
| 553 | Ga0395898_0067469 | 3300037466 | Bacteria | 3463 |
| 554 | Ga0395901_0080085 | 3300038443 | Bacteria | 3409 |
| 555 | Ga0395901_0113519 | 3300038443 | Bacteria | 2845 |
| 556 | Ga0439455_0008113 | 3300042012 | Bacteria | 2243 |
| 557 | Ga0466966_0035259 | 3300044684 | Bacteria | 3233 |
| 558 | Ga0466966_0247600 | 3300044684 | Bacteria | 1074 |
| 559 | Ga0466963_0012826 | 3300044694 | Bacteria | 5134 |
| 560 | Ga0466963_0085438 | 3300044694 | Bacteria | 2142 |
| 561 | Ga0466963_0260918 | 3300044694 | Bacteria | 1216 |
| 562 | Ga0453684_0520997 | 3300044712 | Unclassified | 1313 |
| 563 | Ga0466971_0118592 | 3300044719 | Bacteria | 1224 |
| 564 | Ga0466957_0007351 | 3300044842 | Bacteria | 6227 |
| 565 | Ga0466959_0058230 | 3300045049 | Bacteria | 2814 |
| 566 | Ga0451576_0412103 | 3300045051 | Unclassified | 1417 |
| 567 | Ga0466958_0377851 | 3300045836 | Unclassified | 913 |
| 568 | Ga0466967_0039586 | 3300045976 | Bacteria | 4054 |
| 569 | Ga0495592_0000074 | 3300046454 | Bacteria | 89381 |
| 570 | Ga0495592_0008799 | 3300046454 | Bacteria | 7582 |
| 571 | Ga0495592_0076740 | 3300046454 | Unclassified | 2423 |
| 572 | Ga0495629_0002412 | 3300046459 | Bacteria | 14389 |
| 573 | Ga0495629_0210078 | 3300046459 | Bacteria | 1344 |
| 574 | Ga0495638_0032251 | 3300046460 | Bacteria | 3360 |
| 575 | Ga0495651_0000945 | 3300046462 | Bacteria | 22479 |
| 576 | Ga0495651_0004910 | 3300046462 | Bacteria | 10228 |
| 577 | Ga0495651_0013633 | 3300046462 | Bacteria | 6282 |
| 578 | Ga0495651_0078828 | 3300046462 | Bacteria | 2491 |
| 579 | Ga0495653_0000125 | 3300046463 | Bacteria | 65032 |
| 580 | Ga0495653_0000912 | 3300046463 | Bacteria | 22874 |
| 581 | Ga0495653_0147994 | 3300046463 | Bacteria | 1644 |
| 582 | Ga0495580_0082304 | 3300046472 | Bacteria | 2243 |
| 583 | Ga0495582_0054221 | 3300046473 | Bacteria | 2211 |
| 584 | Ga0495639_0033329 | 3300046475 | Bacteria | 2300 |
| 585 | Ga0495662_0189062 | 3300046476 | Bacteria | 1015 |
| 586 | Ga0495664_0000008 | 3300046477 | Bacteria | 307158 |
| 587 | Ga0495664_0017935 | 3300046477 | Bacteria | 4048 |
| 588 | Ga0495664_0046163 | 3300046477 | Bacteria | 2585 |
| 589 | Ga0495584_0114986 | 3300046491 | Bacteria | 1362 |
| 590 | Ga0495608_0000014 | 3300046511 | Bacteria | 221042 |
| 591 | Ga0495608_0017211 | 3300046511 | Bacteria | 5002 |
| 592 | Ga0495608_0021587 | 3300046511 | Bacteria | 4419 |
| 593 | Ga0495608_0033484 | 3300046511 | Bacteria | 3472 |
| 594 | Ga0495608_0154470 | 3300046511 | Bacteria | 1461 |
| 595 | Ga0495618_0000013 | 3300046514 | Bacteria | 168671 |
| 596 | Ga0495618_0072511 | 3300046514 | Bacteria | 2191 |
| 597 | Ga0495628_0000008 | 3300046516 | Bacteria | 284313 |
| 598 | Ga0495628_0001948 | 3300046516 | Bacteria | 18722 |
| 599 | Ga0495628_0006134 | 3300046516 | Bacteria | 10513 |
| 600 | Ga0495630_0000300 | 3300046517 | Bacteria | 39627 |
| 601 | Ga0495630_0133303 | 3300046517 | Bacteria | 1887 |
| 602 | Ga0495632_0108162 | 3300046519 | Bacteria | 1307 |
| 603 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 604 | Ga0495652_0011801 | 3300046529 | Bacteria | 7893 |
| 605 | Ga0495640_0000020 | 3300046533 | Bacteria | 116618 |
| 606 | Ga0495640_0120756 | 3300046533 | Bacteria | 1704 |
| 607 | Ga0495640_0138870 | 3300046533 | Bacteria | 1567 |
| 608 | Ga0495587_0000005 | 3300046536 | Bacteria | 358412 |
| 609 | Ga0495587_0001648 | 3300046536 | Bacteria | 14896 |
| 610 | Ga0495587_0002348 | 3300046536 | Bacteria | 12651 |
| 611 | Ga0495645_0000007 | 3300046543 | Bacteria | 376299 |
| 612 | Ga0495645_0001151 | 3300046543 | Bacteria | 17952 |
| 613 | Ga0495645_0093448 | 3300046543 | Unclassified | 2146 |
| 614 | Ga0495645_0303187 | 3300046543 | Bacteria | 1043 |
| 615 | Ga0495667_0000012 | 3300046559 | Bacteria | 220967 |
| 616 | Ga0495667_0000212 | 3300046559 | Bacteria | 38949 |
| 617 | Ga0495667_0029096 | 3300046559 | Bacteria | 3718 |
| 618 | Ga0495634_0000052 | 3300046642 | Bacteria | 91494 |
| 619 | Ga0495634_0042445 | 3300046642 | Bacteria | 3085 |
| 620 | Ga0495634_0058411 | 3300046642 | Bacteria | 2571 |
| 621 | Ga0495635_0000010 | 3300046663 | Bacteria | 246385 |
| 622 | Ga0495635_0004345 | 3300046663 | Bacteria | 9816 |
| 623 | Ga0495635_0016550 | 3300046663 | Bacteria | 5151 |
| 624 | Ga0495635_0091119 | 3300046663 | Bacteria | 2085 |
| 625 | Ga0495635_0237009 | 3300046663 | Unclassified | 1232 |
| 626 | Ga0495657_0000052 | 3300046675 | Bacteria | 101480 |
| 627 | Ga0495657_0002168 | 3300046675 | Bacteria | 16656 |
| 628 | Ga0495657_0161460 | 3300046675 | Bacteria | 1386 |
| 629 | Ga0495599_0000031 | 3300046678 | Bacteria | 109567 |
| 630 | Ga0495599_0001508 | 3300046678 | Bacteria | 13400 |
| 631 | Ga0495599_0004835 | 3300046678 | Bacteria | 8015 |
| 632 | Ga0495623_0000031 | 3300046679 | Bacteria | 84524 |
| 633 | Ga0495623_0000188 | 3300046679 | Bacteria | 39199 |
| 634 | Ga0495646_0000012 | 3300046680 | Bacteria | 185805 |
| 635 | Ga0495658_0110503 | 3300046683 | Bacteria | 1652 |
| 636 | Ga0495624_0038098 | 3300046690 | Bacteria | 3090 |
| 637 | Ga0495624_0081016 | 3300046690 | Bacteria | 2011 |
| 638 | Ga0495600_0000016 | 3300046809 | Bacteria | 111762 |
| 639 | Ga0495600_0005049 | 3300046809 | Bacteria | 7928 |
| 640 | Ga0495600_0336732 | 3300046809 | Bacteria | 947 |
| 641 | Ga0495581_0001731 | 3300047315 | Bacteria | 12166 |
| 642 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 643 | Ga0495604_0002011 | 3300047317 | Bacteria | 16393 |
| 644 | Ga0495604_0016801 | 3300047317 | Bacteria | 5854 |
| 645 | Ga0495604_0035286 | 3300047317 | Bacteria | 3950 |
| 646 | Ga0495636_0138819 | 3300047318 | Bacteria | 1085 |
| 647 | Ga0495674_0000012 | 3300047319 | Bacteria | 270651 |
| 648 | Ga0495674_0045966 | 3300047319 | Bacteria | 3877 |
| 649 | Ga0495674_0078258 | 3300047319 | Bacteria | 2841 |
| 650 | Ga0495674_0081725 | 3300047319 | Bacteria | 2771 |
| 651 | Ga0495672_0038675 | 3300047320 | Bacteria | 2908 |
| 652 | Ga0495672_0053353 | 3300047320 | Bacteria | 2370 |
| 653 | Ga0495676_0040153 | 3300047321 | Bacteria | 3865 |
| 654 | Ga0495680_0000784 | 3300047322 | Bacteria | 35535 |
| 655 | Ga0495680_0005676 | 3300047322 | Bacteria | 11681 |
| 656 | Ga0495680_0008975 | 3300047322 | Bacteria | 9034 |
| 657 | Ga0495675_0000108 | 3300047444 | Bacteria | 59810 |
| 658 | Ga0495675_0051912 | 3300047444 | Bacteria | 2603 |
| 659 | Ga0495684_0000021 | 3300047471 | Bacteria | 144901 |
| 660 | Ga0495684_0008262 | 3300047471 | Bacteria | 8058 |
| 661 | Ga0495684_0186867 | 3300047471 | Bacteria | 1534 |
| 662 | Ga0495593_0007068 | 3300047673 | Bacteria | 6584 |
| 663 | Ga0495593_0057920 | 3300047673 | Bacteria | 2033 |
| 664 | Ga0495593_0106204 | 3300047673 | Bacteria | 1436 |
| 665 | Ga0495602_0000031 | 3300048088 | Bacteria | 141518 |
| 666 | Ga0495602_0002562 | 3300048088 | Bacteria | 18530 |
| 667 | Ga0495602_0008079 | 3300048088 | Bacteria | 10996 |
| 668 | Ga0496100_0001962 | 3300048903 | Bacteria | 10308 |
| 669 | Ga0496100_0089531 | 3300048903 | Bacteria | 2096 |
| 670 | Ga0496101_0000171 | 3300048904 | Bacteria | 53757 |
| 671 | Ga0496101_0019820 | 3300048904 | Bacteria | 4598 |
| 672 | Ga0496102_0004728 | 3300048905 | Bacteria | 11530 |
| 673 | Ga0496102_0009589 | 3300048905 | Bacteria | 8327 |
| 674 | Ga0496102_0219653 | 3300048905 | Unclassified | 1791 |
| 675 | Ga0496103_0001994 | 3300048906 | Bacteria | 13160 |
| 676 | Ga0496103_0237457 | 3300048906 | Bacteria | 1172 |
| 677 | Ga0496104_0000067 | 3300048907 | Bacteria | 108556 |
| 678 | Ga0496104_0004667 | 3300048907 | Bacteria | 11923 |
| 679 | Ga0496104_0035890 | 3300048907 | Bacteria | 4632 |
| 680 | Ga0496104_0036019 | 3300048907 | Bacteria | 4623 |
| 681 | Ga0496104_0562889 | 3300048907 | Unclassified | 1050 |
| 682 | Ga0496105_0000130 | 3300048908 | Bacteria | 50576 |
| 683 | Ga0496105_0012493 | 3300048908 | Bacteria | 6723 |
| 684 | Ga0496105_0018548 | 3300048908 | Bacteria | 5598 |
| 685 | Ga0496105_0045757 | 3300048908 | Bacteria | 3611 |
| 686 | Ga0496105_0353814 | 3300048908 | Bacteria | 1172 |
| 687 | Ga0496106_0000581 | 3300048909 | Bacteria | 26118 |
| 688 | Ga0496106_0034589 | 3300048909 | Bacteria | 3775 |
| 689 | Ga0496106_0051477 | 3300048909 | Bacteria | 3105 |
| 690 | Ga0496106_0088851 | 3300048909 | Bacteria | 2382 |
| 691 | Ga0496107_0000224 | 3300048910 | Bacteria | 29999 |
| 692 | Ga0496107_0011691 | 3300048910 | Bacteria | 6119 |
| 693 | Ga0496107_0028556 | 3300048910 | Bacteria | 3964 |
| 694 | Ga0496108_0000547 | 3300048911 | Bacteria | 29390 |
| 695 | Ga0496108_0076048 | 3300048911 | Bacteria | 2837 |
| 696 | Ga0496108_0139570 | 3300048911 | Unclassified | 2088 |
| 697 | Ga0496108_0531229 | 3300048911 | Unclassified | 1027 |
| 698 | Ga0496109_0002652 | 3300048912 | Bacteria | 15006 |
| 699 | Ga0496109_0003680 | 3300048912 | Bacteria | 12807 |
| 700 | Ga0496109_0010245 | 3300048912 | Bacteria | 8005 |
| 701 | Ga0496109_0056682 | 3300048912 | Bacteria | 3575 |
| 702 | Ga0496110_0031483 | 3300048913 | Bacteria | 4577 |
| 703 | Ga0496110_0032988 | 3300048913 | Bacteria | 4476 |
| 704 | Ga0496110_0131192 | 3300048913 | Bacteria | 2263 |
| 705 | Ga0496110_0281255 | 3300048913 | Bacteria | 1515 |
| 706 | Ga0496110_0514295 | 3300048913 | Unclassified | 1089 |
| 707 | Ga0496111_0006106 | 3300048914 | Bacteria | 7795 |
| 708 | Ga0496111_0007480 | 3300048914 | Bacteria | 7164 |
| 709 | Ga0496111_0033969 | 3300048914 | Bacteria | 3640 |
| 710 | Ga0496111_0035117 | 3300048914 | Unclassified | 3582 |
| 711 | Ga0496111_0084367 | 3300048914 | Unclassified | 2322 |
| 712 | Ga0496112_0011363 | 3300048915 | Bacteria | 8127 |
| 713 | Ga0496112_0012719 | 3300048915 | Bacteria | 7738 |
| 714 | Ga0496112_0018912 | 3300048915 | Bacteria | 6490 |
| 715 | Ga0496112_0347525 | 3300048915 | Bacteria | 1426 |
| 716 | Ga0496113_0006052 | 3300048916 | Bacteria | 7624 |
| 717 | Ga0496113_0033819 | 3300048916 | Bacteria | 3725 |
| 718 | Ga0496113_0034016 | 3300048916 | Bacteria | 3716 |
| 719 | Ga0496113_0083378 | 3300048916 | Bacteria | 2452 |
| 720 | Ga0496113_0288946 | 3300048916 | Bacteria | 1311 |
| 721 | Ga0496114_0027396 | 3300048917 | Bacteria | 4667 |
| 722 | Ga0496114_0049871 | 3300048917 | Bacteria | 3483 |
| 723 | Ga0496114_0089670 | 3300048917 | Bacteria | 2609 |
| 724 | Ga0496115_0020880 | 3300048918 | Bacteria | 5054 |
| 725 | Ga0496115_0127534 | 3300048918 | Bacteria | 2096 |
| 726 | Ga0496121_0224421 | 3300048924 | Bacteria | 1321 |
| 727 | Ga0496126_0546513 | 3300048929 | Bacteria | 920 |
| 728 | Ga0501031_0007245 | 3300049568 | Bacteria | 7239 |
| 729 | Ga0501031_0218591 | 3300049568 | Bacteria | 1241 |
| 730 | Ga0501032_0010448 | 3300049569 | Bacteria | 6696 |
| 731 | Ga0501032_0021454 | 3300049569 | Bacteria | 4489 |
| 732 | Ga0501033_0009732 | 3300049570 | Bacteria | 7387 |
| 733 | Ga0501034_0020703 | 3300049571 | Bacteria | 6716 |
| 734 | Ga0501034_0021707 | 3300049571 | Bacteria | 6541 |
| 735 | Ga0501034_0146652 | 3300049571 | Bacteria | 2337 |
| 736 | Ga0501034_0271391 | 3300049571 | Bacteria | 1637 |
| 737 | Ga0501036_0004541 | 3300049572 | Bacteria | 11205 |
| 738 | Ga0501036_0345417 | 3300049572 | Bacteria | 1243 |
| 739 | Ga0501037_0059219 | 3300049573 | Bacteria | 2794 |
| 740 | Ga0501037_0113207 | 3300049573 | Bacteria | 1954 |
| 741 | Ga0501038_0011982 | 3300049574 | Bacteria | 7916 |
| 742 | Ga0501038_0085937 | 3300049574 | Bacteria | 2644 |
| 743 | Ga0501039_0007113 | 3300049575 | Bacteria | 8527 |
| 744 | Ga0501039_0017663 | 3300049575 | Bacteria | 5472 |
| 745 | Ga0501043_0119084 | 3300049579 | Bacteria | 2070 |
| 746 | Ga0501043_0130142 | 3300049579 | Bacteria | 1972 |
| 747 | Ga0501046_0005945 | 3300049580 | Bacteria | 10866 |
| 748 | Ga0501047_0013700 | 3300049581 | Bacteria | 7697 |
| 749 | Ga0501047_0037523 | 3300049581 | Bacteria | 4685 |
| 750 | Ga0501047_0062236 | 3300049581 | Bacteria | 3600 |
| 751 | Ga0501047_0069874 | 3300049581 | Bacteria | 3381 |
| 752 | Ga0501047_0117697 | 3300049581 | Bacteria | 2539 |
| 753 | Ga0501047_0142444 | 3300049581 | Bacteria | 2275 |
| 754 | Ga0501069_0002360 | 3300049585 | Bacteria | 9568 |
| 755 | Ga0501069_0007169 | 3300049585 | Bacteria | 5844 |
| 756 | Ga0501069_0030737 | 3300049585 | Bacteria | 2951 |
| 757 | Ga0501070_0001477 | 3300049586 | Bacteria | 21037 |
| 758 | Ga0501070_0013667 | 3300049586 | Bacteria | 6839 |
| 759 | Ga0501070_0027936 | 3300049586 | Bacteria | 4733 |
| 760 | Ga0501070_0214933 | 3300049586 | Bacteria | 1577 |
| 761 | Ga0501071_0053241 | 3300049587 | Bacteria | 2919 |
| 762 | Ga0501072_0001047 | 3300049588 | Bacteria | 20473 |
| 763 | Ga0501072_0001974 | 3300049588 | Bacteria | 15286 |
| 764 | Ga0501072_0214017 | 3300049588 | Bacteria | 1536 |
| 765 | Ga0501074_0026711 | 3300049590 | Bacteria | 4186 |
| 766 | Ga0501079_0019695 | 3300049741 | Bacteria | 5154 |
| 767 | Ga0501079_0107735 | 3300049741 | Bacteria | 2163 |
| 768 | Ga0501079_0246616 | 3300049741 | Bacteria | 1396 |
| 769 | Ga0501080_0038360 | 3300049742 | Bacteria | 4473 |
| 770 | Ga0501080_0230458 | 3300049742 | Bacteria | 1693 |
| 771 | Ga0501083_0012866 | 3300049744 | Bacteria | 5852 |
| 772 | Ga0501083_0018988 | 3300049744 | Bacteria | 4785 |
| 773 | Ga0501083_0091482 | 3300049744 | Bacteria | 2009 |
| 774 | Ga0501035_0005943 | 3300049822 | Bacteria | 11491 |
| 775 | Ga0501035_0182059 | 3300049822 | Bacteria | 1810 |
| 776 | Ga0501044_0001075 | 3300049823 | Bacteria | 32629 |
| 777 | Ga0501044_0050006 | 3300049823 | Bacteria | 4315 |
| 778 | Ga0501044_0074884 | 3300049823 | Bacteria | 3438 |
| 779 | Ga0501044_0091961 | 3300049823 | Bacteria | 3059 |
| 780 | Ga0501044_0117939 | 3300049823 | Bacteria | 2657 |
| 781 | Ga0501044_0126730 | 3300049823 | Bacteria | 2550 |
| 782 | Ga0501044_0212964 | 3300049823 | Bacteria | 1886 |
| 783 | Ga0501044_0404590 | 3300049823 | Bacteria | 1277 |
| 784 | nmdc:mga03n38_124729_c1 | 3300050490 | Bacteria | 1270 |
| 785 | nmdc:mga00v17_24097_c1 | 3300050491 | Bacteria | 3526 |
| 786 | nmdc:mga0k408_104608_c1 | 3300050493 | Bacteria | 1671 |
| 787 | nmdc:mga06z11_22728_c1 | 3300050494 | Bacteria | 2934 |
| 788 | nmdc:mga04h51_99719_c1 | 3300050495 | Bacteria | 1057 |
| 789 | nmdc:mga05p37_19429_c1 | 3300050507 | Bacteria | 8220 |
| 790 | nmdc:mga05p37_57458_c1 | 3300050507 | Bacteria | 4792 |
| 791 | nmdc:mga05p37_651189_c1 | 3300050507 | Bacteria | 1180 |
| 792 | nmdc:mga0qj67_155368_c1 | 3300050509 | Bacteria | 1857 |
| 793 | nmdc:mga0qj67_67_c1 | 3300050509 | Bacteria | 74400 |
| 794 | nmdc:mga0qj67_938_c1 | 3300050509 | Bacteria | 20072 |
| 795 | nmdc:mga06r32_24345_c1 | 3300050510 | Bacteria | 5617 |
| 796 | nmdc:mga06r32_290805_c1 | 3300050510 | Bacteria | 1621 |
| 797 | nmdc:mga06r32_661_c1 | 3300050510 | Bacteria | 30144 |
| 798 | nmdc:mga08y16_135004_c1 | 3300050511 | Bacteria | 2564 |
| 799 | nmdc:mga08y16_20627_c1 | 3300050511 | Bacteria | 6954 |
| 800 | nmdc:mga08y16_208_c1 | 3300050511 | Bacteria | 52742 |
| 801 | nmdc:mga08y16_266745_c1 | 3300050511 | Bacteria | 1768 |
| 802 | nmdc:mga08y16_380385_c1 | 3300050511 | Bacteria | 1447 |
| 803 | nmdc:mga0n895_12771_c1 | 3300050512 | Bacteria | 7543 |
| 804 | nmdc:mga0n895_19194_c1 | 3300050512 | Bacteria | 6348 |
| 805 | nmdc:mga0n895_53296_c1 | 3300050512 | Bacteria | 3974 |
| 806 | nmdc:mga0n895_77003_c1 | 3300050512 | Bacteria | 3317 |
| 807 | nmdc:mga0n895_797_c1 | 3300050512 | Bacteria | 22514 |
| 808 | nmdc:mga0rr50_129066_c1 | 3300050513 | Bacteria | 2022 |
| 809 | nmdc:mga0rr50_19804_c1 | 3300050513 | Bacteria | 4552 |
| 810 | nmdc:mga0rr50_60157_c1 | 3300050513 | Bacteria | 2856 |
| 811 | nmdc:mga0rr50_65568_c1 | 3300050513 | Bacteria | 2751 |
| 812 | nmdc:mga0a205_232480_c1 | 3300050515 | Bacteria | 1726 |
| 813 | nmdc:mga0a205_2345_c1 | 3300050515 | Bacteria | 16707 |
| 814 | Ga0495601_0000011 | 3300053077 | Bacteria | 264937 |
| 815 | Ga0495601_0000237 | 3300053077 | Bacteria | 29469 |
| 816 | Ga0495601_0000293 | 3300053077 | Bacteria | 26739 |
| 817 | Ga0495612_0000006 | 3300053078 | Bacteria | 269278 |
| 818 | Ga0495612_0000275 | 3300053078 | Bacteria | 21187 |
| 819 | Ga0495612_0006268 | 3300053078 | Bacteria | 4900 |
| 820 | Ga0495612_0009610 | 3300053078 | Bacteria | 3916 |
| 821 | Ga0495612_0109193 | 3300053078 | Unclassified | 1183 |
| 822 | Ga0495595_0000055 | 3300053084 | Bacteria | 58901 |
| 823 | Ga0495595_0000379 | 3300053084 | Bacteria | 16834 |
| 824 | Ga0495595_0000730 | 3300053084 | Bacteria | 12469 |
| 825 | Ga0495595_0002027 | 3300053084 | Bacteria | 7865 |
| 826 | Ga0495619_0000013 | 3300053085 | Bacteria | 264865 |
| 827 | Ga0495619_0000259 | 3300053085 | Bacteria | 38593 |
| 828 | Ga0495619_0000343 | 3300053085 | Bacteria | 32522 |
| 829 | Ga0495619_0005586 | 3300053085 | Bacteria | 7979 |
| 830 | Ga0495619_0021933 | 3300053085 | Bacteria | 4082 |
| 831 | Ga0500644_0000752 | 3300053088 | Bacteria | 11186 |
| 832 | Ga0500651_0000859 | 3300053093 | Bacteria | 14881 |
| 833 | Ga0500651_0073213 | 3300053093 | Bacteria | 2130 |
| 834 | Ga0500641_0006534 | 3300053096 | Bacteria | 4135 |
| 835 | Ga0500641_0020611 | 3300053096 | Bacteria | 2504 |
| 836 | Ga0500562_019410 | 3300053108 | Bacteria | 1758 |
| 837 | Ga0500562_056928 | 3300053108 | Bacteria | 1048 |
| 838 | Ga0500593_001364 | 3300053117 | Bacteria | 8791 |
| 839 | Ga0500595_000078 | 3300053119 | Bacteria | 68089 |
| 840 | Ga0500652_021503 | 3300053131 | Bacteria | 2431 |
| 841 | Ga0500658_0022990 | 3300053134 | Bacteria | 2377 |
| 842 | Ga0500577_0020532 | 3300053142 | Bacteria | 2162 |
| 843 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 844 | Ga0500616_0040284 | 3300053153 | Bacteria | 2514 |
| 845 | Ga0500645_000147 | 3300053730 | Bacteria | 54792 |
| 846 | Ga0501084_0056033 | 3300054114 | Bacteria | 3298 |
| 847 | Ga0501084_0122571 | 3300054114 | Bacteria | 2186 |
| 848 | Ga0501082_0001469 | 3300060353 | Bacteria | 20732 |
| 849 | Ga0501082_0149408 | 3300060353 | Bacteria | 2029 |
| 850 | Ga0501082_0199464 | 3300060353 | Bacteria | 1741 |
| 851 | Ga0501082_0235697 | 3300060353 | Bacteria | 1593 |
| 852 | Ga0466962_0132901 | 3300061719 | Bacteria | 1203 |
| 853 | 2643757829 | 2643221547 | Bacteria | 4740017 |
| 854 | Ga0500610_0093299 | |||
| 855 | SwRhRL2b_contig_211530 | |||
| 856 | 2214939638 | |||
| 857 | ARcpr5oldR_c000200 | |||
| 858 | ARSoilYngRDRAFT_c00112 | |||
| 859 | ARcpr5yngRDRAFT_c000099 | |||
| 860 | ARSoilOldRDRAFT_c000057 | |||
| 861 | ARCol0yngRDRAFT_1000002 | |||
| 862 | JGI24752J21851_1000687 | |||
| 863 | JGI24746J21847_1003277 | |||
| 864 | JGI24747J21853_1000005 | |||
| 865 | JGI24740J21852_10023436 | |||
| 866 | JGI24739J22299_10002265 | |||
| 867 | JGI24737J22298_10001491 | |||
| 868 | JGI24737J22298_10007538 | |||
| 869 | JGI24737J22298_10011929 | |||
| 870 | JGI24743J22301_10003125 | |||
| 871 | JGI24735J21928_10059680 | |||
| 872 | JGI24750J21931_1000421 | |||
| 873 | JGI24738J21930_10001595 | |||
| 874 | JGI24744J21845_10000953 | |||
| 875 | JGI24035J26624_1000120 | |||
| 876 | JGI24033J26618_1000561 | |||
| 877 | JGI24034J26672_10005293 | |||
| 878 | JGI24742J22300_10002020 | |||
| 879 | JGI24751J29686_10003524 | |||
| 880 | JGI25404J52841_10003033 | |||
| 881 | Ga0065717_1002163 | |||
| 882 | Ga0065704_10093895 | |||
| 883 | Ga0065712_10000677 | |||
| 884 | Ga0065715_10089460 | |||
| 885 | Ga0065715_10146056 | |||
| 886 | Ga0070658_10001079 | |||
| 887 | Ga0070658_10027129 | |||
| 888 | Ga0070676_10000332 | |||
| 889 | Ga0070683_100004171 | |||
| 890 | Ga0070683_100166798 | |||
| 891 | Ga0070670_100014416 | |||
| 892 | Ga0070670_100079111 | |||
| 893 | Ga0070677_10000258 | |||
| 894 | Ga0068869_100000510 | |||
| 895 | Ga0068869_100093650 | |||
| 896 | Ga0070666_10006735 | |||
| 897 | Ga0070680_100001476 | |||
| 898 | Ga0070680_100014316 | |||
| 899 | Ga0070680_100045368 | |||
| 900 | Ga0070680_100046304 | |||
| 901 | Ga0070680_100149189 | |||
| 902 | Ga0070680_100168351 | |||
| 903 | Ga0070682_100000800 | |||
| 904 | Ga0070682_100040937 | |||
| 905 | Ga0070682_100076282 | |||
| 906 | Ga0068868_100000148 | |||
| 907 | Ga0070660_100001314 | |||
| 908 | Ga0070660_100005629 | |||
| 909 | Ga0070660_100043853 | |||
| 910 | Ga0070660_100051330 | |||
| 911 | Ga0070689_100009190 | |||
| 912 | Ga0070689_100025871 | |||
| 913 | Ga0070689_100041732 | |||
| 914 | Ga0070691_10001528 | |||
| 915 | Ga0070687_100000318 | |||
| 916 | Ga0070661_100000768 | |||
| 917 | Ga0070692_10000347 | |||
| 918 | Ga0070668_100004879 | |||
| 919 | Ga0070675_100001491 | |||
| 920 | Ga0070671_100001416 | |||
| 921 | Ga0070671_100410283 | |||
| 922 | Ga0070674_100001355 | |||
| 923 | Ga0070673_100000670 | |||
| 924 | Ga0070673_100066154 | |||
| 925 | Ga0070688_100001144 | |||
| 926 | Ga0070688_100060334 | |||
| 927 | Ga0070659_100001400 | |||
| 928 | Ga0070659_100045780 | |||
| 929 | Ga0070659_100077702 | |||
| 930 | Ga0070667_100002340 | |||
| 931 | Ga0070667_100009705 | |||
| 932 | Ga0070709_10052829 | |||
| 933 | Ga0070709_10068694 | |||
| 934 | Ga0070714_100058449 | |||
| 935 | Ga0070713_100000838 | |||
| 936 | Ga0070713_100052496 | |||
| 937 | Ga0070713_100139281 | |||
| 938 | Ga0070710_10014664 | |||
| 939 | Ga0070710_10045772 | |||
| 940 | Ga0070710_10162031 | |||
| 941 | Ga0070710_10184638 | |||
| 942 | Ga0070701_10000066 | |||
| 943 | Ga0070711_100020031 | |||
| 944 | Ga0070711_100044002 | |||
| 945 | Ga0070711_100098409 | |||
| 946 | Ga0070711_100267340 | |||
| 947 | Ga0070711_100283973 | |||
| 948 | Ga0070705_100001500 | |||
| 949 | Ga0070663_100292869 | |||
| 950 | Ga0070678_100000391 | |||
| 951 | Ga0070678_100000533 | |||
| 952 | Ga0070662_100001285 | |||
| 953 | Ga0070662_100074764 | |||
| 954 | Ga0070662_100117199 | |||
| 955 | Ga0070681_10002720 | |||
| 956 | Ga0070681_10070625 | |||
| 957 | Ga0070681_10084411 | |||
| 958 | Ga0070681_10140043 | |||
| 959 | Ga0070681_10168379 | |||
| 960 | Ga0070681_10216735 | |||
| 961 | Ga0070681_10233082 | |||
| 962 | Ga0070681_10285042 | |||
| 963 | Ga0068867_100001688 | |||
| 964 | Ga0070685_10000496 | |||
| 965 | Ga0074259_11597102 | |||
| 966 | Ga0070699_100401292 | |||
| 967 | Ga0070679_100007687 | |||
| 968 | Ga0070679_100032306 | |||
| 969 | Ga0070679_100048607 | |||
| 970 | Ga0070679_100130409 | |||
| 971 | Ga0070684_100000101 | |||
| 972 | Ga0068853_100005490 | |||
| 973 | Ga0070672_100000016 | |||
| 974 | Ga0070686_100002195 | |||
| 975 | Ga0070695_100000225 | |||
| 976 | Ga0070695_100109868 | |||
| 977 | Ga0070696_100251546 | |||
| 978 | Ga0070693_100000138 | |||
| 979 | Ga0070693_100139635 | |||
| 980 | Ga0070665_100009456 | |||
| 981 | Ga0068855_100004983 | |||
| 982 | Ga0068855_100008651 | |||
| 983 | Ga0068855_100061527 | |||
| 984 | Ga0068855_100079557 | |||
| 985 | Ga0068855_100103490 | |||
| 986 | Ga0068855_100547901 | |||
| 987 | Ga0070664_100000067 | |||
| 988 | Ga0070664_100042919 | |||
| 989 | Ga0070664_100086949 | |||
| 990 | Ga0070664_100205626 | |||
| 991 | Ga0068857_100000275 | |||
| 992 | Ga0068857_100344642 | |||
| 993 | Ga0068854_100002271 | |||
| 994 | Ga0068856_100001016 | |||
| 995 | Ga0068856_100072079 | |||
| 996 | Ga0068856_100152568 | |||
| 997 | Ga0070702_100000175 | |||
| 998 | Ga0068852_100000611 | |||
| 999 | Ga0068852_100107719 | |||
| 1000 | Ga0068852_100231389 | |||
| 1001 | Ga0068859_100002948 | |||
| 1002 | Ga0068859_100153834 | |||
| 1003 | Ga0068864_100000234 | |||
| 1004 | Ga0068866_10002176 | |||
| 1005 | Ga0068861_100000317 | |||
| 1006 | Ga0068870_10000009 | |||
| 1007 | Ga0068863_100001729 | |||
| 1008 | Ga0068863_100243537 | |||
| 1009 | Ga0068858_100001059 | |||
| 1010 | Ga0068858_100146326 | |||
| 1011 | Ga0068860_100003167 | |||
| 1012 | Ga0068860_100054184 | |||
| 1013 | Ga0068860_100105226 | |||
| 1014 | Ga0068862_100059326 | |||
| 1015 | Ga0081455_10000002 | |||
| 1016 | Ga0081455_10008146 | |||
| 1017 | Ga0081455_10050343 | |||
| 1018 | Ga0081455_10155291 | |||
| 1019 | Ga0081455_10246077 | |||
| 1020 | Ga0081540_1002418 | |||
| 1021 | Ga0081540_1023338 | |||
| 1022 | Ga0081539_10000785 | |||
| 1023 | Ga0070717_10038117 | |||
| 1024 | Ga0075365_10081588 | |||
| 1025 | Ga0075368_10031688 | |||
| 1026 | Ga0075363_100110530 | |||
| 1027 | Ga0070716_100027805 | |||
| 1028 | Ga0070716_100206395 | |||
| 1029 | Ga0075367_10011527 | |||
| 1030 | Ga0075367_10178443 | |||
| 1031 | Ga0075369_10013674 | |||
| 1032 | Ga0097621_100008493 | |||
| 1033 | Ga0097621_100086650 | |||
| 1034 | Ga0097621_100152886 | |||
| 1035 | Ga0068871_100000012 | |||
| 1036 | Ga0068871_100015699 | |||
| 1037 | Ga0068871_100043549 | |||
| 1038 | Ga0075428_100054583 | |||
| 1039 | Ga0075428_100389056 | |||
| 1040 | Ga0075430_100000006 | |||
| 1041 | Ga0075430_100008278 | |||
| 1042 | Ga0075430_100034169 | |||
| 1043 | Ga0075431_100026174 | |||
| 1044 | Ga0075431_100066569 | |||
| 1045 | Ga0075431_100316811 | |||
| 1046 | Ga0075433_10000072 | |||
| 1047 | Ga0075433_10050916 | |||
| 1048 | Ga0075433_10158706 | |||
| 1049 | Ga0075434_100000756 | |||
| 1050 | Ga0075434_100001819 | |||
| 1051 | Ga0075434_100084317 | |||
| 1052 | Ga0075434_100716338 | |||
| 1053 | Ga0075429_100001133 | |||
| 1054 | Ga0068865_100000355 | |||
| 1055 | Ga0068865_100139673 | |||
| 1056 | Ga0075436_100008407 | |||
| 1057 | Ga0075436_100065193 | |||
| 1058 | Ga0097620_100002948 | |||
| 1059 | Ga0097620_100153828 | |||
| 1060 | Ga0075435_100096777 | |||
| 1061 | Ga0075435_100171763 | |||
| 1062 | Ga0099795_10002070 | |||
| 1063 | Ga0105250_10020383 | |||
| 1064 | Ga0105240_10011929 | |||
| 1065 | Ga0105240_10035122 | |||
| 1066 | Ga0105240_10079667 | |||
| 1067 | Ga0105240_10488059 | |||
| 1068 | Ga0105240_10564559 | |||
| 1069 | Ga0111539_10001688 | |||
| 1070 | Ga0111539_10002781 | |||
| 1071 | Ga0111539_10135968 | |||
| 1072 | Ga0111539_10241105 | |||
| 1073 | Ga0105245_10000409 | |||
| 1074 | Ga0105245_10199203 | |||
| 1075 | Ga0105247_10009989 | |||
| 1076 | Ga0105247_10032107 | |||
| 1077 | Ga0105247_10106695 | |||
| 1078 | Ga0114129_10002643 | |||
| 1079 | Ga0114129_10026034 | |||
| 1080 | Ga0114129_10027930 | |||
| 1081 | Ga0114129_10407405 | |||
| 1082 | Ga0105243_10005740 | |||
| 1083 | Ga0105243_10016932 | |||
| 1084 | Ga0105243_10057268 | |||
| 1085 | Ga0105241_10000053 | |||
| 1086 | Ga0105242_10001586 | |||
| 1087 | Ga0105242_10004359 | |||
| 1088 | Ga0105242_10594591 | |||
| 1089 | Ga0105248_10000309 | |||
| 1090 | Ga0105248_10005691 | |||
| 1091 | Ga0105237_10005630 | |||
| 1092 | Ga0105237_10069335 | |||
| 1093 | Ga0105238_10034257 | |||
| 1094 | Ga0105238_10036638 | |||
| 1095 | Ga0105238_10073165 | |||
| 1096 | Ga0105249_10003451 | |||
| 1097 | Ga0105249_10069622 | |||
| 1098 | Ga0105249_10451484 | |||
| 1099 | Ga0099796_10000271 | |||
| 1100 | Ga0105239_10007939 | |||
| 1101 | Ga0105246_10002040 | |||
| 1102 | Ga0105246_10020203 | |||
| 1103 | Ga0105246_10056119 | |||
| 1104 | Ga0157326_1002526 | |||
| 1105 | Ga0157373_10111448 | |||
| 1106 | Ga0157373_10151823 | |||
| 1107 | Ga0157371_10006362 | |||
| 1108 | Ga0157370_10052583 | |||
| 1109 | Ga0157370_10083529 | |||
| 1110 | Ga0157370_10324210 | |||
| 1111 | Ga0157369_10138350 | |||
| 1112 | Ga0157374_10000452 | |||
| 1113 | Ga0157378_10006920 | |||
| 1114 | Ga0157378_10090405 | |||
| 1115 | Ga0163162_10000796 | |||
| 1116 | Ga0157372_10103618 | |||
| 1117 | Ga0157372_10223771 | |||
| 1118 | Ga0157372_10350520 | |||
| 1119 | Ga0157375_10004563 | |||
| 1120 | Ga0157375_10109964 | |||
| 1121 | Ga0163163_10001104 | |||
| 1122 | Ga0163163_10011726 | |||
| 1123 | Ga0157380_10011668 | |||
| 1124 | Ga0157380_10343125 | |||
| 1125 | Ga0157377_10000538 | |||
| 1126 | Ga0157379_10014950 | |||
| 1127 | Ga0157379_10052646 | |||
| 1128 | Ga0157379_10054659 | |||
| 1129 | Ga0157376_10002295 | |||
| 1130 | Ga0157376_10075778 | |||
| 1131 | Ga0163161_10000499 | |||
| 1132 | Ga0163161_10031075 | |||
| 1133 | Ga0163161_10044297 | |||
| 1134 | Ga0224572_1007664 | |||
| 1135 | Ga0207666_1000214 | |||
| 1136 | Ga0207673_1000709 | |||
| 1137 | Ga0209758_1002068 | |||
| 1138 | Ga0207697_10000252 | |||
| 1139 | Ga0207696_1028499 | |||
| 1140 | Ga0207713_1040532 | |||
| 1141 | Ga0207653_10009760 | |||
| 1142 | Ga0207682_10000029 | |||
| 1143 | Ga0207692_10036813 | |||
| 1144 | Ga0207692_10121642 | |||
| 1145 | Ga0207692_10169707 | |||
| 1146 | Ga0207642_10000713 | |||
| 1147 | Ga0207710_10002958 | |||
| 1148 | Ga0207710_10017381 | |||
| 1149 | Ga0207688_10000020 | |||
| 1150 | Ga0207680_10016808 | |||
| 1151 | Ga0207647_10004529 | |||
| 1152 | Ga0207685_10035152 | |||
| 1153 | Ga0207699_10014685 | |||
| 1154 | Ga0207699_10087595 | |||
| 1155 | Ga0207645_10000108 | |||
| 1156 | Ga0207645_10013858 | |||
| 1157 | Ga0207643_10000044 | |||
| 1158 | Ga0207705_10003898 | |||
| 1159 | Ga0207705_10019149 | |||
| 1160 | Ga0207654_10000143 | |||
| 1161 | Ga0207707_10002475 | |||
| 1162 | Ga0207707_10025926 | |||
| 1163 | Ga0207707_10059362 | |||
| 1164 | Ga0207707_10061972 | |||
| 1165 | Ga0207707_10098330 | |||
| 1166 | Ga0207707_10223325 | |||
| 1167 | Ga0207695_10049621 | |||
| 1168 | Ga0207695_10242068 | |||
| 1169 | Ga0207695_10335084 | |||
| 1170 | Ga0207671_10055301 | |||
| 1171 | Ga0207671_10068359 | |||
| 1172 | Ga0207693_10000831 | |||
| 1173 | Ga0207693_10013903 | |||
| 1174 | Ga0207693_10202602 | |||
| 1175 | Ga0207693_10212051 | |||
| 1176 | Ga0207663_10038034 | |||
| 1177 | Ga0207663_10048191 | |||
| 1178 | Ga0207663_10139926 | |||
| 1179 | Ga0207663_10228913 | |||
| 1180 | Ga0207660_10000543 | |||
| 1181 | Ga0207660_10034302 | |||
| 1182 | Ga0207660_10063418 | |||
| 1183 | Ga0207660_10132428 | |||
| 1184 | Ga0207662_10000104 | |||
| 1185 | Ga0207657_10001453 | |||
| 1186 | Ga0207657_10026514 | |||
| 1187 | Ga0207657_10072420 | |||
| 1188 | Ga0207649_10000057 | |||
| 1189 | Ga0207652_10000916 | |||
| 1190 | Ga0207652_10003429 | |||
| 1191 | Ga0207652_10054911 | |||
| 1192 | Ga0207652_10079222 | |||
| 1193 | Ga0207652_10467625 | |||
| 1194 | Ga0207681_10000154 | |||
| 1195 | Ga0207694_10021575 | |||
| 1196 | Ga0207650_10001534 | |||
| 1197 | Ga0207650_10056507 | |||
| 1198 | Ga0207659_10000028 | |||
| 1199 | Ga0207687_10000061 | |||
| 1200 | Ga0207687_10046165 | |||
| 1201 | Ga0207700_10040958 | |||
| 1202 | Ga0207700_10409139 | |||
| 1203 | Ga0207664_10021268 | |||
| 1204 | Ga0207644_10000194 | |||
| 1205 | Ga0207690_10000225 | |||
| 1206 | Ga0207706_10001293 | |||
| 1207 | Ga0207706_10005469 | |||
| 1208 | Ga0207706_10073685 | |||
| 1209 | Ga0207686_10000530 | |||
| 1210 | Ga0207686_10348480 | |||
| 1211 | Ga0207709_10000291 | |||
| 1212 | Ga0207709_10023592 | |||
| 1213 | Ga0207709_10148386 | |||
| 1214 | Ga0207669_10000019 | |||
| 1215 | Ga0207704_10000438 | |||
| 1216 | Ga0207665_10001846 | |||
| 1217 | Ga0207665_10113391 | |||
| 1218 | Ga0207691_10001047 | |||
| 1219 | Ga0207711_10007089 | |||
| 1220 | Ga0207689_10015750 | |||
| 1221 | Ga0207661_10000126 | |||
| 1222 | Ga0207679_10000026 | |||
| 1223 | Ga0207679_10086651 | |||
| 1224 | Ga0207679_10112071 | |||
| 1225 | Ga0207679_10131573 | |||
| 1226 | Ga0207679_10238480 | |||
| 1227 | Ga0207679_10331066 | |||
| 1228 | Ga0207667_10061340 | |||
| 1229 | Ga0207667_10074595 | |||
| 1230 | Ga0207667_10082366 | |||
| 1231 | Ga0207651_10048815 | |||
| 1232 | Ga0207712_10206909 | |||
| 1233 | Ga0207668_10000049 | |||
| 1234 | Ga0207640_10014520 | |||
| 1235 | Ga0207658_10001093 | |||
| 1236 | Ga0207658_10033212 | |||
| 1237 | Ga0207677_10000229 | |||
| 1238 | Ga0207677_10192346 | |||
| 1239 | Ga0207703_10000780 | |||
| 1240 | Ga0207703_10016660 | |||
| 1241 | Ga0207703_10129175 | |||
| 1242 | Ga0207639_10002735 | |||
| 1243 | Ga0207639_10062341 | |||
| 1244 | Ga0207639_10425821 | |||
| 1245 | Ga0207678_10000403 | |||
| 1246 | Ga0207678_10025638 | |||
| 1247 | Ga0207708_10000669 | |||
| 1248 | Ga0207708_10122623 | |||
| 1249 | Ga0207702_10006536 | |||
| 1250 | Ga0207702_10105775 | |||
| 1251 | Ga0207641_10000542 | |||
| 1252 | Ga0207648_10001244 | |||
| 1253 | Ga0207648_10046575 | |||
| 1254 | Ga0207676_10000672 | |||
| 1255 | Ga0207676_10023535 | |||
| 1256 | Ga0207676_10237431 | |||
| 1257 | Ga0207674_10001968 | |||
| 1258 | Ga0207674_10344210 | |||
| 1259 | Ga0207675_100001274 | |||
| 1260 | Ga0207675_100281680 | |||
| 1261 | Ga0207683_10000034 | |||
| 1262 | Ga0207683_10000880 | |||
| 1263 | Ga0207683_10056924 | |||
| 1264 | Ga0207683_10161311 | |||
| 1265 | Ga0207698_10001780 | |||
| 1266 | Ga0207698_10299548 | |||
| 1267 | Ga0209973_1001377 | |||
| 1268 | Ga0209967_1004729 | |||
| 1269 | Ga0209983_1009493 | |||
| 1270 | Ga0209971_1006197 | |||
| 1271 | Ga0209971_1029894 | |||
| 1272 | Ga0209966_1001368 | |||
| 1273 | Ga0209966_1003718 | |||
| 1274 | Ga0209998_10000899 | |||
| 1275 | Ga0209998_10004893 | |||
| 1276 | Ga0209813_10068327 | |||
| 1277 | Ga0209974_10000698 | |||
| 1278 | Ga0207428_10000082 | |||
| 1279 | Ga0207428_10000130 | |||
| 1280 | Ga0207428_10000701 | |||
| 1281 | Ga0207428_10125640 | |||
| 1282 | Ga0268266_10055440 | |||
| 1283 | Ga0268266_10233963 | |||
| 1284 | Ga0268265_10000410 | |||
| 1285 | Ga0268265_10070504 | |||
| 1286 | Ga0268264_10047713 | |||
| 1287 | Ga0268264_10211197 | |||
| 1288 | Ga0265337_1002200 | |||
| 1289 | Ga0265338_10012066 | |||
| 1290 | Ga0265338_10037538 | |||
| 1291 | Ga0265338_10064827 | |||
| 1292 | Ga0265338_10125989 | |||
| 1293 | Ga0265338_10174362 | |||
| 1294 | Ga0265760_10029698 | |||
| 1295 | Ga0265332_10001889 | |||
| 1296 | Ga0265320_10017995 | |||
| 1297 | Ga0265325_10000011 | |||
| 1298 | Ga0265325_10003321 | |||
| 1299 | Ga0265325_10004383 | |||
| 1300 | Ga0265325_10011637 | |||
| 1301 | Ga0265325_10116311 | |||
| 1302 | Ga0265329_10013032 | |||
| 1303 | Ga0265340_10054151 | |||
| 1304 | Ga0265340_10085969 | |||
| 1305 | Ga0265339_10000126 | |||
| 1306 | Ga0265339_10004269 | |||
| 1307 | Ga0265339_10012362 | |||
| 1308 | Ga0265339_10042013 | |||
| 1309 | Ga0265331_10012691 | |||
| 1310 | Ga0265331_10026975 | |||
| 1311 | Ga0265331_10032880 | |||
| 1312 | Ga0265316_10149939 | |||
| 1313 | Ga0265313_10000229 | |||
| 1314 | Ga0265313_10000844 | |||
| 1315 | Ga0265313_10002765 | |||
| 1316 | Ga0265313_10007706 | |||
| 1317 | Ga0265313_10019159 | |||
| 1318 | Ga0265313_10029774 | |||
| 1319 | Ga0265313_10039013 | |||
| 1320 | Ga0265314_10005927 | |||
| 1321 | Ga0265314_10023751 | |||
| 1322 | Ga0265314_10072504 | |||
| 1323 | Ga0265342_10000034 | |||
| 1324 | Ga0265342_10000912 | |||
| 1325 | Ga0265342_10007941 | |||
| 1326 | Ga0265342_10014143 | |||
| 1327 | Ga0265342_10015093 | |||
| 1328 | Ga0307409_100245549 | |||
| 1329 | Ga0316583_10001418 | |||
| 1330 | Ga0373930_0009859 | |||
| 1331 | Ga0373948_0005133 | |||
| 1332 | Ga0373950_0001937 | |||
| 1333 | Ga0373950_0003659 | |||
| 1334 | Ga0373958_0009944 | |||
| 1335 | Ga0373959_0000655 | |||
| 1336 | Ga0373938_0006040 | |||
| 1337 | Ga0373928_0005065 | |||
| 1338 | Ga0373929_0000658 | |||
| 1339 | Ga0373934_0016930 | |||
| 1340 | Ga0373940_0001526 | |||
| 1341 | Ga0373944_0019216 | |||
| 1342 | Ga0373949_0001017 | |||
| 1343 | Ga0373949_0001292 | |||
| 1344 | Ga0373951_0002056 | |||
| 1345 | Ga0373951_0003873 | |||
| 1346 | Ga0373952_0000144 | |||
| 1347 | Ga0373952_0000281 | |||
| 1348 | Ga0373923_0001046 | |||
| 1349 | Ga0373932_0002464 | |||
| 1350 | Ga0373936_0022240 | |||
| 1351 | Ga0373936_0034754 | |||
| 1352 | Ga0373936_0062816 | |||
| 1353 | Ga0373939_0000683 | |||
| 1354 | Ga0373941_0001013 | |||
| 1355 | Ga0373945_0000920 | |||
| 1356 | Ga0373945_0027656 | |||
| 1357 | Ga0373953_0010000 | |||
| 1358 | Ga0373953_0012506 | |||
| 1359 | Ga0373954_0002745 | |||
| 1360 | Ga0373956_0045122 | |||
| 1361 | Ga0373956_0076282 | |||
| 1362 | Ga0373957_0033236 | |||
| 1363 | Ga0373960_0002351 | |||
| 1364 | Ga0373943_0009555 | |||
| 1365 | Ga0373946_0007038 | |||
| 1366 | Ga0373946_0041336 | |||
| 1367 | Ga0373955_0000056 | |||
| 1368 | Ga0373955_0000744 | |||
| 1369 | Ga0373955_0002809 | |||
| 1370 | Ga0373955_0027811 | |||
| 1371 | Ga0373942_0000425 | |||
| 1372 | Ga0373961_0001258 | |||
| 1373 | Ga0373961_0046999 | |||
| 1374 | Ga0373962_0002220 | |||
| 1375 | Ga0373924_0002988 | |||
| 1376 | Ga0373931_0001019 | |||
| 1377 | Ga0373931_0005216 | |||
| 1378 | Ga0373931_0051425 | |||
| 1379 | Ga0373931_0146419 | |||
| 1380 | Ga0373935_0000102 | |||
| 1381 | Ga0373935_0172706 | |||
| 1382 | Ga0373927_0000676 | |||
| 1383 | Ga0373927_0102440 | |||
| 1384 | Ga0373933_0004846 | |||
| 1385 | Ga0373933_0008943 | |||
| 1386 | Ga0373933_0072568 | |||
| 1387 | Ga0373933_0074080 | |||
| 1388 | Ga0373947_0000139 | |||
| 1389 | Ga0373947_0033535 | |||
| 1390 | Ga0373937_0000041 | |||
| 1391 | Ga0373937_0002444 | |||
| 1392 | Ga0373937_0004304 | |||
| 1393 | Ga0373937_0038071 | |||
| 1394 | Ga0373937_0195906 | |||
| 1395 | Ga0373937_0239559 | |||
| 1396 | Ga0373925_0000048 | |||
| 1397 | Ga0373925_0037002 | |||
| 1398 | Ga0395899_0006309 | |||
| 1399 | Ga0395899_0011575 | |||
| 1400 | Ga0395900_0020934 | |||
| 1401 | Ga0395900_0066824 | |||
| 1402 | Ga0395900_0140664 | |||
| 1403 | Ga0395900_0383535 | |||
| 1404 | Ga0395898_0003040 | |||
| 1405 | Ga0395898_0005216 | |||
| 1406 | Ga0395898_0067469 | |||
| 1407 | Ga0395901_0080085 | |||
| 1408 | Ga0395901_0113519 | |||
| 1409 | Ga0439455_0008113 | |||
| 1410 | Ga0466966_0035259 | |||
| 1411 | Ga0466966_0247600 | |||
| 1412 | Ga0466963_0012826 | |||
| 1413 | Ga0466963_0085438 | |||
| 1414 | Ga0466963_0260918 | |||
| 1415 | Ga0453684_0520997 | |||
| 1416 | Ga0466971_0118592 | |||
| 1417 | Ga0466957_0007351 | |||
| 1418 | Ga0466959_0058230 | |||
| 1419 | Ga0451576_0412103 | |||
| 1420 | Ga0466958_0377851 | |||
| 1421 | Ga0466967_0039586 | |||
| 1422 | Ga0495592_0000074 | |||
| 1423 | Ga0495592_0008799 | |||
| 1424 | Ga0495592_0076740 | |||
| 1425 | Ga0495629_0002412 | |||
| 1426 | Ga0495629_0210078 | |||
| 1427 | Ga0495638_0032251 | |||
| 1428 | Ga0495651_0000945 | |||
| 1429 | Ga0495651_0004910 | |||
| 1430 | Ga0495651_0013633 | |||
| 1431 | Ga0495651_0078828 | |||
| 1432 | Ga0495653_0000125 | |||
| 1433 | Ga0495653_0000912 | |||
| 1434 | Ga0495653_0147994 | |||
| 1435 | Ga0495580_0082304 | |||
| 1436 | Ga0495582_0054221 | |||
| 1437 | Ga0495639_0033329 | |||
| 1438 | Ga0495662_0189062 | |||
| 1439 | Ga0495664_0000008 | |||
| 1440 | Ga0495664_0017935 | |||
| 1441 | Ga0495664_0046163 | |||
| 1442 | Ga0495584_0114986 | |||
| 1443 | Ga0495608_0000014 | |||
| 1444 | Ga0495608_0017211 | |||
| 1445 | Ga0495608_0021587 | |||
| 1446 | Ga0495608_0033484 | |||
| 1447 | Ga0495608_0154470 | |||
| 1448 | Ga0495618_0000013 | |||
| 1449 | Ga0495618_0072511 | |||
| 1450 | Ga0495628_0000008 | |||
| 1451 | Ga0495628_0001948 | |||
| 1452 | Ga0495628_0006134 | |||
| 1453 | Ga0495630_0000300 | |||
| 1454 | Ga0495630_0133303 | |||
| 1455 | Ga0495632_0108162 | |||
| 1456 | Ga0495652_0000005 | |||
| 1457 | Ga0495652_0011801 | |||
| 1458 | Ga0495640_0000020 | |||
| 1459 | Ga0495640_0120756 | |||
| 1460 | Ga0495640_0138870 | |||
| 1461 | Ga0495587_0000005 | |||
| 1462 | Ga0495587_0001648 | |||
| 1463 | Ga0495587_0002348 | |||
| 1464 | Ga0495645_0000007 | |||
| 1465 | Ga0495645_0001151 | |||
| 1466 | Ga0495645_0093448 | |||
| 1467 | Ga0495645_0303187 | |||
| 1468 | Ga0495667_0000012 | |||
| 1469 | Ga0495667_0000212 | |||
| 1470 | Ga0495667_0029096 | |||
| 1471 | Ga0495634_0000052 | |||
| 1472 | Ga0495634_0042445 | |||
| 1473 | Ga0495634_0058411 | |||
| 1474 | Ga0495635_0000010 | |||
| 1475 | Ga0495635_0004345 | |||
| 1476 | Ga0495635_0016550 | |||
| 1477 | Ga0495635_0091119 | |||
| 1478 | Ga0495635_0237009 | |||
| 1479 | Ga0495657_0000052 | |||
| 1480 | Ga0495657_0002168 | |||
| 1481 | Ga0495657_0161460 | |||
| 1482 | Ga0495599_0000031 | |||
| 1483 | Ga0495599_0001508 | |||
| 1484 | Ga0495599_0004835 | |||
| 1485 | Ga0495623_0000031 | |||
| 1486 | Ga0495623_0000188 | |||
| 1487 | Ga0495646_0000012 | |||
| 1488 | Ga0495658_0110503 | |||
| 1489 | Ga0495624_0038098 | |||
| 1490 | Ga0495624_0081016 | |||
| 1491 | Ga0495600_0000016 | |||
| 1492 | Ga0495600_0005049 | |||
| 1493 | Ga0495600_0336732 | |||
| 1494 | Ga0495581_0001731 | |||
| 1495 | Ga0495604_0000001 | |||
| 1496 | Ga0495604_0002011 | |||
| 1497 | Ga0495604_0016801 | |||
| 1498 | Ga0495604_0035286 | |||
| 1499 | Ga0495636_0138819 | |||
| 1500 | Ga0495674_0000012 | |||
| 1501 | Ga0495674_0045966 | |||
| 1502 | Ga0495674_0078258 | |||
| 1503 | Ga0495674_0081725 | |||
| 1504 | Ga0495672_0038675 | |||
| 1505 | Ga0495672_0053353 | |||
| 1506 | Ga0495676_0040153 | |||
| 1507 | Ga0495680_0000784 | |||
| 1508 | Ga0495680_0005676 | |||
| 1509 | Ga0495680_0008975 | |||
| 1510 | Ga0495675_0000108 | |||
| 1511 | Ga0495675_0051912 | |||
| 1512 | Ga0495684_0000021 | |||
| 1513 | Ga0495684_0008262 | |||
| 1514 | Ga0495684_0186867 | |||
| 1515 | Ga0495593_0007068 | |||
| 1516 | Ga0495593_0057920 | |||
| 1517 | Ga0495593_0106204 | |||
| 1518 | Ga0495602_0000031 | |||
| 1519 | Ga0495602_0002562 | |||
| 1520 | Ga0495602_0008079 | |||
| 1521 | Ga0496100_0001962 | |||
| 1522 | Ga0496100_0089531 | |||
| 1523 | Ga0496101_0000171 | |||
| 1524 | Ga0496101_0019820 | |||
| 1525 | Ga0496102_0004728 | |||
| 1526 | Ga0496102_0009589 | |||
| 1527 | Ga0496102_0219653 | |||
| 1528 | Ga0496103_0001994 | |||
| 1529 | Ga0496103_0237457 | |||
| 1530 | Ga0496104_0000067 | |||
| 1531 | Ga0496104_0004667 | |||
| 1532 | Ga0496104_0035890 | |||
| 1533 | Ga0496104_0036019 | |||
| 1534 | Ga0496104_0562889 | |||
| 1535 | Ga0496105_0000130 | |||
| 1536 | Ga0496105_0012493 | |||
| 1537 | Ga0496105_0018548 | |||
| 1538 | Ga0496105_0045757 | |||
| 1539 | Ga0496105_0353814 | |||
| 1540 | Ga0496106_0000581 | |||
| 1541 | Ga0496106_0034589 | |||
| 1542 | Ga0496106_0051477 | |||
| 1543 | Ga0496106_0088851 | |||
| 1544 | Ga0496107_0000224 | |||
| 1545 | Ga0496107_0011691 | |||
| 1546 | Ga0496107_0028556 | |||
| 1547 | Ga0496108_0000547 | |||
| 1548 | Ga0496108_0076048 | |||
| 1549 | Ga0496108_0139570 | |||
| 1550 | Ga0496108_0531229 | |||
| 1551 | Ga0496109_0002652 | |||
| 1552 | Ga0496109_0003680 | |||
| 1553 | Ga0496109_0010245 | |||
| 1554 | Ga0496109_0056682 | |||
| 1555 | Ga0496110_0031483 | |||
| 1556 | Ga0496110_0032988 | |||
| 1557 | Ga0496110_0131192 | |||
| 1558 | Ga0496110_0281255 | |||
| 1559 | Ga0496110_0514295 | |||
| 1560 | Ga0496111_0006106 | |||
| 1561 | Ga0496111_0007480 | |||
| 1562 | Ga0496111_0033969 | |||
| 1563 | Ga0496111_0035117 | |||
| 1564 | Ga0496111_0084367 | |||
| 1565 | Ga0496112_0011363 | |||
| 1566 | Ga0496112_0012719 | |||
| 1567 | Ga0496112_0018912 | |||
| 1568 | Ga0496112_0347525 | |||
| 1569 | Ga0496113_0006052 | |||
| 1570 | Ga0496113_0033819 | |||
| 1571 | Ga0496113_0034016 | |||
| 1572 | Ga0496113_0083378 | |||
| 1573 | Ga0496113_0288946 | |||
| 1574 | Ga0496114_0027396 | |||
| 1575 | Ga0496114_0049871 | |||
| 1576 | Ga0496114_0089670 | |||
| 1577 | Ga0496115_0020880 | |||
| 1578 | Ga0496115_0127534 | |||
| 1579 | Ga0496121_0224421 | |||
| 1580 | Ga0496126_0546513 | |||
| 1581 | Ga0501031_0007245 | |||
| 1582 | Ga0501031_0218591 | |||
| 1583 | Ga0501032_0010448 | |||
| 1584 | Ga0501032_0021454 | |||
| 1585 | Ga0501033_0009732 | |||
| 1586 | Ga0501034_0020703 | |||
| 1587 | Ga0501034_0021707 | |||
| 1588 | Ga0501034_0146652 | |||
| 1589 | Ga0501034_0271391 | |||
| 1590 | Ga0501036_0004541 | |||
| 1591 | Ga0501036_0345417 | |||
| 1592 | Ga0501037_0059219 | |||
| 1593 | Ga0501037_0113207 | |||
| 1594 | Ga0501038_0011982 | |||
| 1595 | Ga0501038_0085937 | |||
| 1596 | Ga0501039_0007113 | |||
| 1597 | Ga0501039_0017663 | |||
| 1598 | Ga0501043_0119084 | |||
| 1599 | Ga0501043_0130142 | |||
| 1600 | Ga0501046_0005945 | |||
| 1601 | Ga0501047_0013700 | |||
| 1602 | Ga0501047_0037523 | |||
| 1603 | Ga0501047_0062236 | |||
| 1604 | Ga0501047_0069874 | |||
| 1605 | Ga0501047_0117697 | |||
| 1606 | Ga0501047_0142444 | |||
| 1607 | Ga0501069_0002360 | |||
| 1608 | Ga0501069_0007169 | |||
| 1609 | Ga0501069_0030737 | |||
| 1610 | Ga0501070_0001477 | |||
| 1611 | Ga0501070_0013667 | |||
| 1612 | Ga0501070_0027936 | |||
| 1613 | Ga0501070_0214933 | |||
| 1614 | Ga0501071_0053241 | |||
| 1615 | Ga0501072_0001047 | |||
| 1616 | Ga0501072_0001974 | |||
| 1617 | Ga0501072_0214017 | |||
| 1618 | Ga0501074_0026711 | |||
| 1619 | Ga0501079_0019695 | |||
| 1620 | Ga0501079_0107735 | |||
| 1621 | Ga0501079_0246616 | |||
| 1622 | Ga0501080_0038360 | |||
| 1623 | Ga0501080_0230458 | |||
| 1624 | Ga0501083_0012866 | |||
| 1625 | Ga0501083_0018988 | |||
| 1626 | Ga0501083_0091482 | |||
| 1627 | Ga0501035_0005943 | |||
| 1628 | Ga0501035_0182059 | |||
| 1629 | Ga0501044_0001075 | |||
| 1630 | Ga0501044_0050006 | |||
| 1631 | Ga0501044_0074884 | |||
| 1632 | Ga0501044_0091961 | |||
| 1633 | Ga0501044_0117939 | |||
| 1634 | Ga0501044_0126730 | |||
| 1635 | Ga0501044_0212964 | |||
| 1636 | Ga0501044_0404590 | |||
| 1637 | nmdc:mga03n38_124729_c1 | |||
| 1638 | nmdc:mga00v17_24097_c1 | |||
| 1639 | nmdc:mga0k408_104608_c1 | |||
| 1640 | nmdc:mga06z11_22728_c1 | |||
| 1641 | nmdc:mga04h51_99719_c1 | |||
| 1642 | nmdc:mga05p37_19429_c1 | |||
| 1643 | nmdc:mga05p37_57458_c1 | |||
| 1644 | nmdc:mga05p37_651189_c1 | |||
| 1645 | nmdc:mga0qj67_155368_c1 | |||
| 1646 | nmdc:mga0qj67_67_c1 | |||
| 1647 | nmdc:mga0qj67_938_c1 | |||
| 1648 | nmdc:mga06r32_24345_c1 | |||
| 1649 | nmdc:mga06r32_290805_c1 | |||
| 1650 | nmdc:mga06r32_661_c1 | |||
| 1651 | nmdc:mga08y16_135004_c1 | |||
| 1652 | nmdc:mga08y16_20627_c1 | |||
| 1653 | nmdc:mga08y16_208_c1 | |||
| 1654 | nmdc:mga08y16_266745_c1 | |||
| 1655 | nmdc:mga08y16_380385_c1 | |||
| 1656 | nmdc:mga0n895_12771_c1 | |||
| 1657 | nmdc:mga0n895_19194_c1 | |||
| 1658 | nmdc:mga0n895_53296_c1 | |||
| 1659 | nmdc:mga0n895_77003_c1 | |||
| 1660 | nmdc:mga0n895_797_c1 | |||
| 1661 | nmdc:mga0rr50_129066_c1 | |||
| 1662 | nmdc:mga0rr50_19804_c1 | |||
| 1663 | nmdc:mga0rr50_60157_c1 | |||
| 1664 | nmdc:mga0rr50_65568_c1 | |||
| 1665 | nmdc:mga0a205_232480_c1 | |||
| 1666 | nmdc:mga0a205_2345_c1 | |||
| 1667 | Ga0495601_0000011 | |||
| 1668 | Ga0495601_0000237 | |||
| 1669 | Ga0495601_0000293 | |||
| 1670 | Ga0495612_0000006 | |||
| 1671 | Ga0495612_0000275 | |||
| 1672 | Ga0495612_0006268 | |||
| 1673 | Ga0495612_0009610 | |||
| 1674 | Ga0495612_0109193 | |||
| 1675 | Ga0495595_0000055 | |||
| 1676 | Ga0495595_0000379 | |||
| 1677 | Ga0495595_0000730 | |||
| 1678 | Ga0495595_0002027 | |||
| 1679 | Ga0495619_0000013 | |||
| 1680 | Ga0495619_0000259 | |||
| 1681 | Ga0495619_0000343 | |||
| 1682 | Ga0495619_0005586 | |||
| 1683 | Ga0495619_0021933 | |||
| 1684 | Ga0500644_0000752 | |||
| 1685 | Ga0500651_0000859 | |||
| 1686 | Ga0500651_0073213 | |||
| 1687 | Ga0500641_0006534 | |||
| 1688 | Ga0500641_0020611 | |||
| 1689 | Ga0500562_019410 | |||
| 1690 | Ga0500562_056928 | |||
| 1691 | Ga0500593_001364 | |||
| 1692 | Ga0500595_000078 | |||
| 1693 | Ga0500652_021503 | |||
| 1694 | Ga0500658_0022990 | |||
| 1695 | Ga0500577_0020532 | |||
| 1696 | Ga0500616_0000006 | |||
| 1697 | Ga0500616_0040284 | |||
| 1698 | Ga0500645_000147 | |||
| 1699 | Ga0501084_0056033 | |||
| 1700 | Ga0501084_0122571 | |||
| 1701 | Ga0501082_0001469 | |||
| 1702 | Ga0501082_0149408 | |||
| 1703 | Ga0501082_0199464 | |||
| 1704 | Ga0501082_0235697 | |||
| 1705 | Ga0466962_0132901 | |||
| 1706 | 2643757829 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2whn-assembly2.cif.gz_B | n-terminal domain from the pilc type iv pilus biogenesis protein | 0.8447 | 135 | 237 |
| 5nbg-assembly1.cif.gz_B | structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system | 0.837 | 135 | 242 |
| 2whn-assembly1.cif.gz_A | n-terminal domain from the pilc type iv pilus biogenesis protein | 0.8302 | 135 | 237 |
| 3c1q-assembly1.cif.gz_A | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.8271 | 135 | 241 |
| 2vma-assembly1.cif.gz_A | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.8234 | 135 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2whnB00 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.8447 | 135 | 237 | 1.20.81.30 |
| af_I6Y479_96_222_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.8264 | 142 | 265 | 1.20.81.30 |
| af_P36646_52_165_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.8254 | 135 | 244 | 1.20.81.30 |
| af_I6Y479_96_222_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.8036 | 142 | 265 | 1.20.81.30 |
| 2whnB00 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.8013 | 135 | 237 | 1.20.81.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A444K1C5-F1-model_v4 | Type II secretion system F family protein | 0.849 | 106 | 309 |
GO:0005886
|
| AF-A0A444K1C5-F1-model_v4 | Type II secretion system F family protein | 0.8416 | 106 | 309 |
GO:0005886
|
| AF-A0A4P7SZM4-F1-model_v4 | Type II secretion system protein F | 0.8303 | 81 | 309 |
GO:0005886
|
| AF-A0A536F7G4-F1-model_v4 | Type II secretion system protein GspF domain-containing protein | 0.8195 | 105 | 309 |
GO:0005886
|
| AF-A0A7V0XEU4-F1-model_v4 | Type II secretion system protein GspF domain-containing protein | 0.8176 | 118 | 309 |
GO:0005886
|