F483565
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 853 | 435 | 1706 | 226 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2547132103|2547374908 |
| Length | 266 |
| Sequence | HFECRRSSHNVPTDAPQIVNTFQASSGPRFAGGLALYGDTMLLHIPAVLSAEELALGRELLARADWADGRITAGSQSAQVKRNLQLPQQLPEAQQLQAMVEGALQRNGLFFSAALPAKIFPPLFNCYQAGMDFGNHVDNAVRRHPFDGGWVRTDVSCTLFFSRPDEYEGGELVIEDTYGSHSVKLDAGDMVLYPSTSLHRVEPVTAGARLASFFWVQSMISDDGKRRLLFDMDAAISSLRLQLGDNEALVALTANYHNLLRMWASP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 217 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 220 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 232 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 243 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 251 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 252 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 253 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 254 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 255 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 256 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 257 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 258 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 259 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 260 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 263 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 311 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 312 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 313 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 318 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 319 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 343 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 344 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 345 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 346 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 347 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 348 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 349 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 350 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 351 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 352 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 353 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 354 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 359 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 360 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 361 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 362 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 363 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 364 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 365 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 372 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 384 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 385 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 386 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 387 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 388 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 391 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 394 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 396 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 397 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 400 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 401 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 402 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 403 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 404 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 405 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 406 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 407 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 408 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 409 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 410 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 411 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 412 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 413 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 414 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 415 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 416 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 417 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 418 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 419 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 420 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 421 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 422 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 423 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 424 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 425 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 426 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 427 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 428 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 429 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 430 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 431 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 432 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 433 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 434 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 435 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.66 |
| Metatranscriptomes | 0.12 |
| Isolates | 4.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.21 |
| Nodule | 1.06 |
| Rhizoplane | 2.23 |
| Rhizosphere | 82.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1016224 | 3300002070 | Bacteria | 1010 |
| 2 | JGI24749J21850_1028161 | 3300002076 | Bacteria | 803 |
| 3 | JGI24744J21845_10039574 | 3300002077 | Bacteria | 884 |
| 4 | JGI24034J26672_10006470 | 3300002239 | Bacteria | 1690 |
| 5 | rootL2_10083363 | 3300003322 | Bacteria | 16621 |
| 6 | Ga0055526_1013787 | 3300003771 | Bacteria | 3385 |
| 7 | Ga0055537_1005105 | 3300003773 | Bacteria | 3587 |
| 8 | Ga0055524_1001263 | 3300003775 | Bacteria | 14843 |
| 9 | Ga0055536_1003133 | 3300003781 | Bacteria | 8980 |
| 10 | Ga0055536_1004801 | 3300003781 | Bacteria | 6768 |
| 11 | Ga0055536_1005155 | 3300003781 | Bacteria | 6461 |
| 12 | Ga0055534_1010687 | 3300003784 | Bacteria | 1905 |
| 13 | Ga0055530_10000310 | 3300003791 | Bacteria | 44225 |
| 14 | Ga0055531_10002945 | 3300003794 | Bacteria | 11076 |
| 15 | Ga0055531_10007831 | 3300003794 | Bacteria | 5750 |
| 16 | Ga0055531_10027351 | 3300003794 | Bacteria | 2004 |
| 17 | Ga0058692_1000431 | 3300003856 | Bacteria | 19221 |
| 18 | Ga0065704_10148704 | 3300005289 | Bacteria | 1448 |
| 19 | Ga0065715_10100239 | 3300005293 | Bacteria | 3320 |
| 20 | Ga0065707_10029968 | 3300005295 | Bacteria | 1119 |
| 21 | Ga0070658_10002553 | 3300005327 | Bacteria | 15186 |
| 22 | Ga0070676_10260264 | 3300005328 | Bacteria | 1161 |
| 23 | Ga0070676_10261845 | 3300005328 | Bacteria | 1158 |
| 24 | Ga0070683_100358925 | 3300005329 | Bacteria | 1388 |
| 25 | Ga0070683_100508954 | 3300005329 | Bacteria | 1150 |
| 26 | Ga0070690_100003142 | 3300005330 | Bacteria | 8993 |
| 27 | Ga0070670_100006524 | 3300005331 | Bacteria | 9880 |
| 28 | Ga0070670_100026480 | 3300005331 | Bacteria | 4989 |
| 29 | Ga0070670_100134969 | 3300005331 | Bacteria | 2132 |
| 30 | Ga0070670_100304558 | 3300005331 | Unclassified | 1394 |
| 31 | Ga0070670_100468456 | 3300005331 | Bacteria | 1118 |
| 32 | Ga0070670_100556076 | 3300005331 | Bacteria | 1024 |
| 33 | Ga0070677_10006039 | 3300005333 | Bacteria | 4013 |
| 34 | Ga0070677_10091383 | 3300005333 | Bacteria | 1325 |
| 35 | Ga0068869_100001182 | 3300005334 | Bacteria | 15323 |
| 36 | Ga0068869_100017486 | 3300005334 | Bacteria | 4861 |
| 37 | Ga0068869_100557786 | 3300005334 | Bacteria | 963 |
| 38 | Ga0068869_100942753 | 3300005334 | Bacteria | 749 |
| 39 | Ga0070666_10026489 | 3300005335 | Bacteria | 3789 |
| 40 | Ga0070666_10144040 | 3300005335 | Bacteria | 1660 |
| 41 | Ga0070680_100177831 | 3300005336 | Bacteria | 1791 |
| 42 | Ga0070660_100003289 | 3300005339 | Bacteria | 11105 |
| 43 | Ga0070660_100018896 | 3300005339 | Bacteria | 5044 |
| 44 | Ga0070689_100008082 | 3300005340 | Bacteria | 7391 |
| 45 | Ga0070687_100000376 | 3300005343 | Bacteria | 15278 |
| 46 | Ga0070661_100036204 | 3300005344 | Bacteria | 3588 |
| 47 | Ga0070661_100245864 | 3300005344 | Bacteria | 1379 |
| 48 | Ga0070668_100613705 | 3300005347 | Bacteria | 953 |
| 49 | Ga0070669_100000001 | 3300005353 | Bacteria | 537589 |
| 50 | Ga0070669_100169463 | 3300005353 | Bacteria | 1701 |
| 51 | Ga0070675_100004297 | 3300005354 | Bacteria | 10855 |
| 52 | Ga0070675_100018240 | 3300005354 | Bacteria | 5586 |
| 53 | Ga0070675_100022287 | 3300005354 | Bacteria | 5060 |
| 54 | Ga0070671_100000002 | 3300005355 | Bacteria | 292733 |
| 55 | Ga0070671_100029085 | 3300005355 | Bacteria | 4555 |
| 56 | Ga0070671_100041611 | 3300005355 | Bacteria | 3819 |
| 57 | Ga0070674_100000167 | 3300005356 | Bacteria | 30534 |
| 58 | Ga0070673_100056243 | 3300005364 | Bacteria | 3103 |
| 59 | Ga0070688_100000491 | 3300005365 | Bacteria | 20041 |
| 60 | Ga0070688_100233179 | 3300005365 | Bacteria | 1303 |
| 61 | Ga0070659_100000743 | 3300005366 | Bacteria | 23664 |
| 62 | Ga0070659_100000820 | 3300005366 | Bacteria | 22687 |
| 63 | Ga0070659_100004983 | 3300005366 | Bacteria | 9508 |
| 64 | Ga0070659_100030874 | 3300005366 | Bacteria | 4147 |
| 65 | Ga0070659_100091984 | 3300005366 | Bacteria | 2432 |
| 66 | Ga0070667_100004785 | 3300005367 | Bacteria | 11339 |
| 67 | Ga0070703_10031602 | 3300005406 | Bacteria | 1602 |
| 68 | Ga0070701_10043469 | 3300005438 | Bacteria | 2299 |
| 69 | Ga0070705_100000983 | 3300005440 | Bacteria | 15930 |
| 70 | Ga0070705_100005445 | 3300005440 | Bacteria | 6202 |
| 71 | Ga0070705_100482493 | 3300005440 | Bacteria | 937 |
| 72 | Ga0070700_100025169 | 3300005441 | Bacteria | 3503 |
| 73 | Ga0070700_100295253 | 3300005441 | Bacteria | 1181 |
| 74 | Ga0070694_100324945 | 3300005444 | Bacteria | 1185 |
| 75 | Ga0070708_100040828 | 3300005445 | Bacteria | 4065 |
| 76 | Ga0070663_100015868 | 3300005455 | Bacteria | 4875 |
| 77 | Ga0070663_100501343 | 3300005455 | Bacteria | 1008 |
| 78 | Ga0070678_100003331 | 3300005456 | Bacteria | 8940 |
| 79 | Ga0070678_100006518 | 3300005456 | Bacteria | 6856 |
| 80 | Ga0070678_100020327 | 3300005456 | Bacteria | 4353 |
| 81 | Ga0070662_100002454 | 3300005457 | Bacteria | 11422 |
| 82 | Ga0070681_10001866 | 3300005458 | Bacteria | 19023 |
| 83 | Ga0070681_10015969 | 3300005458 | Bacteria | 7487 |
| 84 | Ga0070681_10095047 | 3300005458 | Bacteria | 2929 |
| 85 | Ga0070681_10176869 | 3300005458 | Bacteria | 2056 |
| 86 | Ga0070681_10351413 | 3300005458 | Bacteria | 1384 |
| 87 | Ga0068867_100014253 | 3300005459 | Bacteria | 5631 |
| 88 | Ga0068867_100127993 | 3300005459 | Bacteria | 1970 |
| 89 | Ga0070685_10000312 | 3300005466 | Bacteria | 30514 |
| 90 | Ga0070706_100003178 | 3300005467 | Bacteria | 16216 |
| 91 | Ga0070707_100130219 | 3300005468 | Bacteria | 2447 |
| 92 | Ga0070679_100022623 | 3300005530 | Bacteria | 6145 |
| 93 | Ga0070679_100055690 | 3300005530 | Bacteria | 3939 |
| 94 | Ga0070679_100226611 | 3300005530 | Bacteria | 1829 |
| 95 | Ga0070679_100403233 | 3300005530 | Bacteria | 1313 |
| 96 | Ga0070684_100044363 | 3300005535 | Bacteria | 3846 |
| 97 | Ga0068853_100005451 | 3300005539 | Bacteria | 9970 |
| 98 | Ga0068853_100007924 | 3300005539 | Bacteria | 8516 |
| 99 | Ga0068853_100501382 | 3300005539 | Bacteria | 1146 |
| 100 | Ga0070672_100011434 | 3300005543 | Bacteria | 6191 |
| 101 | Ga0070672_100441412 | 3300005543 | Bacteria | 1120 |
| 102 | Ga0070686_100004704 | 3300005544 | Bacteria | 7525 |
| 103 | Ga0070696_100033486 | 3300005546 | Bacteria | 3531 |
| 104 | Ga0070696_100047787 | 3300005546 | Bacteria | 2970 |
| 105 | Ga0070693_100000389 | 3300005547 | Bacteria | 19974 |
| 106 | Ga0070693_100307119 | 3300005547 | Bacteria | 1071 |
| 107 | Ga0070665_100058556 | 3300005548 | Bacteria | 3862 |
| 108 | Ga0070665_100181062 | 3300005548 | Bacteria | 2108 |
| 109 | Ga0070665_100273288 | 3300005548 | Bacteria | 1692 |
| 110 | Ga0070704_100018066 | 3300005549 | Bacteria | 4499 |
| 111 | Ga0070704_100193390 | 3300005549 | Bacteria | 1637 |
| 112 | Ga0068855_100001278 | 3300005563 | Bacteria | 31177 |
| 113 | Ga0068855_100001819 | 3300005563 | Bacteria | 26612 |
| 114 | Ga0070664_100011160 | 3300005564 | Bacteria | 7286 |
| 115 | Ga0068857_100214791 | 3300005577 | Bacteria | 1756 |
| 116 | Ga0068854_100032491 | 3300005578 | Bacteria | 3632 |
| 117 | Ga0068854_100057209 | 3300005578 | Bacteria | 2812 |
| 118 | Ga0068854_100707637 | 3300005578 | Bacteria | 870 |
| 119 | Ga0068856_100012081 | 3300005614 | Bacteria | 8363 |
| 120 | Ga0068856_100020253 | 3300005614 | Bacteria | 6460 |
| 121 | Ga0068856_100295606 | 3300005614 | Bacteria | 1637 |
| 122 | Ga0068856_100669876 | 3300005614 | Bacteria | 1058 |
| 123 | Ga0070702_100349868 | 3300005615 | Bacteria | 1040 |
| 124 | Ga0068852_100004791 | 3300005616 | Bacteria | 9610 |
| 125 | Ga0068852_100251423 | 3300005616 | Bacteria | 1694 |
| 126 | Ga0068859_100002725 | 3300005617 | Bacteria | 17917 |
| 127 | Ga0068864_100000323 | 3300005618 | Bacteria | 42172 |
| 128 | Ga0068864_100040657 | 3300005618 | Bacteria | 3977 |
| 129 | Ga0068864_100162383 | 3300005618 | Bacteria | 2031 |
| 130 | Ga0068864_100207846 | 3300005618 | Bacteria | 1801 |
| 131 | Ga0068861_100001192 | 3300005719 | Bacteria | 16170 |
| 132 | Ga0068861_100002755 | 3300005719 | Bacteria | 11526 |
| 133 | Ga0068861_100033317 | 3300005719 | Bacteria | 3799 |
| 134 | Ga0068851_10000396 | 3300005834 | Bacteria | 19748 |
| 135 | Ga0068870_10000513 | 3300005840 | Bacteria | 14666 |
| 136 | Ga0068870_10001473 | 3300005840 | Bacteria | 9523 |
| 137 | Ga0068870_10059711 | 3300005840 | Bacteria | 2045 |
| 138 | Ga0068870_10138612 | 3300005840 | Bacteria | 1421 |
| 139 | Ga0068863_100011337 | 3300005841 | Bacteria | 8631 |
| 140 | Ga0068863_100017755 | 3300005841 | Bacteria | 6811 |
| 141 | Ga0068863_100081617 | 3300005841 | Bacteria | 3063 |
| 142 | Ga0068863_100084708 | 3300005841 | Bacteria | 3004 |
| 143 | Ga0068863_100288715 | 3300005841 | Bacteria | 1590 |
| 144 | Ga0068863_100290501 | 3300005841 | Bacteria | 1585 |
| 145 | Ga0068858_100024171 | 3300005842 | Bacteria | 5662 |
| 146 | Ga0068858_100107416 | 3300005842 | Bacteria | 2605 |
| 147 | Ga0068858_100230425 | 3300005842 | Bacteria | 1756 |
| 148 | Ga0068858_100682680 | 3300005842 | Bacteria | 999 |
| 149 | Ga0068860_100057650 | 3300005843 | Bacteria | 3692 |
| 150 | Ga0068860_100286332 | 3300005843 | Bacteria | 1611 |
| 151 | Ga0068860_100296685 | 3300005843 | Bacteria | 1583 |
| 152 | Ga0068862_100000856 | 3300005844 | Bacteria | 29863 |
| 153 | Ga0068862_100004739 | 3300005844 | Bacteria | 11447 |
| 154 | Ga0068862_100019061 | 3300005844 | Bacteria | 5721 |
| 155 | Ga0068862_100204582 | 3300005844 | Bacteria | 1781 |
| 156 | Ga0081455_10035349 | 3300005937 | Bacteria | 4467 |
| 157 | Ga0081455_10159847 | 3300005937 | Bacteria | 1728 |
| 158 | Ga0081540_1000069 | 3300005983 | Bacteria | 111562 |
| 159 | Ga0081540_1000394 | 3300005983 | Bacteria | 43177 |
| 160 | Ga0075365_10065906 | 3300006038 | Bacteria | 2428 |
| 161 | Ga0075368_10000982 | 3300006042 | Bacteria | 8906 |
| 162 | Ga0075363_100071829 | 3300006048 | Bacteria | 1881 |
| 163 | Ga0075432_10126682 | 3300006058 | Bacteria | 964 |
| 164 | Ga0070715_10070721 | 3300006163 | Bacteria | 1558 |
| 165 | Ga0070715_10097515 | 3300006163 | Bacteria | 1365 |
| 166 | Ga0075362_10010431 | 3300006177 | Bacteria | 3628 |
| 167 | Ga0075367_10014576 | 3300006178 | Bacteria | 4256 |
| 168 | Ga0075367_10018531 | 3300006178 | Bacteria | 3843 |
| 169 | Ga0075366_10068062 | 3300006195 | Bacteria | 2119 |
| 170 | Ga0097621_100000838 | 3300006237 | Bacteria | 21638 |
| 171 | Ga0097621_100016607 | 3300006237 | Bacteria | 5569 |
| 172 | Ga0097621_100103834 | 3300006237 | Bacteria | 2394 |
| 173 | Ga0075370_10091817 | 3300006353 | Bacteria | 1752 |
| 174 | Ga0068871_100000675 | 3300006358 | Bacteria | 23340 |
| 175 | Ga0068871_100000829 | 3300006358 | Bacteria | 20718 |
| 176 | Ga0068871_100054493 | 3300006358 | Bacteria | 3244 |
| 177 | Ga0068871_100191445 | 3300006358 | Bacteria | 1762 |
| 178 | Ga0075428_100593091 | 3300006844 | Bacteria | 1183 |
| 179 | Ga0075430_100005542 | 3300006846 | Bacteria | 10659 |
| 180 | Ga0075430_100018913 | 3300006846 | Bacteria | 5861 |
| 181 | Ga0075430_100334527 | 3300006846 | Bacteria | 1251 |
| 182 | Ga0075431_100001427 | 3300006847 | Bacteria | 21965 |
| 183 | Ga0075431_100248618 | 3300006847 | Bacteria | 1807 |
| 184 | Ga0075431_100416241 | 3300006847 | Bacteria | 1343 |
| 185 | Ga0075431_100625367 | 3300006847 | Bacteria | 1059 |
| 186 | Ga0075433_10064014 | 3300006852 | Bacteria | 3223 |
| 187 | Ga0075434_100084101 | 3300006871 | Bacteria | 3180 |
| 188 | Ga0075429_100054288 | 3300006880 | Bacteria | 3486 |
| 189 | Ga0097620_100002725 | 3300006931 | Bacteria | 17917 |
| 190 | Ga0079104_1000020 | 3300006946 | Bacteria | 256848 |
| 191 | Ga0075435_100060907 | 3300007076 | Bacteria | 3061 |
| 192 | Ga0105244_10069369 | 3300009036 | Bacteria | 1760 |
| 193 | Ga0105250_10000684 | 3300009092 | Bacteria | 21197 |
| 194 | Ga0105240_10001833 | 3300009093 | Bacteria | 35581 |
| 195 | Ga0105240_10103614 | 3300009093 | Bacteria | 3456 |
| 196 | Ga0111539_10001473 | 3300009094 | Bacteria | 31441 |
| 197 | Ga0111539_10118726 | 3300009094 | Bacteria | 3099 |
| 198 | Ga0111539_10191639 | 3300009094 | Bacteria | 2385 |
| 199 | Ga0105245_10001784 | 3300009098 | Bacteria | 19587 |
| 200 | Ga0105247_10000499 | 3300009101 | Bacteria | 32445 |
| 201 | Ga0105247_10001755 | 3300009101 | Bacteria | 15272 |
| 202 | Ga0105247_10092067 | 3300009101 | Bacteria | 1926 |
| 203 | Ga0114129_10005737 | 3300009147 | Bacteria | 17592 |
| 204 | Ga0114129_10028119 | 3300009147 | Bacteria | 7966 |
| 205 | Ga0114129_10034844 | 3300009147 | Bacteria | 7112 |
| 206 | Ga0114129_10845816 | 3300009147 | Bacteria | 1164 |
| 207 | Ga0114129_11530976 | 3300009147 | Bacteria | 818 |
| 208 | Ga0105243_10003516 | 3300009148 | Bacteria | 12656 |
| 209 | Ga0105243_10040411 | 3300009148 | Bacteria | 3643 |
| 210 | Ga0105241_10099312 | 3300009174 | Bacteria | 2311 |
| 211 | Ga0105241_10106187 | 3300009174 | Bacteria | 2241 |
| 212 | Ga0105241_10491433 | 3300009174 | Bacteria | 1093 |
| 213 | Ga0105241_10623475 | 3300009174 | Bacteria | 977 |
| 214 | Ga0105242_10000776 | 3300009176 | Bacteria | 24808 |
| 215 | Ga0105242_10016603 | 3300009176 | Bacteria | 5726 |
| 216 | Ga0105248_10052796 | 3300009177 | Bacteria | 4562 |
| 217 | Ga0105248_10270480 | 3300009177 | Bacteria | 1913 |
| 218 | Ga0105237_10000240 | 3300009545 | Bacteria | 77901 |
| 219 | Ga0105237_10151970 | 3300009545 | Bacteria | 2312 |
| 220 | Ga0105238_10001156 | 3300009551 | Bacteria | 26656 |
| 221 | Ga0105238_10002207 | 3300009551 | Bacteria | 19641 |
| 222 | Ga0105238_10046900 | 3300009551 | Bacteria | 4358 |
| 223 | Ga0105249_10002404 | 3300009553 | Bacteria | 16271 |
| 224 | Ga0105249_10064841 | 3300009553 | Bacteria | 3359 |
| 225 | Ga0105239_10003666 | 3300010375 | Bacteria | 18760 |
| 226 | Ga0105239_10261190 | 3300010375 | Bacteria | 1946 |
| 227 | Ga0105246_10005681 | 3300011119 | Bacteria | 7612 |
| 228 | Ga0157373_10001212 | 3300013100 | Bacteria | 19706 |
| 229 | Ga0157373_10009846 | 3300013100 | Bacteria | 7045 |
| 230 | Ga0157371_10001038 | 3300013102 | Bacteria | 30445 |
| 231 | Ga0157371_10004495 | 3300013102 | Bacteria | 12160 |
| 232 | Ga0157371_10017286 | 3300013102 | Bacteria | 5363 |
| 233 | Ga0157370_10000662 | 3300013104 | Bacteria | 42848 |
| 234 | Ga0157370_10002750 | 3300013104 | Bacteria | 21019 |
| 235 | Ga0157370_10008238 | 3300013104 | Bacteria | 11255 |
| 236 | Ga0157369_10024719 | 3300013105 | Bacteria | 6676 |
| 237 | Ga0157374_10000876 | 3300013296 | Bacteria | 26225 |
| 238 | Ga0157374_10593162 | 3300013296 | Bacteria | 1117 |
| 239 | Ga0157378_10000880 | 3300013297 | Bacteria | 27725 |
| 240 | Ga0157378_10183652 | 3300013297 | Bacteria | 1969 |
| 241 | Ga0157378_10420922 | 3300013297 | Bacteria | 1320 |
| 242 | Ga0163162_10001408 | 3300013306 | Bacteria | 22388 |
| 243 | Ga0163162_10017854 | 3300013306 | Bacteria | 6942 |
| 244 | Ga0163162_10468019 | 3300013306 | Bacteria | 1392 |
| 245 | Ga0163162_10867132 | 3300013306 | Bacteria | 1017 |
| 246 | Ga0163162_11403658 | 3300013306 | Bacteria | 794 |
| 247 | Ga0157372_10013278 | 3300013307 | Bacteria | 8790 |
| 248 | Ga0157372_10030186 | 3300013307 | Bacteria | 5927 |
| 249 | Ga0157375_10012511 | 3300013308 | Bacteria | 7531 |
| 250 | Ga0157375_10080250 | 3300013308 | Bacteria | 3300 |
| 251 | Ga0157375_10265028 | 3300013308 | Bacteria | 1880 |
| 252 | Ga0163163_10071581 | 3300014325 | Bacteria | 3455 |
| 253 | Ga0163163_10076193 | 3300014325 | Bacteria | 3349 |
| 254 | Ga0163163_10158478 | 3300014325 | Bacteria | 2308 |
| 255 | Ga0157380_10011035 | 3300014326 | Bacteria | 6516 |
| 256 | Ga0157380_10032233 | 3300014326 | Bacteria | 4029 |
| 257 | Ga0157380_10152128 | 3300014326 | Bacteria | 2001 |
| 258 | Ga0157377_10000421 | 3300014745 | Bacteria | 18342 |
| 259 | Ga0157379_10002360 | 3300014968 | Bacteria | 15768 |
| 260 | Ga0157379_10095916 | 3300014968 | Bacteria | 2661 |
| 261 | Ga0157379_10223518 | 3300014968 | Bacteria | 1706 |
| 262 | Ga0157379_10330518 | 3300014968 | Bacteria | 1393 |
| 263 | Ga0157379_10416273 | 3300014968 | Bacteria | 1237 |
| 264 | Ga0157376_10004912 | 3300014969 | Bacteria | 9322 |
| 265 | Ga0157376_10047151 | 3300014969 | Bacteria | 3556 |
| 266 | Ga0157376_10066788 | 3300014969 | Bacteria | 3041 |
| 267 | Ga0157376_10081219 | 3300014969 | Bacteria | 2783 |
| 268 | Ga0182007_10043767 | 3300015262 | Bacteria | 1487 |
| 269 | Ga0183369_1007 | 3300015685 | Bacteria | 414878 |
| 270 | Ga0163161_10019395 | 3300017792 | Bacteria | 4771 |
| 271 | Ga0213872_10000211 | 3300021361 | Bacteria | 51730 |
| 272 | Ga0213872_10029040 | 3300021361 | Bacteria | 2536 |
| 273 | Ga0213876_10000987 | 3300021384 | Bacteria | 18681 |
| 274 | Ga0213876_10130061 | 3300021384 | Bacteria | 1338 |
| 275 | Ga0209674_100635 | 3300025226 | Bacteria | 12776 |
| 276 | Ga0209026_1000037 | 3300025250 | Bacteria | 282562 |
| 277 | Ga0209565_1001442 | 3300025263 | Bacteria | 10501 |
| 278 | Ga0209675_1000025 | 3300025291 | Bacteria | 294102 |
| 279 | Ga0209675_1003444 | 3300025291 | Bacteria | 7521 |
| 280 | Ga0209676_1000198 | 3300025292 | Bacteria | 134708 |
| 281 | Ga0209676_1001165 | 3300025292 | Bacteria | 28524 |
| 282 | Ga0209676_1001500 | 3300025292 | Bacteria | 21339 |
| 283 | Ga0209676_1050538 | 3300025292 | Bacteria | 1096 |
| 284 | Ga0209025_1028558 | 3300025294 | Bacteria | 2728 |
| 285 | Ga0209025_1096882 | 3300025294 | Bacteria | 946 |
| 286 | Ga0209564_1003296 | 3300025295 | Bacteria | 11221 |
| 287 | Ga0209758_1007867 | 3300025297 | Bacteria | 7097 |
| 288 | Ga0209050_1000104 | 3300025298 | Bacteria | 228921 |
| 289 | Ga0209050_1002306 | 3300025298 | Bacteria | 16802 |
| 290 | Ga0209050_1013188 | 3300025298 | Bacteria | 3697 |
| 291 | Ga0209256_1000964 | 3300025299 | Bacteria | 34690 |
| 292 | Ga0209257_1000860 | 3300025304 | Bacteria | 43237 |
| 293 | Ga0209257_1001790 | 3300025304 | Bacteria | 23629 |
| 294 | Ga0209257_1003091 | 3300025304 | Bacteria | 14969 |
| 295 | Ga0209257_1018503 | 3300025304 | Bacteria | 2677 |
| 296 | Ga0207697_10000248 | 3300025315 | Bacteria | 29669 |
| 297 | Ga0207697_10001354 | 3300025315 | Bacteria | 13437 |
| 298 | Ga0207697_10004831 | 3300025315 | Bacteria | 6363 |
| 299 | Ga0207656_10007391 | 3300025321 | Bacteria | 3999 |
| 300 | Ga0207656_10048795 | 3300025321 | Bacteria | 1824 |
| 301 | Ga0207696_1002516 | 3300025711 | Bacteria | 8949 |
| 302 | Ga0207682_10000093 | 3300025893 | Bacteria | 41366 |
| 303 | Ga0207682_10001426 | 3300025893 | Bacteria | 11040 |
| 304 | Ga0207642_10099894 | 3300025899 | Bacteria | 1454 |
| 305 | Ga0207710_10004910 | 3300025900 | Bacteria | 5798 |
| 306 | Ga0207710_10036099 | 3300025900 | Bacteria | 2178 |
| 307 | Ga0207688_10022722 | 3300025901 | Bacteria | 3433 |
| 308 | Ga0207680_10000256 | 3300025903 | Bacteria | 25532 |
| 309 | Ga0207680_10021323 | 3300025903 | Bacteria | 3504 |
| 310 | Ga0207680_10124747 | 3300025903 | Bacteria | 1689 |
| 311 | Ga0207680_10139928 | 3300025903 | Bacteria | 1604 |
| 312 | Ga0207647_10020714 | 3300025904 | Bacteria | 4405 |
| 313 | Ga0207647_10272005 | 3300025904 | Bacteria | 968 |
| 314 | Ga0207645_10000101 | 3300025907 | Bacteria | 63405 |
| 315 | Ga0207645_10139169 | 3300025907 | Bacteria | 1581 |
| 316 | Ga0207643_10000166 | 3300025908 | Bacteria | 45538 |
| 317 | Ga0207643_10002758 | 3300025908 | Bacteria | 9501 |
| 318 | Ga0207643_10163904 | 3300025908 | Bacteria | 1338 |
| 319 | Ga0207643_10209240 | 3300025908 | Bacteria | 1190 |
| 320 | Ga0207705_10029847 | 3300025909 | Bacteria | 3888 |
| 321 | Ga0207705_10061876 | 3300025909 | Bacteria | 2704 |
| 322 | Ga0207684_10008871 | 3300025910 | Bacteria | 8927 |
| 323 | Ga0207654_10414508 | 3300025911 | Bacteria | 939 |
| 324 | Ga0207707_10012137 | 3300025912 | Bacteria | 7489 |
| 325 | Ga0207707_10013190 | 3300025912 | Bacteria | 7205 |
| 326 | Ga0207707_10092784 | 3300025912 | Bacteria | 2638 |
| 327 | Ga0207707_10138615 | 3300025912 | Bacteria | 2127 |
| 328 | Ga0207707_10145645 | 3300025912 | Bacteria | 2071 |
| 329 | Ga0207695_10087457 | 3300025913 | Bacteria | 3139 |
| 330 | Ga0207695_10114082 | 3300025913 | Bacteria | 2678 |
| 331 | Ga0207663_10391493 | 3300025916 | Bacteria | 1061 |
| 332 | Ga0207660_10294296 | 3300025917 | Bacteria | 1291 |
| 333 | Ga0207662_10000010 | 3300025918 | Bacteria | 91647 |
| 334 | Ga0207657_10000353 | 3300025919 | Bacteria | 48893 |
| 335 | Ga0207657_10030005 | 3300025919 | Bacteria | 4940 |
| 336 | Ga0207657_10038401 | 3300025919 | Bacteria | 4262 |
| 337 | Ga0207649_10045312 | 3300025920 | Bacteria | 2696 |
| 338 | Ga0207649_10056595 | 3300025920 | Bacteria | 2449 |
| 339 | Ga0207652_10023091 | 3300025921 | Bacteria | 5152 |
| 340 | Ga0207652_10168974 | 3300025921 | Bacteria | 1962 |
| 341 | Ga0207652_10327530 | 3300025921 | Bacteria | 1383 |
| 342 | Ga0207646_10041233 | 3300025922 | Bacteria | 4151 |
| 343 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 344 | Ga0207681_10019058 | 3300025923 | Bacteria | 4331 |
| 345 | Ga0207694_10000623 | 3300025924 | Bacteria | 32207 |
| 346 | Ga0207694_10021700 | 3300025924 | Bacteria | 4866 |
| 347 | Ga0207694_10062426 | 3300025924 | Bacteria | 2901 |
| 348 | Ga0207650_10003185 | 3300025925 | Bacteria | 11308 |
| 349 | Ga0207650_10024028 | 3300025925 | Bacteria | 4327 |
| 350 | Ga0207650_10201645 | 3300025925 | Unclassified | 1594 |
| 351 | Ga0207650_10219288 | 3300025925 | Bacteria | 1530 |
| 352 | Ga0207659_10020488 | 3300025926 | Bacteria | 4372 |
| 353 | Ga0207659_10109120 | 3300025926 | Bacteria | 2100 |
| 354 | Ga0207659_10680183 | 3300025926 | Bacteria | 880 |
| 355 | Ga0207687_10001680 | 3300025927 | Bacteria | 15253 |
| 356 | Ga0207687_10085191 | 3300025927 | Bacteria | 2292 |
| 357 | Ga0207700_10026229 | 3300025928 | Bacteria | 4061 |
| 358 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 359 | Ga0207644_10169640 | 3300025931 | Bacteria | 1702 |
| 360 | Ga0207644_10189599 | 3300025931 | Bacteria | 1616 |
| 361 | Ga0207644_10596442 | 3300025931 | Bacteria | 917 |
| 362 | Ga0207644_10869035 | 3300025931 | Bacteria | 755 |
| 363 | Ga0207690_10000424 | 3300025932 | Bacteria | 27614 |
| 364 | Ga0207690_10001856 | 3300025932 | Bacteria | 12985 |
| 365 | Ga0207690_10003818 | 3300025932 | Bacteria | 8915 |
| 366 | Ga0207690_10327261 | 3300025932 | Bacteria | 1206 |
| 367 | Ga0207706_10000077 | 3300025933 | Bacteria | 102336 |
| 368 | Ga0207706_10008405 | 3300025933 | Bacteria | 9525 |
| 369 | Ga0207686_10471912 | 3300025934 | Bacteria | 969 |
| 370 | Ga0207709_10000055 | 3300025935 | Bacteria | 222373 |
| 371 | Ga0207709_10021881 | 3300025935 | Bacteria | 3622 |
| 372 | Ga0207670_10018583 | 3300025936 | Bacteria | 4230 |
| 373 | Ga0207669_10031514 | 3300025937 | Bacteria | 2963 |
| 374 | Ga0207704_10009730 | 3300025938 | Bacteria | 4654 |
| 375 | Ga0207704_10441779 | 3300025938 | Bacteria | 1036 |
| 376 | Ga0207665_10117829 | 3300025939 | Bacteria | 1873 |
| 377 | Ga0207665_10170312 | 3300025939 | Bacteria | 1572 |
| 378 | Ga0207691_10000033 | 3300025940 | Bacteria | 115126 |
| 379 | Ga0207691_10000680 | 3300025940 | Bacteria | 33596 |
| 380 | Ga0207691_10004283 | 3300025940 | Bacteria | 13863 |
| 381 | Ga0207711_10036711 | 3300025941 | Bacteria | 4159 |
| 382 | Ga0207711_10675841 | 3300025941 | Bacteria | 963 |
| 383 | Ga0207689_10003350 | 3300025942 | Bacteria | 14674 |
| 384 | Ga0207689_10032746 | 3300025942 | Bacteria | 4321 |
| 385 | Ga0207689_10403368 | 3300025942 | Bacteria | 1140 |
| 386 | Ga0207689_10653300 | 3300025942 | Bacteria | 886 |
| 387 | Ga0207661_10038621 | 3300025944 | Bacteria | 3743 |
| 388 | Ga0207661_10799434 | 3300025944 | Bacteria | 868 |
| 389 | Ga0207679_10023078 | 3300025945 | Bacteria | 4248 |
| 390 | Ga0207667_10008704 | 3300025949 | Bacteria | 12029 |
| 391 | Ga0207667_10015762 | 3300025949 | Bacteria | 8570 |
| 392 | Ga0207651_10014737 | 3300025960 | Bacteria | 4523 |
| 393 | Ga0207651_10066916 | 3300025960 | Bacteria | 2526 |
| 394 | Ga0207712_10002383 | 3300025961 | Bacteria | 12182 |
| 395 | Ga0207712_10008093 | 3300025961 | Bacteria | 6651 |
| 396 | Ga0207668_10097860 | 3300025972 | Bacteria | 2172 |
| 397 | Ga0207640_10041946 | 3300025981 | Bacteria | 2914 |
| 398 | Ga0207640_10117583 | 3300025981 | Bacteria | 1898 |
| 399 | Ga0207640_10230495 | 3300025981 | Bacteria | 1424 |
| 400 | Ga0207640_10402962 | 3300025981 | Bacteria | 1114 |
| 401 | Ga0207658_10010583 | 3300025986 | Bacteria | 6267 |
| 402 | Ga0207658_10029130 | 3300025986 | Bacteria | 3895 |
| 403 | Ga0207658_10039364 | 3300025986 | Bacteria | 3411 |
| 404 | Ga0207677_10004853 | 3300026023 | Bacteria | 7256 |
| 405 | Ga0207677_10019078 | 3300026023 | Bacteria | 4132 |
| 406 | Ga0207703_10014955 | 3300026035 | Bacteria | 6055 |
| 407 | Ga0207703_10024943 | 3300026035 | Bacteria | 4704 |
| 408 | Ga0207703_10072035 | 3300026035 | Bacteria | 2856 |
| 409 | Ga0207639_10657331 | 3300026041 | Bacteria | 970 |
| 410 | Ga0207678_10000464 | 3300026067 | Bacteria | 36746 |
| 411 | Ga0207678_10691855 | 3300026067 | Bacteria | 897 |
| 412 | Ga0207708_10011861 | 3300026075 | Bacteria | 6489 |
| 413 | Ga0207708_10082139 | 3300026075 | Bacteria | 2477 |
| 414 | Ga0207708_10379530 | 3300026075 | Bacteria | 1165 |
| 415 | Ga0207708_10452851 | 3300026075 | Bacteria | 1069 |
| 416 | Ga0207702_10229162 | 3300026078 | Bacteria | 1735 |
| 417 | Ga0207641_10009679 | 3300026088 | Bacteria | 7940 |
| 418 | Ga0207641_10015606 | 3300026088 | Bacteria | 6225 |
| 419 | Ga0207641_10115063 | 3300026088 | Bacteria | 2391 |
| 420 | Ga0207641_10459667 | 3300026088 | Bacteria | 1231 |
| 421 | Ga0207648_10000189 | 3300026089 | Bacteria | 64801 |
| 422 | Ga0207648_10015036 | 3300026089 | Bacteria | 7127 |
| 423 | Ga0207648_10459721 | 3300026089 | Bacteria | 1160 |
| 424 | Ga0207676_10000304 | 3300026095 | Bacteria | 42178 |
| 425 | Ga0207676_10007112 | 3300026095 | Bacteria | 7931 |
| 426 | Ga0207676_10026418 | 3300026095 | Bacteria | 4319 |
| 427 | Ga0207676_10093156 | 3300026095 | Bacteria | 2479 |
| 428 | Ga0207676_10489054 | 3300026095 | Bacteria | 1167 |
| 429 | Ga0207674_10000224 | 3300026116 | Bacteria | 70660 |
| 430 | Ga0207674_10368821 | 3300026116 | Bacteria | 1388 |
| 431 | Ga0207675_100000043 | 3300026118 | Bacteria | 89667 |
| 432 | Ga0207675_100000137 | 3300026118 | Bacteria | 62412 |
| 433 | Ga0207675_100019121 | 3300026118 | Bacteria | 6395 |
| 434 | Ga0207675_100042371 | 3300026118 | Bacteria | 4250 |
| 435 | Ga0207683_10011248 | 3300026121 | Bacteria | 7630 |
| 436 | Ga0207683_10023264 | 3300026121 | Bacteria | 5327 |
| 437 | Ga0207683_10031886 | 3300026121 | Bacteria | 4576 |
| 438 | Ga0207683_10188941 | 3300026121 | Bacteria | 1870 |
| 439 | Ga0207683_10498685 | 3300026121 | Bacteria | 1124 |
| 440 | Ga0207698_10001141 | 3300026142 | Bacteria | 15454 |
| 441 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 442 | Ga0209983_1013907 | 3300027665 | Bacteria | 1656 |
| 443 | Ga0209813_10002831 | 3300027866 | Bacteria | 4014 |
| 444 | Ga0209974_10019699 | 3300027876 | Bacteria | 2237 |
| 445 | Ga0207428_10000018 | 3300027907 | Bacteria | 293117 |
| 446 | Ga0207428_10000043 | 3300027907 | Bacteria | 198931 |
| 447 | Ga0207428_10275384 | 3300027907 | Bacteria | 1250 |
| 448 | Ga0268266_10010399 | 3300028379 | Bacteria | 8133 |
| 449 | Ga0268266_10041792 | 3300028379 | Bacteria | 3914 |
| 450 | Ga0268266_10227150 | 3300028379 | Bacteria | 1718 |
| 451 | Ga0268265_10000264 | 3300028380 | Bacteria | 59642 |
| 452 | Ga0268265_10023793 | 3300028380 | Bacteria | 4323 |
| 453 | Ga0268265_10032629 | 3300028380 | Bacteria | 3776 |
| 454 | Ga0268265_10103258 | 3300028380 | Bacteria | 2308 |
| 455 | Ga0268265_10214672 | 3300028380 | Bacteria | 1679 |
| 456 | Ga0268265_10477623 | 3300028380 | Bacteria | 1170 |
| 457 | Ga0268264_10000071 | 3300028381 | Bacteria | 267236 |
| 458 | Ga0268264_10120771 | 3300028381 | Bacteria | 2309 |
| 459 | Ga0268264_10238196 | 3300028381 | Bacteria | 1684 |
| 460 | Ga0268264_10522847 | 3300028381 | Bacteria | 1160 |
| 461 | Ga0265323_10075991 | 3300028653 | Unclassified | 1140 |
| 462 | Ga0307515_10003406 | 3300028794 | Bacteria | 33481 |
| 463 | Ga0307515_10006103 | 3300028794 | Bacteria | 24230 |
| 464 | Ga0307515_10027473 | 3300028794 | Bacteria | 9726 |
| 465 | Ga0307515_10068694 | 3300028794 | Bacteria | 4861 |
| 466 | Ga0307515_10307019 | 3300028794 | Bacteria | 1265 |
| 467 | Ga0307515_10347750 | 3300028794 | Bacteria | 1131 |
| 468 | Ga0265338_10040980 | 3300028800 | Bacteria | 4339 |
| 469 | Ga0307512_10066250 | 3300030522 | Bacteria | 2730 |
| 470 | Ga0265332_10056750 | 3300031238 | Bacteria | 1678 |
| 471 | Ga0265339_10270648 | 3300031249 | Bacteria | 817 |
| 472 | Ga0265316_10000349 | 3300031344 | Bacteria | 51876 |
| 473 | Ga0307513_10105713 | 3300031456 | Bacteria | 2823 |
| 474 | Ga0307513_10393839 | 3300031456 | Bacteria | 1121 |
| 475 | Ga0307509_10004212 | 3300031507 | Bacteria | 20986 |
| 476 | Ga0307408_100002690 | 3300031548 | Bacteria | 12339 |
| 477 | Ga0307408_100012733 | 3300031548 | Bacteria | 5577 |
| 478 | Ga0307408_100345880 | 3300031548 | Bacteria | 1260 |
| 479 | Ga0307408_100419130 | 3300031548 | Bacteria | 1154 |
| 480 | Ga0307408_100749231 | 3300031548 | Bacteria | 882 |
| 481 | Ga0307508_10000048 | 3300031616 | Bacteria | 137587 |
| 482 | Ga0307508_10344018 | 3300031616 | Bacteria | 1083 |
| 483 | Ga0265314_10011769 | 3300031711 | Bacteria | 7196 |
| 484 | Ga0265314_10058937 | 3300031711 | Bacteria | 2629 |
| 485 | Ga0265342_10081350 | 3300031712 | Bacteria | 1870 |
| 486 | Ga0307516_10346404 | 3300031730 | Bacteria | 1152 |
| 487 | Ga0307405_10006369 | 3300031731 | Bacteria | 5802 |
| 488 | Ga0307405_10009680 | 3300031731 | Bacteria | 4953 |
| 489 | Ga0307405_10253818 | 3300031731 | Bacteria | 1310 |
| 490 | Ga0307413_10056193 | 3300031824 | Bacteria | 2399 |
| 491 | Ga0307413_10190893 | 3300031824 | Bacteria | 1471 |
| 492 | Ga0307518_10233755 | 3300031838 | Bacteria | 1187 |
| 493 | Ga0307410_10108851 | 3300031852 | Bacteria | 2002 |
| 494 | Ga0307410_10161971 | 3300031852 | Bacteria | 1677 |
| 495 | Ga0307410_10189257 | 3300031852 | Bacteria | 1564 |
| 496 | Ga0307406_10009322 | 3300031901 | Bacteria | 5501 |
| 497 | Ga0307406_10081421 | 3300031901 | Bacteria | 2153 |
| 498 | Ga0307406_10087312 | 3300031901 | Bacteria | 2090 |
| 499 | Ga0307406_10200855 | 3300031901 | Bacteria | 1467 |
| 500 | Ga0307407_10065456 | 3300031903 | Bacteria | 2140 |
| 501 | Ga0307407_10496013 | 3300031903 | Bacteria | 894 |
| 502 | Ga0307412_10014216 | 3300031911 | Bacteria | 4690 |
| 503 | Ga0307412_10022171 | 3300031911 | Bacteria | 3889 |
| 504 | Ga0307412_10064124 | 3300031911 | Bacteria | 2481 |
| 505 | Ga0307412_10085707 | 3300031911 | Bacteria | 2190 |
| 506 | Ga0307412_10103139 | 3300031911 | Bacteria | 2021 |
| 507 | Ga0307412_10104851 | 3300031911 | Bacteria | 2007 |
| 508 | Ga0307412_10264090 | 3300031911 | Bacteria | 1344 |
| 509 | Ga0307412_10625517 | 3300031911 | Bacteria | 915 |
| 510 | Ga0307412_10960940 | 3300031911 | Bacteria | 752 |
| 511 | Ga0307409_100134923 | 3300031995 | Bacteria | 2116 |
| 512 | Ga0307409_100542934 | 3300031995 | Bacteria | 1140 |
| 513 | Ga0307416_100004163 | 3300032002 | Bacteria | 8670 |
| 514 | Ga0307416_100050988 | 3300032002 | Bacteria | 3302 |
| 515 | Ga0307416_100367942 | 3300032002 | Bacteria | 1462 |
| 516 | Ga0307416_101294113 | 3300032002 | Bacteria | 835 |
| 517 | Ga0307414_10002973 | 3300032004 | Bacteria | 8971 |
| 518 | Ga0307414_10055406 | 3300032004 | Bacteria | 2776 |
| 519 | Ga0307414_10075866 | 3300032004 | Bacteria | 2441 |
| 520 | Ga0307414_10108443 | 3300032004 | Bacteria | 2106 |
| 521 | Ga0307411_10000528 | 3300032005 | Bacteria | 13457 |
| 522 | Ga0307411_10017762 | 3300032005 | Bacteria | 4064 |
| 523 | Ga0307411_10745652 | 3300032005 | Bacteria | 857 |
| 524 | Ga0307415_100011676 | 3300032126 | Bacteria | 5040 |
| 525 | Ga0307415_100752758 | 3300032126 | Bacteria | 885 |
| 526 | Ga0307510_10218823 | 3300033180 | Bacteria | 1418 |
| 527 | Ga0373940_0052288 | 3300035088 | Bacteria | 1150 |
| 528 | Ga0373943_0267748 | 3300035170 | Bacteria | 963 |
| 529 | Ga0316574_0340729 | 3300035398 | Bacteria | 950 |
| 530 | Ga0373931_0003751 | 3300035691 | Bacteria | 6870 |
| 531 | Ga0373931_0408658 | 3300035691 | Bacteria | 861 |
| 532 | Ga0373937_0024289 | 3300036401 | Bacteria | 5465 |
| 533 | Ga0373937_0048181 | 3300036401 | Bacteria | 3900 |
| 534 | Ga0373937_0099401 | 3300036401 | Bacteria | 2699 |
| 535 | Ga0373937_0341582 | 3300036401 | Bacteria | 1418 |
| 536 | Ga0373925_0062160 | 3300037068 | Bacteria | 2808 |
| 537 | Ga0373925_0376142 | 3300037068 | Bacteria | 1156 |
| 538 | Ga0436364_0516927 | 3300037853 | Bacteria | 1938 |
| 539 | Ga0436364_0791589 | 3300037853 | Bacteria | 3861 |
| 540 | Ga0436365_1599716 | 3300039437 | Bacteria | 29460 |
| 541 | Ga0436361_0057254 | 3300039447 | Bacteria | 8651 |
| 542 | Ga0436361_0606718 | 3300039447 | Bacteria | 5397 |
| 543 | Ga0436361_0991571 | 3300039447 | Bacteria | 8152 |
| 544 | Ga0436361_1094211 | 3300039447 | Bacteria | 10053 |
| 545 | Ga0439438_000002 | 3300041405 | Bacteria | 618223 |
| 546 | Ga0439447_004906 | 3300041407 | Bacteria | 4525 |
| 547 | Ga0451839_1570770 | 3300041496 | Unclassified | 1598 |
| 548 | Ga0451841_0746418 | 3300041498 | Bacteria | 1276 |
| 549 | Ga0451851_0269188 | 3300041507 | Bacteria | 1515 |
| 550 | Ga0451843_1443981 | 3300041509 | Bacteria | 793 |
| 551 | Ga0439441_024856 | 3300042001 | Bacteria | 1128 |
| 552 | Ga0439464_0009337 | 3300042439 | Bacteria | 2581 |
| 553 | Ga0439464_0011418 | 3300042439 | Bacteria | 2354 |
| 554 | Ga0450893_0000595 | 3300042532 | Bacteria | 5170 |
| 555 | Ga0451577_0503113 | 3300042876 | Bacteria | 1100 |
| 556 | Ga0439440_0021028 | 3300042993 | Bacteria | 1468 |
| 557 | Ga0466972_0074519 | 3300044658 | Bacteria | 1617 |
| 558 | Ga0453684_0063816 | 3300044712 | Bacteria | 4708 |
| 559 | Ga0453684_0110535 | 3300044712 | Bacteria | 3340 |
| 560 | Ga0453684_0194669 | 3300044712 | Bacteria | 2368 |
| 561 | Ga0453684_1344060 | 3300044712 | Bacteria | 743 |
| 562 | Ga0466957_0285841 | 3300044842 | Bacteria | 1105 |
| 563 | Ga0451576_0246624 | 3300045051 | Bacteria | 1866 |
| 564 | Ga0495617_000554 | 3300046452 | Bacteria | 19232 |
| 565 | Ga0495627_073813 | 3300046453 | Bacteria | 994 |
| 566 | Ga0495590_0003858 | 3300046457 | Bacteria | 6100 |
| 567 | Ga0495580_0000143 | 3300046472 | Bacteria | 51276 |
| 568 | Ga0495580_0422069 | 3300046472 | Bacteria | 897 |
| 569 | Ga0495584_0001236 | 3300046491 | Bacteria | 15593 |
| 570 | Ga0495584_0211580 | 3300046491 | Bacteria | 986 |
| 571 | Ga0495584_0315117 | 3300046491 | Bacteria | 794 |
| 572 | Ga0495585_0000050 | 3300046492 | Bacteria | 119283 |
| 573 | Ga0495585_0000053 | 3300046492 | Bacteria | 115559 |
| 574 | Ga0495585_0002270 | 3300046492 | Bacteria | 13878 |
| 575 | Ga0495585_0019274 | 3300046492 | Bacteria | 3934 |
| 576 | Ga0495596_0004585 | 3300046500 | Bacteria | 6703 |
| 577 | Ga0495607_0032804 | 3300046501 | Bacteria | 3165 |
| 578 | Ga0495583_0000318 | 3300046506 | Bacteria | 76178 |
| 579 | Ga0495583_0046727 | 3300046506 | Bacteria | 1995 |
| 580 | Ga0495606_0076693 | 3300046507 | Bacteria | 2088 |
| 581 | Ga0495606_0153892 | 3300046507 | Bacteria | 1347 |
| 582 | Ga0495610_0000012 | 3300046512 | Bacteria | 517442 |
| 583 | Ga0495616_0000860 | 3300046513 | Bacteria | 22061 |
| 584 | Ga0495616_0002305 | 3300046513 | Bacteria | 12769 |
| 585 | Ga0495616_0023292 | 3300046513 | Bacteria | 3332 |
| 586 | Ga0495643_0080075 | 3300046522 | Bacteria | 1701 |
| 587 | Ga0495648_0000080 | 3300046524 | Bacteria | 126026 |
| 588 | Ga0495648_0000320 | 3300046524 | Bacteria | 53330 |
| 589 | Ga0495654_0001046 | 3300046530 | Bacteria | 20265 |
| 590 | Ga0495654_0028958 | 3300046530 | Bacteria | 2828 |
| 591 | Ga0495654_0086072 | 3300046530 | Bacteria | 1465 |
| 592 | Ga0495665_0010830 | 3300046531 | Bacteria | 4934 |
| 593 | Ga0495598_0028406 | 3300046537 | Bacteria | 1551 |
| 594 | Ga0495609_0003471 | 3300046538 | Bacteria | 9018 |
| 595 | Ga0495597_0000687 | 3300046542 | Bacteria | 27336 |
| 596 | Ga0495633_0001928 | 3300046558 | Bacteria | 15107 |
| 597 | Ga0495633_0021967 | 3300046558 | Bacteria | 3184 |
| 598 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 599 | Ga0495668_0005283 | 3300046616 | Bacteria | 8832 |
| 600 | Ga0495611_0209906 | 3300046648 | Bacteria | 907 |
| 601 | Ga0495625_0000362 | 3300046660 | Bacteria | 69497 |
| 602 | Ga0495625_0031630 | 3300046660 | Bacteria | 3933 |
| 603 | Ga0495588_0264778 | 3300046674 | Unclassified | 906 |
| 604 | Ga0495670_0002312 | 3300046691 | Bacteria | 9417 |
| 605 | Ga0495671_0000006 | 3300046692 | Bacteria | 500471 |
| 606 | Ga0495660_0000484 | 3300046810 | Bacteria | 33161 |
| 607 | Ga0495604_0047813 | 3300047317 | Bacteria | 3331 |
| 608 | Ga0495636_0010356 | 3300047318 | Bacteria | 3682 |
| 609 | Ga0495683_0000079 | 3300047323 | Bacteria | 96333 |
| 610 | Ga0495681_0050816 | 3300047470 | Bacteria | 1952 |
| 611 | Ga0495686_0060297 | 3300047472 | Bacteria | 2359 |
| 612 | Ga0495615_0057830 | 3300048090 | Bacteria | 1016 |
| 613 | Ga0495626_0078800 | 3300048091 | Bacteria | 1467 |
| 614 | Ga0495626_0095229 | 3300048091 | Bacteria | 1304 |
| 615 | Ga0495626_0138329 | 3300048091 | Bacteria | 1034 |
| 616 | Ga0496100_0594439 | 3300048903 | Bacteria | 859 |
| 617 | Ga0496102_0001755 | 3300048905 | Bacteria | 18917 |
| 618 | Ga0496102_0036708 | 3300048905 | Bacteria | 4416 |
| 619 | Ga0496102_0047207 | 3300048905 | Bacteria | 3912 |
| 620 | Ga0496102_0102899 | 3300048905 | Bacteria | 2655 |
| 621 | Ga0496102_0839520 | 3300048905 | Bacteria | 841 |
| 622 | Ga0496104_0014231 | 3300048907 | Bacteria | 7181 |
| 623 | Ga0496104_1067454 | 3300048907 | Bacteria | 711 |
| 624 | Ga0496106_0014891 | 3300048909 | Bacteria | 5753 |
| 625 | Ga0496107_0029674 | 3300048910 | Bacteria | 3893 |
| 626 | Ga0496107_0030293 | 3300048910 | Bacteria | 3857 |
| 627 | Ga0496109_0061532 | 3300048912 | Bacteria | 3432 |
| 628 | Ga0496112_0005601 | 3300048915 | Bacteria | 10892 |
| 629 | Ga0496112_0349570 | 3300048915 | Bacteria | 1421 |
| 630 | Ga0496113_0033418 | 3300048916 | Bacteria | 3745 |
| 631 | Ga0496113_0303190 | 3300048916 | Unclassified | 1279 |
| 632 | Ga0496113_0425505 | 3300048916 | Bacteria | 1067 |
| 633 | Ga0496114_1025408 | 3300048917 | Bacteria | 709 |
| 634 | Ga0496121_0153883 | 3300048924 | Bacteria | 1689 |
| 635 | Ga0496122_0008622 | 3300048925 | Bacteria | 10945 |
| 636 | Ga0496123_0009128 | 3300048926 | Bacteria | 8972 |
| 637 | Ga0496124_0098966 | 3300048927 | Bacteria | 2365 |
| 638 | Ga0496126_0031046 | 3300048929 | Bacteria | 5054 |
| 639 | Ga0496126_0395996 | 3300048929 | Bacteria | 1121 |
| 640 | Ga0501310_003920 | 3300049130 | Bacteria | 1473 |
| 641 | Ga0495682_0040174 | 3300049460 | Bacteria | 1716 |
| 642 | Ga0501295_000664 | 3300049518 | Bacteria | 3227 |
| 643 | Ga0501300_004637 | 3300049523 | Bacteria | 2033 |
| 644 | Ga0501032_0127621 | 3300049569 | Bacteria | 1679 |
| 645 | Ga0501033_0003236 | 3300049570 | Bacteria | 13474 |
| 646 | Ga0501033_0010481 | 3300049570 | Bacteria | 7110 |
| 647 | Ga0501033_0033222 | 3300049570 | Bacteria | 3874 |
| 648 | Ga0501033_0084621 | 3300049570 | Bacteria | 2324 |
| 649 | Ga0501033_0099157 | 3300049570 | Bacteria | 2127 |
| 650 | Ga0501033_0106255 | 3300049570 | Bacteria | 2045 |
| 651 | Ga0501033_0177232 | 3300049570 | Bacteria | 1529 |
| 652 | Ga0501034_0014593 | 3300049571 | Bacteria | 8088 |
| 653 | Ga0501034_0029450 | 3300049571 | Bacteria | 5580 |
| 654 | Ga0501034_0043880 | 3300049571 | Bacteria | 4522 |
| 655 | Ga0501034_0113887 | 3300049571 | Bacteria | 2694 |
| 656 | Ga0501036_0001437 | 3300049572 | Bacteria | 18309 |
| 657 | Ga0501036_0083371 | 3300049572 | Bacteria | 2702 |
| 658 | Ga0501036_0179170 | 3300049572 | Bacteria | 1784 |
| 659 | Ga0501036_0184880 | 3300049572 | Bacteria | 1754 |
| 660 | Ga0501037_0005886 | 3300049573 | Bacteria | 8960 |
| 661 | Ga0501037_0017242 | 3300049573 | Bacteria | 5317 |
| 662 | Ga0501037_0074982 | 3300049573 | Bacteria | 2457 |
| 663 | Ga0501037_0109552 | 3300049573 | Bacteria | 1990 |
| 664 | Ga0501038_0002195 | 3300049574 | Bacteria | 18153 |
| 665 | Ga0501038_0009271 | 3300049574 | Bacteria | 9026 |
| 666 | Ga0501038_0418042 | 3300049574 | Bacteria | 1035 |
| 667 | Ga0501039_0034416 | 3300049575 | Bacteria | 3909 |
| 668 | Ga0501039_0123174 | 3300049575 | Bacteria | 2032 |
| 669 | Ga0501039_0313667 | 3300049575 | Bacteria | 1233 |
| 670 | Ga0501040_0000010 | 3300049576 | Bacteria | 80841 |
| 671 | Ga0501040_0077260 | 3300049576 | Bacteria | 2303 |
| 672 | Ga0501041_0008456 | 3300049577 | Bacteria | 6055 |
| 673 | Ga0501041_0040286 | 3300049577 | Bacteria | 2835 |
| 674 | Ga0501041_0150534 | 3300049577 | Bacteria | 1453 |
| 675 | Ga0501042_0000323 | 3300049578 | Bacteria | 23831 |
| 676 | Ga0501042_0074718 | 3300049578 | Bacteria | 2425 |
| 677 | Ga0501043_0023855 | 3300049579 | Bacteria | 4798 |
| 678 | Ga0501043_0025869 | 3300049579 | Bacteria | 4604 |
| 679 | Ga0501043_0124534 | 3300049579 | Bacteria | 2021 |
| 680 | Ga0501043_0299341 | 3300049579 | Bacteria | 1229 |
| 681 | Ga0501046_0004727 | 3300049580 | Bacteria | 12284 |
| 682 | Ga0501046_0123836 | 3300049580 | Bacteria | 1965 |
| 683 | Ga0501046_0135376 | 3300049580 | Bacteria | 1866 |
| 684 | Ga0501047_0000984 | 3300049581 | Bacteria | 28735 |
| 685 | Ga0501047_0009139 | 3300049581 | Bacteria | 9356 |
| 686 | Ga0501047_0093597 | 3300049581 | Bacteria | 2884 |
| 687 | Ga0501047_0106118 | 3300049581 | Bacteria | 2689 |
| 688 | Ga0501047_0186772 | 3300049581 | Bacteria | 1938 |
| 689 | Ga0501047_0250758 | 3300049581 | Bacteria | 1619 |
| 690 | Ga0501047_0302899 | 3300049581 | Unclassified | 1440 |
| 691 | Ga0501047_0305728 | 3300049581 | Bacteria | 1432 |
| 692 | Ga0501048_0020833 | 3300049582 | Bacteria | 4804 |
| 693 | Ga0501048_0084795 | 3300049582 | Bacteria | 2234 |
| 694 | Ga0501068_0024875 | 3300049584 | Bacteria | 3519 |
| 695 | Ga0501070_0070755 | 3300049586 | Bacteria | 2888 |
| 696 | Ga0501070_0082962 | 3300049586 | Bacteria | 2653 |
| 697 | Ga0501070_0121976 | 3300049586 | Bacteria | 2154 |
| 698 | Ga0501070_0130847 | 3300049586 | Bacteria | 2073 |
| 699 | Ga0501070_0298675 | 3300049586 | Bacteria | 1312 |
| 700 | Ga0501071_0020060 | 3300049587 | Bacteria | 4644 |
| 701 | Ga0501071_0084352 | 3300049587 | Bacteria | 2328 |
| 702 | Ga0501072_0033851 | 3300049588 | Bacteria | 4003 |
| 703 | Ga0501072_0039242 | 3300049588 | Bacteria | 3718 |
| 704 | Ga0501072_0150802 | 3300049588 | Bacteria | 1853 |
| 705 | Ga0501073_0116260 | 3300049589 | Bacteria | 1854 |
| 706 | Ga0501073_0330784 | 3300049589 | Bacteria | 1052 |
| 707 | Ga0501074_0135492 | 3300049590 | Bacteria | 1761 |
| 708 | Ga0501075_0000090 | 3300049591 | Bacteria | 41736 |
| 709 | Ga0501075_0058090 | 3300049591 | Bacteria | 2913 |
| 710 | Ga0501076_0003453 | 3300049592 | Bacteria | 11085 |
| 711 | Ga0501076_0019707 | 3300049592 | Bacteria | 5158 |
| 712 | Ga0501076_0597280 | 3300049592 | Bacteria | 911 |
| 713 | Ga0501077_0000017 | 3300049593 | Bacteria | 86892 |
| 714 | Ga0501077_0043870 | 3300049593 | Bacteria | 2841 |
| 715 | Ga0501077_0226542 | 3300049593 | Bacteria | 1188 |
| 716 | Ga0501211_000027 | 3300049658 | Bacteria | 10788 |
| 717 | Ga0501222_005706 | 3300049662 | Bacteria | 1674 |
| 718 | Ga0501223_020669 | 3300049663 | Bacteria | 1288 |
| 719 | Ga0501227_001013 | 3300049665 | Bacteria | 6227 |
| 720 | Ga0501233_030032 | 3300049668 | Bacteria | 1222 |
| 721 | Ga0501235_004365 | 3300049669 | Bacteria | 3059 |
| 722 | Ga0501236_017275 | 3300049670 | Bacteria | 1030 |
| 723 | Ga0501253_001290 | 3300049683 | Bacteria | 2508 |
| 724 | Ga0501255_000775 | 3300049684 | Bacteria | 2334 |
| 725 | Ga0501257_000064 | 3300049686 | Bacteria | 29858 |
| 726 | Ga0501221_000998 | 3300049704 | Bacteria | 4650 |
| 727 | Ga0501229_006708 | 3300049706 | Bacteria | 1426 |
| 728 | Ga0501079_0000063 | 3300049741 | Bacteria | 48461 |
| 729 | Ga0501079_0133991 | 3300049741 | Bacteria | 1928 |
| 730 | Ga0501080_0020796 | 3300049742 | Bacteria | 6075 |
| 731 | Ga0501080_0054679 | 3300049742 | Bacteria | 3717 |
| 732 | Ga0501081_0000085 | 3300049743 | Bacteria | 37187 |
| 733 | Ga0501081_0044647 | 3300049743 | Bacteria | 3042 |
| 734 | Ga0501081_0081609 | 3300049743 | Bacteria | 2265 |
| 735 | Ga0501081_0378437 | 3300049743 | Bacteria | 1046 |
| 736 | Ga0501083_0057315 | 3300049744 | Bacteria | 2608 |
| 737 | Ga0501262_001434 | 3300049759 | Bacteria | 2674 |
| 738 | Ga0501267_000696 | 3300049764 | Bacteria | 2696 |
| 739 | Ga0501268_008679 | 3300049765 | Bacteria | 1546 |
| 740 | Ga0501269_010095 | 3300049766 | Bacteria | 1146 |
| 741 | Ga0501274_003133 | 3300049771 | Bacteria | 1325 |
| 742 | Ga0501280_004097 | 3300049776 | Bacteria | 2168 |
| 743 | Ga0501282_019814 | 3300049778 | Bacteria | 737 |
| 744 | Ga0501283_019534 | 3300049779 | Bacteria | 1073 |
| 745 | Ga0501035_0002403 | 3300049822 | Bacteria | 18351 |
| 746 | Ga0501035_0003576 | 3300049822 | Bacteria | 14852 |
| 747 | Ga0501035_0010161 | 3300049822 | Bacteria | 8736 |
| 748 | Ga0501035_0011687 | 3300049822 | Bacteria | 8137 |
| 749 | Ga0501035_0038689 | 3300049822 | Bacteria | 4318 |
| 750 | Ga0501035_0099678 | 3300049822 | Bacteria | 2550 |
| 751 | Ga0501035_0367969 | 3300049822 | Bacteria | 1200 |
| 752 | Ga0501035_0553431 | 3300049822 | Bacteria | 942 |
| 753 | Ga0501044_0003486 | 3300049823 | Bacteria | 17718 |
| 754 | Ga0501044_0013688 | 3300049823 | Bacteria | 8767 |
| 755 | Ga0501044_0019918 | 3300049823 | Bacteria | 7166 |
| 756 | Ga0501044_0023203 | 3300049823 | Bacteria | 6602 |
| 757 | Ga0501044_0093581 | 3300049823 | Bacteria | 3030 |
| 758 | Ga0501044_0248177 | 3300049823 | Bacteria | 1722 |
| 759 | Ga0501045_0004295 | 3300049824 | Bacteria | 9827 |
| 760 | Ga0501045_0056311 | 3300049824 | Bacteria | 2875 |
| 761 | nmdc:mga00v17_412249_c1 | 3300050491 | Bacteria | 878 |
| 762 | nmdc:mga0yw44_250829_c1 | 3300050492 | Bacteria | 1178 |
| 763 | nmdc:mga0k408_139038_c1 | 3300050493 | Bacteria | 1444 |
| 764 | nmdc:mga0k408_33801_c1 | 3300050493 | Bacteria | 2926 |
| 765 | nmdc:mga0k408_7914_c1 | 3300050493 | Bacteria | 5692 |
| 766 | nmdc:mga06z11_118651_c1 | 3300050494 | Bacteria | 1473 |
| 767 | nmdc:mga06z11_3889_c1 | 3300050494 | Bacteria | 5823 |
| 768 | nmdc:mga07m45_15425_c1 | 3300050496 | Bacteria | 4080 |
| 769 | nmdc:mga07m45_46577_c1 | 3300050496 | Bacteria | 2437 |
| 770 | nmdc:mga07m45_5812_c1 | 3300050496 | Bacteria | 6184 |
| 771 | nmdc:mga05p37_13597_c1 | 3300050507 | Bacteria | 9754 |
| 772 | nmdc:mga05p37_23630_c1 | 3300050507 | Bacteria | 7462 |
| 773 | nmdc:mga09592_11219_c1 | 3300050508 | Bacteria | 7291 |
| 774 | nmdc:mga09592_61725_c1 | 3300050508 | Bacteria | 3170 |
| 775 | nmdc:mga0qj67_11191_c1 | 3300050509 | Bacteria | 6719 |
| 776 | nmdc:mga0qj67_32483_c1 | 3300050509 | Bacteria | 4070 |
| 777 | nmdc:mga0qj67_387_c1 | 3300050509 | Bacteria | 30412 |
| 778 | nmdc:mga0qj67_503545_c1 | 3300050509 | Bacteria | 973 |
| 779 | nmdc:mga06r32_14997_c1 | 3300050510 | Bacteria | 7034 |
| 780 | nmdc:mga06r32_33713_c1 | 3300050510 | Bacteria | 4824 |
| 781 | nmdc:mga06r32_497125_c1 | 3300050510 | Bacteria | 1197 |
| 782 | nmdc:mga08y16_12498_c2 | 3300050511 | Bacteria | 5604 |
| 783 | nmdc:mga08y16_162264_c1 | 3300050511 | Bacteria | 2322 |
| 784 | nmdc:mga08y16_267526_c1 | 3300050511 | Bacteria | 1765 |
| 785 | nmdc:mga08y16_95098_c1 | 3300050511 | Bacteria | 3104 |
| 786 | nmdc:mga0n895_148318_c1 | 3300050512 | Bacteria | 2375 |
| 787 | nmdc:mga0n895_531651_c1 | 3300050512 | Bacteria | 1183 |
| 788 | nmdc:mga0n895_81312_c1 | 3300050512 | Bacteria | 3229 |
| 789 | nmdc:mga0rr50_101551_c1 | 3300050513 | Bacteria | 2261 |
| 790 | nmdc:mga0rr50_60001_c1 | 3300050513 | Bacteria | 2859 |
| 791 | nmdc:mga0a205_25112_c1 | 3300050515 | Bacteria | 5673 |
| 792 | nmdc:mga0sz30_227324_c1 | 3300050516 | Bacteria | 830 |
| 793 | Ga0500643_036169 | 3300053087 | Bacteria | 1476 |
| 794 | Ga0500643_079371 | 3300053087 | Bacteria | 903 |
| 795 | Ga0500643_081047 | 3300053087 | Bacteria | 891 |
| 796 | Ga0500643_103732 | 3300053087 | Bacteria | 770 |
| 797 | Ga0500641_0103669 | 3300053096 | Bacteria | 1221 |
| 798 | Ga0500557_020196 | 3300053105 | Bacteria | 1891 |
| 799 | Ga0500562_000349 | 3300053108 | Bacteria | 11114 |
| 800 | Ga0500592_000217 | 3300053116 | Bacteria | 10476 |
| 801 | Ga0500608_010809 | 3300053122 | Bacteria | 3934 |
| 802 | Ga0500618_000391 | 3300053125 | Bacteria | 30070 |
| 803 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 804 | Ga0500658_0014928 | 3300053134 | Bacteria | 2879 |
| 805 | Ga0500564_186009 | 3300053138 | Bacteria | 863 |
| 806 | Ga0500604_0035494 | 3300053151 | Bacteria | 1484 |
| 807 | Ga0500616_0004492 | 3300053153 | Bacteria | 9917 |
| 808 | Ga0500622_0000023 | 3300053156 | Bacteria | 251170 |
| 809 | Ga0500622_0283844 | 3300053156 | Bacteria | 712 |
| 810 | Ga0500627_0000027 | 3300053158 | Bacteria | 99420 |
| 811 | Ga0500627_0000230 | 3300053158 | Bacteria | 15971 |
| 812 | Ga0501084_0033174 | 3300054114 | Bacteria | 4318 |
| 813 | Ga0501082_0000908 | 3300060353 | Bacteria | 26064 |
| 814 | Ga0501082_0046584 | 3300060353 | Bacteria | 3737 |
| 815 | Ga0501082_0224781 | 3300060353 | Bacteria | 1633 |
| 816 | Ga0530510_0132847 | 3300061734 | Bacteria | 1831 |
| 817 | Ga0530510_0300547 | 3300061734 | Bacteria | 1201 |
| 818 | 2547374908 | 2547132103 | Bacteria | 5115736 |
| 819 | 2501077461 | 2501025502 | Bacteria | 9641094 |
| 820 | 2511092593 | 2510917013 | Bacteria | 9951648 |
| 821 | 2513557193 | 2513237082 | Bacteria | 8640282 |
| 822 | 2513562819 | 2513237083 | Bacteria | 8410967 |
| 823 | 2515683113 | 2515154122 | Bacteria | 8609520 |
| 824 | 2526211242 | 2526164512 | Bacteria | 4025691 |
| 825 | 2643835631 | 2643221563 | Bacteria | 4726935 |
| 826 | 2644056557 | 2643221608 | Bacteria | 4724829 |
| 827 | 2687583839 | 2687453130 | Bacteria | 4227172 |
| 828 | 2722885979 | 2721755523 | Bacteria | 6430384 |
| 829 | 2745162240 | 2744054655 | Bacteria | 3552603 |
| 830 | 2746090958 | 2744054900 | Bacteria | 8399525 |
| 831 | 2746093507 | 2744054901 | Bacteria | 8397047 |
| 832 | 2812368642 | 2811994881 | Bacteria | 6298475 |
| 833 | 2823422660 | 2823421272 | Bacteria | 5372474 |
| 834 | 2839144253 | 2839138175 | Bacteria | 6549354 |
| 835 | 2842326359 | 2842324504 | Bacteria | 9364110 |
| 836 | 2842351122 | 2842348783 | Bacteria | 9002918 |
| 837 | 2842455670 | 2842454564 | Bacteria | 8730687 |
| 838 | 2843695697 | 2843690924 | Bacteria | 5169057 |
| 839 | 2857505825 | 2857504554 | Bacteria | 5369913 |
| 840 | 2857568318 | 2857564685 | Bacteria | 6290584 |
| 841 | 2881104249 | 2881101125 | Bacteria | 4590519 |
| 842 | 2881928003 | 2881927736 | Bacteria | 3993927 |
| 843 | 2887379156 | 2887375801 | Bacteria | 5334027 |
| 844 | 2887631410 | 2887630918 | Bacteria | 3239855 |
| 845 | 2895516954 | 2895511927 | Bacteria | 6802080 |
| 846 | 2919501933 | 2919501602 | Bacteria | 5286340 |
| 847 | 2919509092 | 2919506607 | Bacteria | 3392955 |
| 848 | 2923522701 | 2923519811 | Bacteria | 6298479 |
| 849 | 2926063606 | 2926063275 | Bacteria | 5285848 |
| 850 | 2932423370 | 2932422444 | Bacteria | 4678430 |
| 851 | 2974320744 | 2974320154 | Bacteria | 4571377 |
| 852 | 2998344880 | 2998344455 | Bacteria | 4222996 |
| 853 | 8003955977 | 8003955200 | Bacteria | 8601927 |
| 854 | JGI24750J21931_1016224 | |||
| 855 | JGI24749J21850_1028161 | |||
| 856 | JGI24744J21845_10039574 | |||
| 857 | JGI24034J26672_10006470 | |||
| 858 | rootL2_10083363 | |||
| 859 | Ga0055526_1013787 | |||
| 860 | Ga0055537_1005105 | |||
| 861 | Ga0055524_1001263 | |||
| 862 | Ga0055536_1003133 | |||
| 863 | Ga0055536_1004801 | |||
| 864 | Ga0055536_1005155 | |||
| 865 | Ga0055534_1010687 | |||
| 866 | Ga0055530_10000310 | |||
| 867 | Ga0055531_10002945 | |||
| 868 | Ga0055531_10007831 | |||
| 869 | Ga0055531_10027351 | |||
| 870 | Ga0058692_1000431 | |||
| 871 | Ga0065704_10148704 | |||
| 872 | Ga0065715_10100239 | |||
| 873 | Ga0065707_10029968 | |||
| 874 | Ga0070658_10002553 | |||
| 875 | Ga0070676_10260264 | |||
| 876 | Ga0070676_10261845 | |||
| 877 | Ga0070683_100358925 | |||
| 878 | Ga0070683_100508954 | |||
| 879 | Ga0070690_100003142 | |||
| 880 | Ga0070670_100006524 | |||
| 881 | Ga0070670_100026480 | |||
| 882 | Ga0070670_100134969 | |||
| 883 | Ga0070670_100304558 | |||
| 884 | Ga0070670_100468456 | |||
| 885 | Ga0070670_100556076 | |||
| 886 | Ga0070677_10006039 | |||
| 887 | Ga0070677_10091383 | |||
| 888 | Ga0068869_100001182 | |||
| 889 | Ga0068869_100017486 | |||
| 890 | Ga0068869_100557786 | |||
| 891 | Ga0068869_100942753 | |||
| 892 | Ga0070666_10026489 | |||
| 893 | Ga0070666_10144040 | |||
| 894 | Ga0070680_100177831 | |||
| 895 | Ga0070660_100003289 | |||
| 896 | Ga0070660_100018896 | |||
| 897 | Ga0070689_100008082 | |||
| 898 | Ga0070687_100000376 | |||
| 899 | Ga0070661_100036204 | |||
| 900 | Ga0070661_100245864 | |||
| 901 | Ga0070668_100613705 | |||
| 902 | Ga0070669_100000001 | |||
| 903 | Ga0070669_100169463 | |||
| 904 | Ga0070675_100004297 | |||
| 905 | Ga0070675_100018240 | |||
| 906 | Ga0070675_100022287 | |||
| 907 | Ga0070671_100000002 | |||
| 908 | Ga0070671_100029085 | |||
| 909 | Ga0070671_100041611 | |||
| 910 | Ga0070674_100000167 | |||
| 911 | Ga0070673_100056243 | |||
| 912 | Ga0070688_100000491 | |||
| 913 | Ga0070688_100233179 | |||
| 914 | Ga0070659_100000743 | |||
| 915 | Ga0070659_100000820 | |||
| 916 | Ga0070659_100004983 | |||
| 917 | Ga0070659_100030874 | |||
| 918 | Ga0070659_100091984 | |||
| 919 | Ga0070667_100004785 | |||
| 920 | Ga0070703_10031602 | |||
| 921 | Ga0070701_10043469 | |||
| 922 | Ga0070705_100000983 | |||
| 923 | Ga0070705_100005445 | |||
| 924 | Ga0070705_100482493 | |||
| 925 | Ga0070700_100025169 | |||
| 926 | Ga0070700_100295253 | |||
| 927 | Ga0070694_100324945 | |||
| 928 | Ga0070708_100040828 | |||
| 929 | Ga0070663_100015868 | |||
| 930 | Ga0070663_100501343 | |||
| 931 | Ga0070678_100003331 | |||
| 932 | Ga0070678_100006518 | |||
| 933 | Ga0070678_100020327 | |||
| 934 | Ga0070662_100002454 | |||
| 935 | Ga0070681_10001866 | |||
| 936 | Ga0070681_10015969 | |||
| 937 | Ga0070681_10095047 | |||
| 938 | Ga0070681_10176869 | |||
| 939 | Ga0070681_10351413 | |||
| 940 | Ga0068867_100014253 | |||
| 941 | Ga0068867_100127993 | |||
| 942 | Ga0070685_10000312 | |||
| 943 | Ga0070706_100003178 | |||
| 944 | Ga0070707_100130219 | |||
| 945 | Ga0070679_100022623 | |||
| 946 | Ga0070679_100055690 | |||
| 947 | Ga0070679_100226611 | |||
| 948 | Ga0070679_100403233 | |||
| 949 | Ga0070684_100044363 | |||
| 950 | Ga0068853_100005451 | |||
| 951 | Ga0068853_100007924 | |||
| 952 | Ga0068853_100501382 | |||
| 953 | Ga0070672_100011434 | |||
| 954 | Ga0070672_100441412 | |||
| 955 | Ga0070686_100004704 | |||
| 956 | Ga0070696_100033486 | |||
| 957 | Ga0070696_100047787 | |||
| 958 | Ga0070693_100000389 | |||
| 959 | Ga0070693_100307119 | |||
| 960 | Ga0070665_100058556 | |||
| 961 | Ga0070665_100181062 | |||
| 962 | Ga0070665_100273288 | |||
| 963 | Ga0070704_100018066 | |||
| 964 | Ga0070704_100193390 | |||
| 965 | Ga0068855_100001278 | |||
| 966 | Ga0068855_100001819 | |||
| 967 | Ga0070664_100011160 | |||
| 968 | Ga0068857_100214791 | |||
| 969 | Ga0068854_100032491 | |||
| 970 | Ga0068854_100057209 | |||
| 971 | Ga0068854_100707637 | |||
| 972 | Ga0068856_100012081 | |||
| 973 | Ga0068856_100020253 | |||
| 974 | Ga0068856_100295606 | |||
| 975 | Ga0068856_100669876 | |||
| 976 | Ga0070702_100349868 | |||
| 977 | Ga0068852_100004791 | |||
| 978 | Ga0068852_100251423 | |||
| 979 | Ga0068859_100002725 | |||
| 980 | Ga0068864_100000323 | |||
| 981 | Ga0068864_100040657 | |||
| 982 | Ga0068864_100162383 | |||
| 983 | Ga0068864_100207846 | |||
| 984 | Ga0068861_100001192 | |||
| 985 | Ga0068861_100002755 | |||
| 986 | Ga0068861_100033317 | |||
| 987 | Ga0068851_10000396 | |||
| 988 | Ga0068870_10000513 | |||
| 989 | Ga0068870_10001473 | |||
| 990 | Ga0068870_10059711 | |||
| 991 | Ga0068870_10138612 | |||
| 992 | Ga0068863_100011337 | |||
| 993 | Ga0068863_100017755 | |||
| 994 | Ga0068863_100081617 | |||
| 995 | Ga0068863_100084708 | |||
| 996 | Ga0068863_100288715 | |||
| 997 | Ga0068863_100290501 | |||
| 998 | Ga0068858_100024171 | |||
| 999 | Ga0068858_100107416 | |||
| 1000 | Ga0068858_100230425 | |||
| 1001 | Ga0068858_100682680 | |||
| 1002 | Ga0068860_100057650 | |||
| 1003 | Ga0068860_100286332 | |||
| 1004 | Ga0068860_100296685 | |||
| 1005 | Ga0068862_100000856 | |||
| 1006 | Ga0068862_100004739 | |||
| 1007 | Ga0068862_100019061 | |||
| 1008 | Ga0068862_100204582 | |||
| 1009 | Ga0081455_10035349 | |||
| 1010 | Ga0081455_10159847 | |||
| 1011 | Ga0081540_1000069 | |||
| 1012 | Ga0081540_1000394 | |||
| 1013 | Ga0075365_10065906 | |||
| 1014 | Ga0075368_10000982 | |||
| 1015 | Ga0075363_100071829 | |||
| 1016 | Ga0075432_10126682 | |||
| 1017 | Ga0070715_10070721 | |||
| 1018 | Ga0070715_10097515 | |||
| 1019 | Ga0075362_10010431 | |||
| 1020 | Ga0075367_10014576 | |||
| 1021 | Ga0075367_10018531 | |||
| 1022 | Ga0075366_10068062 | |||
| 1023 | Ga0097621_100000838 | |||
| 1024 | Ga0097621_100016607 | |||
| 1025 | Ga0097621_100103834 | |||
| 1026 | Ga0075370_10091817 | |||
| 1027 | Ga0068871_100000675 | |||
| 1028 | Ga0068871_100000829 | |||
| 1029 | Ga0068871_100054493 | |||
| 1030 | Ga0068871_100191445 | |||
| 1031 | Ga0075428_100593091 | |||
| 1032 | Ga0075430_100005542 | |||
| 1033 | Ga0075430_100018913 | |||
| 1034 | Ga0075430_100334527 | |||
| 1035 | Ga0075431_100001427 | |||
| 1036 | Ga0075431_100248618 | |||
| 1037 | Ga0075431_100416241 | |||
| 1038 | Ga0075431_100625367 | |||
| 1039 | Ga0075433_10064014 | |||
| 1040 | Ga0075434_100084101 | |||
| 1041 | Ga0075429_100054288 | |||
| 1042 | Ga0097620_100002725 | |||
| 1043 | Ga0079104_1000020 | |||
| 1044 | Ga0075435_100060907 | |||
| 1045 | Ga0105244_10069369 | |||
| 1046 | Ga0105250_10000684 | |||
| 1047 | Ga0105240_10001833 | |||
| 1048 | Ga0105240_10103614 | |||
| 1049 | Ga0111539_10001473 | |||
| 1050 | Ga0111539_10118726 | |||
| 1051 | Ga0111539_10191639 | |||
| 1052 | Ga0105245_10001784 | |||
| 1053 | Ga0105247_10000499 | |||
| 1054 | Ga0105247_10001755 | |||
| 1055 | Ga0105247_10092067 | |||
| 1056 | Ga0114129_10005737 | |||
| 1057 | Ga0114129_10028119 | |||
| 1058 | Ga0114129_10034844 | |||
| 1059 | Ga0114129_10845816 | |||
| 1060 | Ga0114129_11530976 | |||
| 1061 | Ga0105243_10003516 | |||
| 1062 | Ga0105243_10040411 | |||
| 1063 | Ga0105241_10099312 | |||
| 1064 | Ga0105241_10106187 | |||
| 1065 | Ga0105241_10491433 | |||
| 1066 | Ga0105241_10623475 | |||
| 1067 | Ga0105242_10000776 | |||
| 1068 | Ga0105242_10016603 | |||
| 1069 | Ga0105248_10052796 | |||
| 1070 | Ga0105248_10270480 | |||
| 1071 | Ga0105237_10000240 | |||
| 1072 | Ga0105237_10151970 | |||
| 1073 | Ga0105238_10001156 | |||
| 1074 | Ga0105238_10002207 | |||
| 1075 | Ga0105238_10046900 | |||
| 1076 | Ga0105249_10002404 | |||
| 1077 | Ga0105249_10064841 | |||
| 1078 | Ga0105239_10003666 | |||
| 1079 | Ga0105239_10261190 | |||
| 1080 | Ga0105246_10005681 | |||
| 1081 | Ga0157373_10001212 | |||
| 1082 | Ga0157373_10009846 | |||
| 1083 | Ga0157371_10001038 | |||
| 1084 | Ga0157371_10004495 | |||
| 1085 | Ga0157371_10017286 | |||
| 1086 | Ga0157370_10000662 | |||
| 1087 | Ga0157370_10002750 | |||
| 1088 | Ga0157370_10008238 | |||
| 1089 | Ga0157369_10024719 | |||
| 1090 | Ga0157374_10000876 | |||
| 1091 | Ga0157374_10593162 | |||
| 1092 | Ga0157378_10000880 | |||
| 1093 | Ga0157378_10183652 | |||
| 1094 | Ga0157378_10420922 | |||
| 1095 | Ga0163162_10001408 | |||
| 1096 | Ga0163162_10017854 | |||
| 1097 | Ga0163162_10468019 | |||
| 1098 | Ga0163162_10867132 | |||
| 1099 | Ga0163162_11403658 | |||
| 1100 | Ga0157372_10013278 | |||
| 1101 | Ga0157372_10030186 | |||
| 1102 | Ga0157375_10012511 | |||
| 1103 | Ga0157375_10080250 | |||
| 1104 | Ga0157375_10265028 | |||
| 1105 | Ga0163163_10071581 | |||
| 1106 | Ga0163163_10076193 | |||
| 1107 | Ga0163163_10158478 | |||
| 1108 | Ga0157380_10011035 | |||
| 1109 | Ga0157380_10032233 | |||
| 1110 | Ga0157380_10152128 | |||
| 1111 | Ga0157377_10000421 | |||
| 1112 | Ga0157379_10002360 | |||
| 1113 | Ga0157379_10095916 | |||
| 1114 | Ga0157379_10223518 | |||
| 1115 | Ga0157379_10330518 | |||
| 1116 | Ga0157379_10416273 | |||
| 1117 | Ga0157376_10004912 | |||
| 1118 | Ga0157376_10047151 | |||
| 1119 | Ga0157376_10066788 | |||
| 1120 | Ga0157376_10081219 | |||
| 1121 | Ga0182007_10043767 | |||
| 1122 | Ga0183369_1007 | |||
| 1123 | Ga0163161_10019395 | |||
| 1124 | Ga0213872_10000211 | |||
| 1125 | Ga0213872_10029040 | |||
| 1126 | Ga0213876_10000987 | |||
| 1127 | Ga0213876_10130061 | |||
| 1128 | Ga0209674_100635 | |||
| 1129 | Ga0209026_1000037 | |||
| 1130 | Ga0209565_1001442 | |||
| 1131 | Ga0209675_1000025 | |||
| 1132 | Ga0209675_1003444 | |||
| 1133 | Ga0209676_1000198 | |||
| 1134 | Ga0209676_1001165 | |||
| 1135 | Ga0209676_1001500 | |||
| 1136 | Ga0209676_1050538 | |||
| 1137 | Ga0209025_1028558 | |||
| 1138 | Ga0209025_1096882 | |||
| 1139 | Ga0209564_1003296 | |||
| 1140 | Ga0209758_1007867 | |||
| 1141 | Ga0209050_1000104 | |||
| 1142 | Ga0209050_1002306 | |||
| 1143 | Ga0209050_1013188 | |||
| 1144 | Ga0209256_1000964 | |||
| 1145 | Ga0209257_1000860 | |||
| 1146 | Ga0209257_1001790 | |||
| 1147 | Ga0209257_1003091 | |||
| 1148 | Ga0209257_1018503 | |||
| 1149 | Ga0207697_10000248 | |||
| 1150 | Ga0207697_10001354 | |||
| 1151 | Ga0207697_10004831 | |||
| 1152 | Ga0207656_10007391 | |||
| 1153 | Ga0207656_10048795 | |||
| 1154 | Ga0207696_1002516 | |||
| 1155 | Ga0207682_10000093 | |||
| 1156 | Ga0207682_10001426 | |||
| 1157 | Ga0207642_10099894 | |||
| 1158 | Ga0207710_10004910 | |||
| 1159 | Ga0207710_10036099 | |||
| 1160 | Ga0207688_10022722 | |||
| 1161 | Ga0207680_10000256 | |||
| 1162 | Ga0207680_10021323 | |||
| 1163 | Ga0207680_10124747 | |||
| 1164 | Ga0207680_10139928 | |||
| 1165 | Ga0207647_10020714 | |||
| 1166 | Ga0207647_10272005 | |||
| 1167 | Ga0207645_10000101 | |||
| 1168 | Ga0207645_10139169 | |||
| 1169 | Ga0207643_10000166 | |||
| 1170 | Ga0207643_10002758 | |||
| 1171 | Ga0207643_10163904 | |||
| 1172 | Ga0207643_10209240 | |||
| 1173 | Ga0207705_10029847 | |||
| 1174 | Ga0207705_10061876 | |||
| 1175 | Ga0207684_10008871 | |||
| 1176 | Ga0207654_10414508 | |||
| 1177 | Ga0207707_10012137 | |||
| 1178 | Ga0207707_10013190 | |||
| 1179 | Ga0207707_10092784 | |||
| 1180 | Ga0207707_10138615 | |||
| 1181 | Ga0207707_10145645 | |||
| 1182 | Ga0207695_10087457 | |||
| 1183 | Ga0207695_10114082 | |||
| 1184 | Ga0207663_10391493 | |||
| 1185 | Ga0207660_10294296 | |||
| 1186 | Ga0207662_10000010 | |||
| 1187 | Ga0207657_10000353 | |||
| 1188 | Ga0207657_10030005 | |||
| 1189 | Ga0207657_10038401 | |||
| 1190 | Ga0207649_10045312 | |||
| 1191 | Ga0207649_10056595 | |||
| 1192 | Ga0207652_10023091 | |||
| 1193 | Ga0207652_10168974 | |||
| 1194 | Ga0207652_10327530 | |||
| 1195 | Ga0207646_10041233 | |||
| 1196 | Ga0207681_10000002 | |||
| 1197 | Ga0207681_10019058 | |||
| 1198 | Ga0207694_10000623 | |||
| 1199 | Ga0207694_10021700 | |||
| 1200 | Ga0207694_10062426 | |||
| 1201 | Ga0207650_10003185 | |||
| 1202 | Ga0207650_10024028 | |||
| 1203 | Ga0207650_10201645 | |||
| 1204 | Ga0207650_10219288 | |||
| 1205 | Ga0207659_10020488 | |||
| 1206 | Ga0207659_10109120 | |||
| 1207 | Ga0207659_10680183 | |||
| 1208 | Ga0207687_10001680 | |||
| 1209 | Ga0207687_10085191 | |||
| 1210 | Ga0207700_10026229 | |||
| 1211 | Ga0207644_10000002 | |||
| 1212 | Ga0207644_10169640 | |||
| 1213 | Ga0207644_10189599 | |||
| 1214 | Ga0207644_10596442 | |||
| 1215 | Ga0207644_10869035 | |||
| 1216 | Ga0207690_10000424 | |||
| 1217 | Ga0207690_10001856 | |||
| 1218 | Ga0207690_10003818 | |||
| 1219 | Ga0207690_10327261 | |||
| 1220 | Ga0207706_10000077 | |||
| 1221 | Ga0207706_10008405 | |||
| 1222 | Ga0207686_10471912 | |||
| 1223 | Ga0207709_10000055 | |||
| 1224 | Ga0207709_10021881 | |||
| 1225 | Ga0207670_10018583 | |||
| 1226 | Ga0207669_10031514 | |||
| 1227 | Ga0207704_10009730 | |||
| 1228 | Ga0207704_10441779 | |||
| 1229 | Ga0207665_10117829 | |||
| 1230 | Ga0207665_10170312 | |||
| 1231 | Ga0207691_10000033 | |||
| 1232 | Ga0207691_10000680 | |||
| 1233 | Ga0207691_10004283 | |||
| 1234 | Ga0207711_10036711 | |||
| 1235 | Ga0207711_10675841 | |||
| 1236 | Ga0207689_10003350 | |||
| 1237 | Ga0207689_10032746 | |||
| 1238 | Ga0207689_10403368 | |||
| 1239 | Ga0207689_10653300 | |||
| 1240 | Ga0207661_10038621 | |||
| 1241 | Ga0207661_10799434 | |||
| 1242 | Ga0207679_10023078 | |||
| 1243 | Ga0207667_10008704 | |||
| 1244 | Ga0207667_10015762 | |||
| 1245 | Ga0207651_10014737 | |||
| 1246 | Ga0207651_10066916 | |||
| 1247 | Ga0207712_10002383 | |||
| 1248 | Ga0207712_10008093 | |||
| 1249 | Ga0207668_10097860 | |||
| 1250 | Ga0207640_10041946 | |||
| 1251 | Ga0207640_10117583 | |||
| 1252 | Ga0207640_10230495 | |||
| 1253 | Ga0207640_10402962 | |||
| 1254 | Ga0207658_10010583 | |||
| 1255 | Ga0207658_10029130 | |||
| 1256 | Ga0207658_10039364 | |||
| 1257 | Ga0207677_10004853 | |||
| 1258 | Ga0207677_10019078 | |||
| 1259 | Ga0207703_10014955 | |||
| 1260 | Ga0207703_10024943 | |||
| 1261 | Ga0207703_10072035 | |||
| 1262 | Ga0207639_10657331 | |||
| 1263 | Ga0207678_10000464 | |||
| 1264 | Ga0207678_10691855 | |||
| 1265 | Ga0207708_10011861 | |||
| 1266 | Ga0207708_10082139 | |||
| 1267 | Ga0207708_10379530 | |||
| 1268 | Ga0207708_10452851 | |||
| 1269 | Ga0207702_10229162 | |||
| 1270 | Ga0207641_10009679 | |||
| 1271 | Ga0207641_10015606 | |||
| 1272 | Ga0207641_10115063 | |||
| 1273 | Ga0207641_10459667 | |||
| 1274 | Ga0207648_10000189 | |||
| 1275 | Ga0207648_10015036 | |||
| 1276 | Ga0207648_10459721 | |||
| 1277 | Ga0207676_10000304 | |||
| 1278 | Ga0207676_10007112 | |||
| 1279 | Ga0207676_10026418 | |||
| 1280 | Ga0207676_10093156 | |||
| 1281 | Ga0207676_10489054 | |||
| 1282 | Ga0207674_10000224 | |||
| 1283 | Ga0207674_10368821 | |||
| 1284 | Ga0207675_100000043 | |||
| 1285 | Ga0207675_100000137 | |||
| 1286 | Ga0207675_100019121 | |||
| 1287 | Ga0207675_100042371 | |||
| 1288 | Ga0207683_10011248 | |||
| 1289 | Ga0207683_10023264 | |||
| 1290 | Ga0207683_10031886 | |||
| 1291 | Ga0207683_10188941 | |||
| 1292 | Ga0207683_10498685 | |||
| 1293 | Ga0207698_10001141 | |||
| 1294 | Ga0209281_1000002 | |||
| 1295 | Ga0209983_1013907 | |||
| 1296 | Ga0209813_10002831 | |||
| 1297 | Ga0209974_10019699 | |||
| 1298 | Ga0207428_10000018 | |||
| 1299 | Ga0207428_10000043 | |||
| 1300 | Ga0207428_10275384 | |||
| 1301 | Ga0268266_10010399 | |||
| 1302 | Ga0268266_10041792 | |||
| 1303 | Ga0268266_10227150 | |||
| 1304 | Ga0268265_10000264 | |||
| 1305 | Ga0268265_10023793 | |||
| 1306 | Ga0268265_10032629 | |||
| 1307 | Ga0268265_10103258 | |||
| 1308 | Ga0268265_10214672 | |||
| 1309 | Ga0268265_10477623 | |||
| 1310 | Ga0268264_10000071 | |||
| 1311 | Ga0268264_10120771 | |||
| 1312 | Ga0268264_10238196 | |||
| 1313 | Ga0268264_10522847 | |||
| 1314 | Ga0265323_10075991 | |||
| 1315 | Ga0307515_10003406 | |||
| 1316 | Ga0307515_10006103 | |||
| 1317 | Ga0307515_10027473 | |||
| 1318 | Ga0307515_10068694 | |||
| 1319 | Ga0307515_10307019 | |||
| 1320 | Ga0307515_10347750 | |||
| 1321 | Ga0265338_10040980 | |||
| 1322 | Ga0307512_10066250 | |||
| 1323 | Ga0265332_10056750 | |||
| 1324 | Ga0265339_10270648 | |||
| 1325 | Ga0265316_10000349 | |||
| 1326 | Ga0307513_10105713 | |||
| 1327 | Ga0307513_10393839 | |||
| 1328 | Ga0307509_10004212 | |||
| 1329 | Ga0307408_100002690 | |||
| 1330 | Ga0307408_100012733 | |||
| 1331 | Ga0307408_100345880 | |||
| 1332 | Ga0307408_100419130 | |||
| 1333 | Ga0307408_100749231 | |||
| 1334 | Ga0307508_10000048 | |||
| 1335 | Ga0307508_10344018 | |||
| 1336 | Ga0265314_10011769 | |||
| 1337 | Ga0265314_10058937 | |||
| 1338 | Ga0265342_10081350 | |||
| 1339 | Ga0307516_10346404 | |||
| 1340 | Ga0307405_10006369 | |||
| 1341 | Ga0307405_10009680 | |||
| 1342 | Ga0307405_10253818 | |||
| 1343 | Ga0307413_10056193 | |||
| 1344 | Ga0307413_10190893 | |||
| 1345 | Ga0307518_10233755 | |||
| 1346 | Ga0307410_10108851 | |||
| 1347 | Ga0307410_10161971 | |||
| 1348 | Ga0307410_10189257 | |||
| 1349 | Ga0307406_10009322 | |||
| 1350 | Ga0307406_10081421 | |||
| 1351 | Ga0307406_10087312 | |||
| 1352 | Ga0307406_10200855 | |||
| 1353 | Ga0307407_10065456 | |||
| 1354 | Ga0307407_10496013 | |||
| 1355 | Ga0307412_10014216 | |||
| 1356 | Ga0307412_10022171 | |||
| 1357 | Ga0307412_10064124 | |||
| 1358 | Ga0307412_10085707 | |||
| 1359 | Ga0307412_10103139 | |||
| 1360 | Ga0307412_10104851 | |||
| 1361 | Ga0307412_10264090 | |||
| 1362 | Ga0307412_10625517 | |||
| 1363 | Ga0307412_10960940 | |||
| 1364 | Ga0307409_100134923 | |||
| 1365 | Ga0307409_100542934 | |||
| 1366 | Ga0307416_100004163 | |||
| 1367 | Ga0307416_100050988 | |||
| 1368 | Ga0307416_100367942 | |||
| 1369 | Ga0307416_101294113 | |||
| 1370 | Ga0307414_10002973 | |||
| 1371 | Ga0307414_10055406 | |||
| 1372 | Ga0307414_10075866 | |||
| 1373 | Ga0307414_10108443 | |||
| 1374 | Ga0307411_10000528 | |||
| 1375 | Ga0307411_10017762 | |||
| 1376 | Ga0307411_10745652 | |||
| 1377 | Ga0307415_100011676 | |||
| 1378 | Ga0307415_100752758 | |||
| 1379 | Ga0307510_10218823 | |||
| 1380 | Ga0373940_0052288 | |||
| 1381 | Ga0373943_0267748 | |||
| 1382 | Ga0316574_0340729 | |||
| 1383 | Ga0373931_0003751 | |||
| 1384 | Ga0373931_0408658 | |||
| 1385 | Ga0373937_0024289 | |||
| 1386 | Ga0373937_0048181 | |||
| 1387 | Ga0373937_0099401 | |||
| 1388 | Ga0373937_0341582 | |||
| 1389 | Ga0373925_0062160 | |||
| 1390 | Ga0373925_0376142 | |||
| 1391 | Ga0436364_0516927 | |||
| 1392 | Ga0436364_0791589 | |||
| 1393 | Ga0436365_1599716 | |||
| 1394 | Ga0436361_0057254 | |||
| 1395 | Ga0436361_0606718 | |||
| 1396 | Ga0436361_0991571 | |||
| 1397 | Ga0436361_1094211 | |||
| 1398 | Ga0439438_000002 | |||
| 1399 | Ga0439447_004906 | |||
| 1400 | Ga0451839_1570770 | |||
| 1401 | Ga0451841_0746418 | |||
| 1402 | Ga0451851_0269188 | |||
| 1403 | Ga0451843_1443981 | |||
| 1404 | Ga0439441_024856 | |||
| 1405 | Ga0439464_0009337 | |||
| 1406 | Ga0439464_0011418 | |||
| 1407 | Ga0450893_0000595 | |||
| 1408 | Ga0451577_0503113 | |||
| 1409 | Ga0439440_0021028 | |||
| 1410 | Ga0466972_0074519 | |||
| 1411 | Ga0453684_0063816 | |||
| 1412 | Ga0453684_0110535 | |||
| 1413 | Ga0453684_0194669 | |||
| 1414 | Ga0453684_1344060 | |||
| 1415 | Ga0466957_0285841 | |||
| 1416 | Ga0451576_0246624 | |||
| 1417 | Ga0495617_000554 | |||
| 1418 | Ga0495627_073813 | |||
| 1419 | Ga0495590_0003858 | |||
| 1420 | Ga0495580_0000143 | |||
| 1421 | Ga0495580_0422069 | |||
| 1422 | Ga0495584_0001236 | |||
| 1423 | Ga0495584_0211580 | |||
| 1424 | Ga0495584_0315117 | |||
| 1425 | Ga0495585_0000050 | |||
| 1426 | Ga0495585_0000053 | |||
| 1427 | Ga0495585_0002270 | |||
| 1428 | Ga0495585_0019274 | |||
| 1429 | Ga0495596_0004585 | |||
| 1430 | Ga0495607_0032804 | |||
| 1431 | Ga0495583_0000318 | |||
| 1432 | Ga0495583_0046727 | |||
| 1433 | Ga0495606_0076693 | |||
| 1434 | Ga0495606_0153892 | |||
| 1435 | Ga0495610_0000012 | |||
| 1436 | Ga0495616_0000860 | |||
| 1437 | Ga0495616_0002305 | |||
| 1438 | Ga0495616_0023292 | |||
| 1439 | Ga0495643_0080075 | |||
| 1440 | Ga0495648_0000080 | |||
| 1441 | Ga0495648_0000320 | |||
| 1442 | Ga0495654_0001046 | |||
| 1443 | Ga0495654_0028958 | |||
| 1444 | Ga0495654_0086072 | |||
| 1445 | Ga0495665_0010830 | |||
| 1446 | Ga0495598_0028406 | |||
| 1447 | Ga0495609_0003471 | |||
| 1448 | Ga0495597_0000687 | |||
| 1449 | Ga0495633_0001928 | |||
| 1450 | Ga0495633_0021967 | |||
| 1451 | Ga0495668_0000001 | |||
| 1452 | Ga0495668_0005283 | |||
| 1453 | Ga0495611_0209906 | |||
| 1454 | Ga0495625_0000362 | |||
| 1455 | Ga0495625_0031630 | |||
| 1456 | Ga0495588_0264778 | |||
| 1457 | Ga0495670_0002312 | |||
| 1458 | Ga0495671_0000006 | |||
| 1459 | Ga0495660_0000484 | |||
| 1460 | Ga0495604_0047813 | |||
| 1461 | Ga0495636_0010356 | |||
| 1462 | Ga0495683_0000079 | |||
| 1463 | Ga0495681_0050816 | |||
| 1464 | Ga0495686_0060297 | |||
| 1465 | Ga0495615_0057830 | |||
| 1466 | Ga0495626_0078800 | |||
| 1467 | Ga0495626_0095229 | |||
| 1468 | Ga0495626_0138329 | |||
| 1469 | Ga0496100_0594439 | |||
| 1470 | Ga0496102_0001755 | |||
| 1471 | Ga0496102_0036708 | |||
| 1472 | Ga0496102_0047207 | |||
| 1473 | Ga0496102_0102899 | |||
| 1474 | Ga0496102_0839520 | |||
| 1475 | Ga0496104_0014231 | |||
| 1476 | Ga0496104_1067454 | |||
| 1477 | Ga0496106_0014891 | |||
| 1478 | Ga0496107_0029674 | |||
| 1479 | Ga0496107_0030293 | |||
| 1480 | Ga0496109_0061532 | |||
| 1481 | Ga0496112_0005601 | |||
| 1482 | Ga0496112_0349570 | |||
| 1483 | Ga0496113_0033418 | |||
| 1484 | Ga0496113_0303190 | |||
| 1485 | Ga0496113_0425505 | |||
| 1486 | Ga0496114_1025408 | |||
| 1487 | Ga0496121_0153883 | |||
| 1488 | Ga0496122_0008622 | |||
| 1489 | Ga0496123_0009128 | |||
| 1490 | Ga0496124_0098966 | |||
| 1491 | Ga0496126_0031046 | |||
| 1492 | Ga0496126_0395996 | |||
| 1493 | Ga0501310_003920 | |||
| 1494 | Ga0495682_0040174 | |||
| 1495 | Ga0501295_000664 | |||
| 1496 | Ga0501300_004637 | |||
| 1497 | Ga0501032_0127621 | |||
| 1498 | Ga0501033_0003236 | |||
| 1499 | Ga0501033_0010481 | |||
| 1500 | Ga0501033_0033222 | |||
| 1501 | Ga0501033_0084621 | |||
| 1502 | Ga0501033_0099157 | |||
| 1503 | Ga0501033_0106255 | |||
| 1504 | Ga0501033_0177232 | |||
| 1505 | Ga0501034_0014593 | |||
| 1506 | Ga0501034_0029450 | |||
| 1507 | Ga0501034_0043880 | |||
| 1508 | Ga0501034_0113887 | |||
| 1509 | Ga0501036_0001437 | |||
| 1510 | Ga0501036_0083371 | |||
| 1511 | Ga0501036_0179170 | |||
| 1512 | Ga0501036_0184880 | |||
| 1513 | Ga0501037_0005886 | |||
| 1514 | Ga0501037_0017242 | |||
| 1515 | Ga0501037_0074982 | |||
| 1516 | Ga0501037_0109552 | |||
| 1517 | Ga0501038_0002195 | |||
| 1518 | Ga0501038_0009271 | |||
| 1519 | Ga0501038_0418042 | |||
| 1520 | Ga0501039_0034416 | |||
| 1521 | Ga0501039_0123174 | |||
| 1522 | Ga0501039_0313667 | |||
| 1523 | Ga0501040_0000010 | |||
| 1524 | Ga0501040_0077260 | |||
| 1525 | Ga0501041_0008456 | |||
| 1526 | Ga0501041_0040286 | |||
| 1527 | Ga0501041_0150534 | |||
| 1528 | Ga0501042_0000323 | |||
| 1529 | Ga0501042_0074718 | |||
| 1530 | Ga0501043_0023855 | |||
| 1531 | Ga0501043_0025869 | |||
| 1532 | Ga0501043_0124534 | |||
| 1533 | Ga0501043_0299341 | |||
| 1534 | Ga0501046_0004727 | |||
| 1535 | Ga0501046_0123836 | |||
| 1536 | Ga0501046_0135376 | |||
| 1537 | Ga0501047_0000984 | |||
| 1538 | Ga0501047_0009139 | |||
| 1539 | Ga0501047_0093597 | |||
| 1540 | Ga0501047_0106118 | |||
| 1541 | Ga0501047_0186772 | |||
| 1542 | Ga0501047_0250758 | |||
| 1543 | Ga0501047_0302899 | |||
| 1544 | Ga0501047_0305728 | |||
| 1545 | Ga0501048_0020833 | |||
| 1546 | Ga0501048_0084795 | |||
| 1547 | Ga0501068_0024875 | |||
| 1548 | Ga0501070_0070755 | |||
| 1549 | Ga0501070_0082962 | |||
| 1550 | Ga0501070_0121976 | |||
| 1551 | Ga0501070_0130847 | |||
| 1552 | Ga0501070_0298675 | |||
| 1553 | Ga0501071_0020060 | |||
| 1554 | Ga0501071_0084352 | |||
| 1555 | Ga0501072_0033851 | |||
| 1556 | Ga0501072_0039242 | |||
| 1557 | Ga0501072_0150802 | |||
| 1558 | Ga0501073_0116260 | |||
| 1559 | Ga0501073_0330784 | |||
| 1560 | Ga0501074_0135492 | |||
| 1561 | Ga0501075_0000090 | |||
| 1562 | Ga0501075_0058090 | |||
| 1563 | Ga0501076_0003453 | |||
| 1564 | Ga0501076_0019707 | |||
| 1565 | Ga0501076_0597280 | |||
| 1566 | Ga0501077_0000017 | |||
| 1567 | Ga0501077_0043870 | |||
| 1568 | Ga0501077_0226542 | |||
| 1569 | Ga0501211_000027 | |||
| 1570 | Ga0501222_005706 | |||
| 1571 | Ga0501223_020669 | |||
| 1572 | Ga0501227_001013 | |||
| 1573 | Ga0501233_030032 | |||
| 1574 | Ga0501235_004365 | |||
| 1575 | Ga0501236_017275 | |||
| 1576 | Ga0501253_001290 | |||
| 1577 | Ga0501255_000775 | |||
| 1578 | Ga0501257_000064 | |||
| 1579 | Ga0501221_000998 | |||
| 1580 | Ga0501229_006708 | |||
| 1581 | Ga0501079_0000063 | |||
| 1582 | Ga0501079_0133991 | |||
| 1583 | Ga0501080_0020796 | |||
| 1584 | Ga0501080_0054679 | |||
| 1585 | Ga0501081_0000085 | |||
| 1586 | Ga0501081_0044647 | |||
| 1587 | Ga0501081_0081609 | |||
| 1588 | Ga0501081_0378437 | |||
| 1589 | Ga0501083_0057315 | |||
| 1590 | Ga0501262_001434 | |||
| 1591 | Ga0501267_000696 | |||
| 1592 | Ga0501268_008679 | |||
| 1593 | Ga0501269_010095 | |||
| 1594 | Ga0501274_003133 | |||
| 1595 | Ga0501280_004097 | |||
| 1596 | Ga0501282_019814 | |||
| 1597 | Ga0501283_019534 | |||
| 1598 | Ga0501035_0002403 | |||
| 1599 | Ga0501035_0003576 | |||
| 1600 | Ga0501035_0010161 | |||
| 1601 | Ga0501035_0011687 | |||
| 1602 | Ga0501035_0038689 | |||
| 1603 | Ga0501035_0099678 | |||
| 1604 | Ga0501035_0367969 | |||
| 1605 | Ga0501035_0553431 | |||
| 1606 | Ga0501044_0003486 | |||
| 1607 | Ga0501044_0013688 | |||
| 1608 | Ga0501044_0019918 | |||
| 1609 | Ga0501044_0023203 | |||
| 1610 | Ga0501044_0093581 | |||
| 1611 | Ga0501044_0248177 | |||
| 1612 | Ga0501045_0004295 | |||
| 1613 | Ga0501045_0056311 | |||
| 1614 | nmdc:mga00v17_412249_c1 | |||
| 1615 | nmdc:mga0yw44_250829_c1 | |||
| 1616 | nmdc:mga0k408_139038_c1 | |||
| 1617 | nmdc:mga0k408_33801_c1 | |||
| 1618 | nmdc:mga0k408_7914_c1 | |||
| 1619 | nmdc:mga06z11_118651_c1 | |||
| 1620 | nmdc:mga06z11_3889_c1 | |||
| 1621 | nmdc:mga07m45_15425_c1 | |||
| 1622 | nmdc:mga07m45_46577_c1 | |||
| 1623 | nmdc:mga07m45_5812_c1 | |||
| 1624 | nmdc:mga05p37_13597_c1 | |||
| 1625 | nmdc:mga05p37_23630_c1 | |||
| 1626 | nmdc:mga09592_11219_c1 | |||
| 1627 | nmdc:mga09592_61725_c1 | |||
| 1628 | nmdc:mga0qj67_11191_c1 | |||
| 1629 | nmdc:mga0qj67_32483_c1 | |||
| 1630 | nmdc:mga0qj67_387_c1 | |||
| 1631 | nmdc:mga0qj67_503545_c1 | |||
| 1632 | nmdc:mga06r32_14997_c1 | |||
| 1633 | nmdc:mga06r32_33713_c1 | |||
| 1634 | nmdc:mga06r32_497125_c1 | |||
| 1635 | nmdc:mga08y16_12498_c2 | |||
| 1636 | nmdc:mga08y16_162264_c1 | |||
| 1637 | nmdc:mga08y16_267526_c1 | |||
| 1638 | nmdc:mga08y16_95098_c1 | |||
| 1639 | nmdc:mga0n895_148318_c1 | |||
| 1640 | nmdc:mga0n895_531651_c1 | |||
| 1641 | nmdc:mga0n895_81312_c1 | |||
| 1642 | nmdc:mga0rr50_101551_c1 | |||
| 1643 | nmdc:mga0rr50_60001_c1 | |||
| 1644 | nmdc:mga0a205_25112_c1 | |||
| 1645 | nmdc:mga0sz30_227324_c1 | |||
| 1646 | Ga0500643_036169 | |||
| 1647 | Ga0500643_079371 | |||
| 1648 | Ga0500643_081047 | |||
| 1649 | Ga0500643_103732 | |||
| 1650 | Ga0500641_0103669 | |||
| 1651 | Ga0500557_020196 | |||
| 1652 | Ga0500562_000349 | |||
| 1653 | Ga0500592_000217 | |||
| 1654 | Ga0500608_010809 | |||
| 1655 | Ga0500618_000391 | |||
| 1656 | Ga0500642_0000002 | |||
| 1657 | Ga0500658_0014928 | |||
| 1658 | Ga0500564_186009 | |||
| 1659 | Ga0500604_0035494 | |||
| 1660 | Ga0500616_0004492 | |||
| 1661 | Ga0500622_0000023 | |||
| 1662 | Ga0500622_0283844 | |||
| 1663 | Ga0500627_0000027 | |||
| 1664 | Ga0500627_0000230 | |||
| 1665 | Ga0501084_0033174 | |||
| 1666 | Ga0501082_0000908 | |||
| 1667 | Ga0501082_0046584 | |||
| 1668 | Ga0501082_0224781 | |||
| 1669 | Ga0530510_0132847 | |||
| 1670 | Ga0530510_0300547 | |||
| 1671 | 2547374908 | |||
| 1672 | 2501077461 | |||
| 1673 | 2511092593 | |||
| 1674 | 2513557193 | |||
| 1675 | 2513562819 | |||
| 1676 | 2515683113 | |||
| 1677 | 2526211242 | |||
| 1678 | 2643835631 | |||
| 1679 | 2644056557 | |||
| 1680 | 2687583839 | |||
| 1681 | 2722885979 | |||
| 1682 | 2745162240 | |||
| 1683 | 2746090958 | |||
| 1684 | 2746093507 | |||
| 1685 | 2812368642 | |||
| 1686 | 2823422660 | |||
| 1687 | 2839144253 | |||
| 1688 | 2842326359 | |||
| 1689 | 2842351122 | |||
| 1690 | 2842455670 | |||
| 1691 | 2843695697 | |||
| 1692 | 2857505825 | |||
| 1693 | 2857568318 | |||
| 1694 | 2881104249 | |||
| 1695 | 2881928003 | |||
| 1696 | 2887379156 | |||
| 1697 | 2887631410 | |||
| 1698 | 2895516954 | |||
| 1699 | 2919501933 | |||
| 1700 | 2919509092 | |||
| 1701 | 2923522701 | |||
| 1702 | 2926063606 | |||
| 1703 | 2932423370 | |||
| 1704 | 2974320744 | |||
| 1705 | 2998344880 | |||
| 1706 | 8003955977 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dkq-assembly1.cif.gz_B-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9797 | 2 | 226 |
| 3dkq-assembly1.cif.gz_C-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9616 | 1 | 226 |
| 3dkq-assembly1.cif.gz_B-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9425 | 2 | 226 |
| 3dkq-assembly1.cif.gz_A-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9418 | 1 | 226 |
| 3dkq-assembly1.cif.gz_C-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9362 | 1 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dkqA02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9654 | 180 | 226 | 4.10.860.20 |
| 3dkqC02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9645 | 180 | 226 | 4.10.860.20 |
| 3dkqC01 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.963 | 2 | 178 | 2.60.120.620 |
| 3dkqA02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9456 | 180 | 226 | 4.10.860.20 |
| 3dkqC02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9448 | 180 | 226 | 4.10.860.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H8NHS7-F1-model_v4 | PKHD-type hydroxylase | 0.9975 | 1 | 199 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |
| AF-A0A399IX52-F1-model_v4 | Fe2+-dependent dioxygenase | 0.9968 | 1 | 226 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |
| AF-A0A377TSW3-F1-model_v4 | Iron-uptake factor PiuC (EC 1.14.11.-) | 0.9959 | 111 | 191 |
GO:0006879
GO:0006974 GO:0016706 |
| AF-A0A1I3CYU9-F1-model_v4 | PKHD-type hydroxylase | 0.9952 | 1 | 226 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |
| AF-G6XFC2-F1-model_v4 | Putative hydroxylase | 0.9944 | 1 | 226 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |