F483565

General Info

Members Datasets Scaffolds Average Seq Length
853 435 1706 226

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2547132103|2547374908
Length 266
Sequence HFECRRSSHNVPTDAPQIVNTFQASSGPRFAGGLALYGDTMLLHIPAVLSAEELALGRELLARADWADGRITAGSQSAQVKRNLQLPQQLPEAQQLQAMVEGALQRNGLFFSAALPAKIFPPLFNCYQAGMDFGNHVDNAVRRHPFDGGWVRTDVSCTLFFSRPDEYEGGELVIEDTYGSHSVKLDAGDMVLYPSTSLHRVEPVTAGARLASFFWVQSMISDDGKRRLLFDMDAAISSLRLQLGDNEALVALTANYHNLLRMWASP

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
209 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
217 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
220 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
232 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
243 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
252 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
253 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
254 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
255 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
256 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
257 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
258 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
259 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
260 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
268 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
269 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
276 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
277 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
278 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
296 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
297 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
300 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
312 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
317 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
318 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
340 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
341 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
342 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
343 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
344 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
345 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
346 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
347 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
348 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
349 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
350 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
351 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
352 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
353 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
358 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
359 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
360 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
361 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
362 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
363 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
364 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
365 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
369 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
370 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
371 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
382 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
383 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
384 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
385 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
386 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
387 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
388 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
389 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
390 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
391 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
392 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
393 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
394 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
395 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
396 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
397 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
398 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
399 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
400 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
401 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
402 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
403 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
404 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
405 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
406 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
407 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
408 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
409 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
410 2721755523 Delftia sp. HK171 Isolate Unclassified
411 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
412 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
413 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
414 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
415 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
416 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
417 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
418 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
419 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
420 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
421 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
422 2857564685 Duganella sp. R-74599 Isolate Unclassified
423 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
424 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
425 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
426 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
427 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
428 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
429 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
430 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
431 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
432 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
433 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
434 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
435 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.66
Metatranscriptomes 0.12
Isolates 4.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.21
Nodule 1.06
Rhizoplane 2.23
Rhizosphere 82.77
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1016224 3300002070 Bacteria 1010
2 JGI24749J21850_1028161 3300002076 Bacteria 803
3 JGI24744J21845_10039574 3300002077 Bacteria 884
4 JGI24034J26672_10006470 3300002239 Bacteria 1690
5 rootL2_10083363 3300003322 Bacteria 16621
6 Ga0055526_1013787 3300003771 Bacteria 3385
7 Ga0055537_1005105 3300003773 Bacteria 3587
8 Ga0055524_1001263 3300003775 Bacteria 14843
9 Ga0055536_1003133 3300003781 Bacteria 8980
10 Ga0055536_1004801 3300003781 Bacteria 6768
11 Ga0055536_1005155 3300003781 Bacteria 6461
12 Ga0055534_1010687 3300003784 Bacteria 1905
13 Ga0055530_10000310 3300003791 Bacteria 44225
14 Ga0055531_10002945 3300003794 Bacteria 11076
15 Ga0055531_10007831 3300003794 Bacteria 5750
16 Ga0055531_10027351 3300003794 Bacteria 2004
17 Ga0058692_1000431 3300003856 Bacteria 19221
18 Ga0065704_10148704 3300005289 Bacteria 1448
19 Ga0065715_10100239 3300005293 Bacteria 3320
20 Ga0065707_10029968 3300005295 Bacteria 1119
21 Ga0070658_10002553 3300005327 Bacteria 15186
22 Ga0070676_10260264 3300005328 Bacteria 1161
23 Ga0070676_10261845 3300005328 Bacteria 1158
24 Ga0070683_100358925 3300005329 Bacteria 1388
25 Ga0070683_100508954 3300005329 Bacteria 1150
26 Ga0070690_100003142 3300005330 Bacteria 8993
27 Ga0070670_100006524 3300005331 Bacteria 9880
28 Ga0070670_100026480 3300005331 Bacteria 4989
29 Ga0070670_100134969 3300005331 Bacteria 2132
30 Ga0070670_100304558 3300005331 Unclassified 1394
31 Ga0070670_100468456 3300005331 Bacteria 1118
32 Ga0070670_100556076 3300005331 Bacteria 1024
33 Ga0070677_10006039 3300005333 Bacteria 4013
34 Ga0070677_10091383 3300005333 Bacteria 1325
35 Ga0068869_100001182 3300005334 Bacteria 15323
36 Ga0068869_100017486 3300005334 Bacteria 4861
37 Ga0068869_100557786 3300005334 Bacteria 963
38 Ga0068869_100942753 3300005334 Bacteria 749
39 Ga0070666_10026489 3300005335 Bacteria 3789
40 Ga0070666_10144040 3300005335 Bacteria 1660
41 Ga0070680_100177831 3300005336 Bacteria 1791
42 Ga0070660_100003289 3300005339 Bacteria 11105
43 Ga0070660_100018896 3300005339 Bacteria 5044
44 Ga0070689_100008082 3300005340 Bacteria 7391
45 Ga0070687_100000376 3300005343 Bacteria 15278
46 Ga0070661_100036204 3300005344 Bacteria 3588
47 Ga0070661_100245864 3300005344 Bacteria 1379
48 Ga0070668_100613705 3300005347 Bacteria 953
49 Ga0070669_100000001 3300005353 Bacteria 537589
50 Ga0070669_100169463 3300005353 Bacteria 1701
51 Ga0070675_100004297 3300005354 Bacteria 10855
52 Ga0070675_100018240 3300005354 Bacteria 5586
53 Ga0070675_100022287 3300005354 Bacteria 5060
54 Ga0070671_100000002 3300005355 Bacteria 292733
55 Ga0070671_100029085 3300005355 Bacteria 4555
56 Ga0070671_100041611 3300005355 Bacteria 3819
57 Ga0070674_100000167 3300005356 Bacteria 30534
58 Ga0070673_100056243 3300005364 Bacteria 3103
59 Ga0070688_100000491 3300005365 Bacteria 20041
60 Ga0070688_100233179 3300005365 Bacteria 1303
61 Ga0070659_100000743 3300005366 Bacteria 23664
62 Ga0070659_100000820 3300005366 Bacteria 22687
63 Ga0070659_100004983 3300005366 Bacteria 9508
64 Ga0070659_100030874 3300005366 Bacteria 4147
65 Ga0070659_100091984 3300005366 Bacteria 2432
66 Ga0070667_100004785 3300005367 Bacteria 11339
67 Ga0070703_10031602 3300005406 Bacteria 1602
68 Ga0070701_10043469 3300005438 Bacteria 2299
69 Ga0070705_100000983 3300005440 Bacteria 15930
70 Ga0070705_100005445 3300005440 Bacteria 6202
71 Ga0070705_100482493 3300005440 Bacteria 937
72 Ga0070700_100025169 3300005441 Bacteria 3503
73 Ga0070700_100295253 3300005441 Bacteria 1181
74 Ga0070694_100324945 3300005444 Bacteria 1185
75 Ga0070708_100040828 3300005445 Bacteria 4065
76 Ga0070663_100015868 3300005455 Bacteria 4875
77 Ga0070663_100501343 3300005455 Bacteria 1008
78 Ga0070678_100003331 3300005456 Bacteria 8940
79 Ga0070678_100006518 3300005456 Bacteria 6856
80 Ga0070678_100020327 3300005456 Bacteria 4353
81 Ga0070662_100002454 3300005457 Bacteria 11422
82 Ga0070681_10001866 3300005458 Bacteria 19023
83 Ga0070681_10015969 3300005458 Bacteria 7487
84 Ga0070681_10095047 3300005458 Bacteria 2929
85 Ga0070681_10176869 3300005458 Bacteria 2056
86 Ga0070681_10351413 3300005458 Bacteria 1384
87 Ga0068867_100014253 3300005459 Bacteria 5631
88 Ga0068867_100127993 3300005459 Bacteria 1970
89 Ga0070685_10000312 3300005466 Bacteria 30514
90 Ga0070706_100003178 3300005467 Bacteria 16216
91 Ga0070707_100130219 3300005468 Bacteria 2447
92 Ga0070679_100022623 3300005530 Bacteria 6145
93 Ga0070679_100055690 3300005530 Bacteria 3939
94 Ga0070679_100226611 3300005530 Bacteria 1829
95 Ga0070679_100403233 3300005530 Bacteria 1313
96 Ga0070684_100044363 3300005535 Bacteria 3846
97 Ga0068853_100005451 3300005539 Bacteria 9970
98 Ga0068853_100007924 3300005539 Bacteria 8516
99 Ga0068853_100501382 3300005539 Bacteria 1146
100 Ga0070672_100011434 3300005543 Bacteria 6191
101 Ga0070672_100441412 3300005543 Bacteria 1120
102 Ga0070686_100004704 3300005544 Bacteria 7525
103 Ga0070696_100033486 3300005546 Bacteria 3531
104 Ga0070696_100047787 3300005546 Bacteria 2970
105 Ga0070693_100000389 3300005547 Bacteria 19974
106 Ga0070693_100307119 3300005547 Bacteria 1071
107 Ga0070665_100058556 3300005548 Bacteria 3862
108 Ga0070665_100181062 3300005548 Bacteria 2108
109 Ga0070665_100273288 3300005548 Bacteria 1692
110 Ga0070704_100018066 3300005549 Bacteria 4499
111 Ga0070704_100193390 3300005549 Bacteria 1637
112 Ga0068855_100001278 3300005563 Bacteria 31177
113 Ga0068855_100001819 3300005563 Bacteria 26612
114 Ga0070664_100011160 3300005564 Bacteria 7286
115 Ga0068857_100214791 3300005577 Bacteria 1756
116 Ga0068854_100032491 3300005578 Bacteria 3632
117 Ga0068854_100057209 3300005578 Bacteria 2812
118 Ga0068854_100707637 3300005578 Bacteria 870
119 Ga0068856_100012081 3300005614 Bacteria 8363
120 Ga0068856_100020253 3300005614 Bacteria 6460
121 Ga0068856_100295606 3300005614 Bacteria 1637
122 Ga0068856_100669876 3300005614 Bacteria 1058
123 Ga0070702_100349868 3300005615 Bacteria 1040
124 Ga0068852_100004791 3300005616 Bacteria 9610
125 Ga0068852_100251423 3300005616 Bacteria 1694
126 Ga0068859_100002725 3300005617 Bacteria 17917
127 Ga0068864_100000323 3300005618 Bacteria 42172
128 Ga0068864_100040657 3300005618 Bacteria 3977
129 Ga0068864_100162383 3300005618 Bacteria 2031
130 Ga0068864_100207846 3300005618 Bacteria 1801
131 Ga0068861_100001192 3300005719 Bacteria 16170
132 Ga0068861_100002755 3300005719 Bacteria 11526
133 Ga0068861_100033317 3300005719 Bacteria 3799
134 Ga0068851_10000396 3300005834 Bacteria 19748
135 Ga0068870_10000513 3300005840 Bacteria 14666
136 Ga0068870_10001473 3300005840 Bacteria 9523
137 Ga0068870_10059711 3300005840 Bacteria 2045
138 Ga0068870_10138612 3300005840 Bacteria 1421
139 Ga0068863_100011337 3300005841 Bacteria 8631
140 Ga0068863_100017755 3300005841 Bacteria 6811
141 Ga0068863_100081617 3300005841 Bacteria 3063
142 Ga0068863_100084708 3300005841 Bacteria 3004
143 Ga0068863_100288715 3300005841 Bacteria 1590
144 Ga0068863_100290501 3300005841 Bacteria 1585
145 Ga0068858_100024171 3300005842 Bacteria 5662
146 Ga0068858_100107416 3300005842 Bacteria 2605
147 Ga0068858_100230425 3300005842 Bacteria 1756
148 Ga0068858_100682680 3300005842 Bacteria 999
149 Ga0068860_100057650 3300005843 Bacteria 3692
150 Ga0068860_100286332 3300005843 Bacteria 1611
151 Ga0068860_100296685 3300005843 Bacteria 1583
152 Ga0068862_100000856 3300005844 Bacteria 29863
153 Ga0068862_100004739 3300005844 Bacteria 11447
154 Ga0068862_100019061 3300005844 Bacteria 5721
155 Ga0068862_100204582 3300005844 Bacteria 1781
156 Ga0081455_10035349 3300005937 Bacteria 4467
157 Ga0081455_10159847 3300005937 Bacteria 1728
158 Ga0081540_1000069 3300005983 Bacteria 111562
159 Ga0081540_1000394 3300005983 Bacteria 43177
160 Ga0075365_10065906 3300006038 Bacteria 2428
161 Ga0075368_10000982 3300006042 Bacteria 8906
162 Ga0075363_100071829 3300006048 Bacteria 1881
163 Ga0075432_10126682 3300006058 Bacteria 964
164 Ga0070715_10070721 3300006163 Bacteria 1558
165 Ga0070715_10097515 3300006163 Bacteria 1365
166 Ga0075362_10010431 3300006177 Bacteria 3628
167 Ga0075367_10014576 3300006178 Bacteria 4256
168 Ga0075367_10018531 3300006178 Bacteria 3843
169 Ga0075366_10068062 3300006195 Bacteria 2119
170 Ga0097621_100000838 3300006237 Bacteria 21638
171 Ga0097621_100016607 3300006237 Bacteria 5569
172 Ga0097621_100103834 3300006237 Bacteria 2394
173 Ga0075370_10091817 3300006353 Bacteria 1752
174 Ga0068871_100000675 3300006358 Bacteria 23340
175 Ga0068871_100000829 3300006358 Bacteria 20718
176 Ga0068871_100054493 3300006358 Bacteria 3244
177 Ga0068871_100191445 3300006358 Bacteria 1762
178 Ga0075428_100593091 3300006844 Bacteria 1183
179 Ga0075430_100005542 3300006846 Bacteria 10659
180 Ga0075430_100018913 3300006846 Bacteria 5861
181 Ga0075430_100334527 3300006846 Bacteria 1251
182 Ga0075431_100001427 3300006847 Bacteria 21965
183 Ga0075431_100248618 3300006847 Bacteria 1807
184 Ga0075431_100416241 3300006847 Bacteria 1343
185 Ga0075431_100625367 3300006847 Bacteria 1059
186 Ga0075433_10064014 3300006852 Bacteria 3223
187 Ga0075434_100084101 3300006871 Bacteria 3180
188 Ga0075429_100054288 3300006880 Bacteria 3486
189 Ga0097620_100002725 3300006931 Bacteria 17917
190 Ga0079104_1000020 3300006946 Bacteria 256848
191 Ga0075435_100060907 3300007076 Bacteria 3061
192 Ga0105244_10069369 3300009036 Bacteria 1760
193 Ga0105250_10000684 3300009092 Bacteria 21197
194 Ga0105240_10001833 3300009093 Bacteria 35581
195 Ga0105240_10103614 3300009093 Bacteria 3456
196 Ga0111539_10001473 3300009094 Bacteria 31441
197 Ga0111539_10118726 3300009094 Bacteria 3099
198 Ga0111539_10191639 3300009094 Bacteria 2385
199 Ga0105245_10001784 3300009098 Bacteria 19587
200 Ga0105247_10000499 3300009101 Bacteria 32445
201 Ga0105247_10001755 3300009101 Bacteria 15272
202 Ga0105247_10092067 3300009101 Bacteria 1926
203 Ga0114129_10005737 3300009147 Bacteria 17592
204 Ga0114129_10028119 3300009147 Bacteria 7966
205 Ga0114129_10034844 3300009147 Bacteria 7112
206 Ga0114129_10845816 3300009147 Bacteria 1164
207 Ga0114129_11530976 3300009147 Bacteria 818
208 Ga0105243_10003516 3300009148 Bacteria 12656
209 Ga0105243_10040411 3300009148 Bacteria 3643
210 Ga0105241_10099312 3300009174 Bacteria 2311
211 Ga0105241_10106187 3300009174 Bacteria 2241
212 Ga0105241_10491433 3300009174 Bacteria 1093
213 Ga0105241_10623475 3300009174 Bacteria 977
214 Ga0105242_10000776 3300009176 Bacteria 24808
215 Ga0105242_10016603 3300009176 Bacteria 5726
216 Ga0105248_10052796 3300009177 Bacteria 4562
217 Ga0105248_10270480 3300009177 Bacteria 1913
218 Ga0105237_10000240 3300009545 Bacteria 77901
219 Ga0105237_10151970 3300009545 Bacteria 2312
220 Ga0105238_10001156 3300009551 Bacteria 26656
221 Ga0105238_10002207 3300009551 Bacteria 19641
222 Ga0105238_10046900 3300009551 Bacteria 4358
223 Ga0105249_10002404 3300009553 Bacteria 16271
224 Ga0105249_10064841 3300009553 Bacteria 3359
225 Ga0105239_10003666 3300010375 Bacteria 18760
226 Ga0105239_10261190 3300010375 Bacteria 1946
227 Ga0105246_10005681 3300011119 Bacteria 7612
228 Ga0157373_10001212 3300013100 Bacteria 19706
229 Ga0157373_10009846 3300013100 Bacteria 7045
230 Ga0157371_10001038 3300013102 Bacteria 30445
231 Ga0157371_10004495 3300013102 Bacteria 12160
232 Ga0157371_10017286 3300013102 Bacteria 5363
233 Ga0157370_10000662 3300013104 Bacteria 42848
234 Ga0157370_10002750 3300013104 Bacteria 21019
235 Ga0157370_10008238 3300013104 Bacteria 11255
236 Ga0157369_10024719 3300013105 Bacteria 6676
237 Ga0157374_10000876 3300013296 Bacteria 26225
238 Ga0157374_10593162 3300013296 Bacteria 1117
239 Ga0157378_10000880 3300013297 Bacteria 27725
240 Ga0157378_10183652 3300013297 Bacteria 1969
241 Ga0157378_10420922 3300013297 Bacteria 1320
242 Ga0163162_10001408 3300013306 Bacteria 22388
243 Ga0163162_10017854 3300013306 Bacteria 6942
244 Ga0163162_10468019 3300013306 Bacteria 1392
245 Ga0163162_10867132 3300013306 Bacteria 1017
246 Ga0163162_11403658 3300013306 Bacteria 794
247 Ga0157372_10013278 3300013307 Bacteria 8790
248 Ga0157372_10030186 3300013307 Bacteria 5927
249 Ga0157375_10012511 3300013308 Bacteria 7531
250 Ga0157375_10080250 3300013308 Bacteria 3300
251 Ga0157375_10265028 3300013308 Bacteria 1880
252 Ga0163163_10071581 3300014325 Bacteria 3455
253 Ga0163163_10076193 3300014325 Bacteria 3349
254 Ga0163163_10158478 3300014325 Bacteria 2308
255 Ga0157380_10011035 3300014326 Bacteria 6516
256 Ga0157380_10032233 3300014326 Bacteria 4029
257 Ga0157380_10152128 3300014326 Bacteria 2001
258 Ga0157377_10000421 3300014745 Bacteria 18342
259 Ga0157379_10002360 3300014968 Bacteria 15768
260 Ga0157379_10095916 3300014968 Bacteria 2661
261 Ga0157379_10223518 3300014968 Bacteria 1706
262 Ga0157379_10330518 3300014968 Bacteria 1393
263 Ga0157379_10416273 3300014968 Bacteria 1237
264 Ga0157376_10004912 3300014969 Bacteria 9322
265 Ga0157376_10047151 3300014969 Bacteria 3556
266 Ga0157376_10066788 3300014969 Bacteria 3041
267 Ga0157376_10081219 3300014969 Bacteria 2783
268 Ga0182007_10043767 3300015262 Bacteria 1487
269 Ga0183369_1007 3300015685 Bacteria 414878
270 Ga0163161_10019395 3300017792 Bacteria 4771
271 Ga0213872_10000211 3300021361 Bacteria 51730
272 Ga0213872_10029040 3300021361 Bacteria 2536
273 Ga0213876_10000987 3300021384 Bacteria 18681
274 Ga0213876_10130061 3300021384 Bacteria 1338
275 Ga0209674_100635 3300025226 Bacteria 12776
276 Ga0209026_1000037 3300025250 Bacteria 282562
277 Ga0209565_1001442 3300025263 Bacteria 10501
278 Ga0209675_1000025 3300025291 Bacteria 294102
279 Ga0209675_1003444 3300025291 Bacteria 7521
280 Ga0209676_1000198 3300025292 Bacteria 134708
281 Ga0209676_1001165 3300025292 Bacteria 28524
282 Ga0209676_1001500 3300025292 Bacteria 21339
283 Ga0209676_1050538 3300025292 Bacteria 1096
284 Ga0209025_1028558 3300025294 Bacteria 2728
285 Ga0209025_1096882 3300025294 Bacteria 946
286 Ga0209564_1003296 3300025295 Bacteria 11221
287 Ga0209758_1007867 3300025297 Bacteria 7097
288 Ga0209050_1000104 3300025298 Bacteria 228921
289 Ga0209050_1002306 3300025298 Bacteria 16802
290 Ga0209050_1013188 3300025298 Bacteria 3697
291 Ga0209256_1000964 3300025299 Bacteria 34690
292 Ga0209257_1000860 3300025304 Bacteria 43237
293 Ga0209257_1001790 3300025304 Bacteria 23629
294 Ga0209257_1003091 3300025304 Bacteria 14969
295 Ga0209257_1018503 3300025304 Bacteria 2677
296 Ga0207697_10000248 3300025315 Bacteria 29669
297 Ga0207697_10001354 3300025315 Bacteria 13437
298 Ga0207697_10004831 3300025315 Bacteria 6363
299 Ga0207656_10007391 3300025321 Bacteria 3999
300 Ga0207656_10048795 3300025321 Bacteria 1824
301 Ga0207696_1002516 3300025711 Bacteria 8949
302 Ga0207682_10000093 3300025893 Bacteria 41366
303 Ga0207682_10001426 3300025893 Bacteria 11040
304 Ga0207642_10099894 3300025899 Bacteria 1454
305 Ga0207710_10004910 3300025900 Bacteria 5798
306 Ga0207710_10036099 3300025900 Bacteria 2178
307 Ga0207688_10022722 3300025901 Bacteria 3433
308 Ga0207680_10000256 3300025903 Bacteria 25532
309 Ga0207680_10021323 3300025903 Bacteria 3504
310 Ga0207680_10124747 3300025903 Bacteria 1689
311 Ga0207680_10139928 3300025903 Bacteria 1604
312 Ga0207647_10020714 3300025904 Bacteria 4405
313 Ga0207647_10272005 3300025904 Bacteria 968
314 Ga0207645_10000101 3300025907 Bacteria 63405
315 Ga0207645_10139169 3300025907 Bacteria 1581
316 Ga0207643_10000166 3300025908 Bacteria 45538
317 Ga0207643_10002758 3300025908 Bacteria 9501
318 Ga0207643_10163904 3300025908 Bacteria 1338
319 Ga0207643_10209240 3300025908 Bacteria 1190
320 Ga0207705_10029847 3300025909 Bacteria 3888
321 Ga0207705_10061876 3300025909 Bacteria 2704
322 Ga0207684_10008871 3300025910 Bacteria 8927
323 Ga0207654_10414508 3300025911 Bacteria 939
324 Ga0207707_10012137 3300025912 Bacteria 7489
325 Ga0207707_10013190 3300025912 Bacteria 7205
326 Ga0207707_10092784 3300025912 Bacteria 2638
327 Ga0207707_10138615 3300025912 Bacteria 2127
328 Ga0207707_10145645 3300025912 Bacteria 2071
329 Ga0207695_10087457 3300025913 Bacteria 3139
330 Ga0207695_10114082 3300025913 Bacteria 2678
331 Ga0207663_10391493 3300025916 Bacteria 1061
332 Ga0207660_10294296 3300025917 Bacteria 1291
333 Ga0207662_10000010 3300025918 Bacteria 91647
334 Ga0207657_10000353 3300025919 Bacteria 48893
335 Ga0207657_10030005 3300025919 Bacteria 4940
336 Ga0207657_10038401 3300025919 Bacteria 4262
337 Ga0207649_10045312 3300025920 Bacteria 2696
338 Ga0207649_10056595 3300025920 Bacteria 2449
339 Ga0207652_10023091 3300025921 Bacteria 5152
340 Ga0207652_10168974 3300025921 Bacteria 1962
341 Ga0207652_10327530 3300025921 Bacteria 1383
342 Ga0207646_10041233 3300025922 Bacteria 4151
343 Ga0207681_10000002 3300025923 Bacteria 985597
344 Ga0207681_10019058 3300025923 Bacteria 4331
345 Ga0207694_10000623 3300025924 Bacteria 32207
346 Ga0207694_10021700 3300025924 Bacteria 4866
347 Ga0207694_10062426 3300025924 Bacteria 2901
348 Ga0207650_10003185 3300025925 Bacteria 11308
349 Ga0207650_10024028 3300025925 Bacteria 4327
350 Ga0207650_10201645 3300025925 Unclassified 1594
351 Ga0207650_10219288 3300025925 Bacteria 1530
352 Ga0207659_10020488 3300025926 Bacteria 4372
353 Ga0207659_10109120 3300025926 Bacteria 2100
354 Ga0207659_10680183 3300025926 Bacteria 880
355 Ga0207687_10001680 3300025927 Bacteria 15253
356 Ga0207687_10085191 3300025927 Bacteria 2292
357 Ga0207700_10026229 3300025928 Bacteria 4061
358 Ga0207644_10000002 3300025931 Bacteria 942221
359 Ga0207644_10169640 3300025931 Bacteria 1702
360 Ga0207644_10189599 3300025931 Bacteria 1616
361 Ga0207644_10596442 3300025931 Bacteria 917
362 Ga0207644_10869035 3300025931 Bacteria 755
363 Ga0207690_10000424 3300025932 Bacteria 27614
364 Ga0207690_10001856 3300025932 Bacteria 12985
365 Ga0207690_10003818 3300025932 Bacteria 8915
366 Ga0207690_10327261 3300025932 Bacteria 1206
367 Ga0207706_10000077 3300025933 Bacteria 102336
368 Ga0207706_10008405 3300025933 Bacteria 9525
369 Ga0207686_10471912 3300025934 Bacteria 969
370 Ga0207709_10000055 3300025935 Bacteria 222373
371 Ga0207709_10021881 3300025935 Bacteria 3622
372 Ga0207670_10018583 3300025936 Bacteria 4230
373 Ga0207669_10031514 3300025937 Bacteria 2963
374 Ga0207704_10009730 3300025938 Bacteria 4654
375 Ga0207704_10441779 3300025938 Bacteria 1036
376 Ga0207665_10117829 3300025939 Bacteria 1873
377 Ga0207665_10170312 3300025939 Bacteria 1572
378 Ga0207691_10000033 3300025940 Bacteria 115126
379 Ga0207691_10000680 3300025940 Bacteria 33596
380 Ga0207691_10004283 3300025940 Bacteria 13863
381 Ga0207711_10036711 3300025941 Bacteria 4159
382 Ga0207711_10675841 3300025941 Bacteria 963
383 Ga0207689_10003350 3300025942 Bacteria 14674
384 Ga0207689_10032746 3300025942 Bacteria 4321
385 Ga0207689_10403368 3300025942 Bacteria 1140
386 Ga0207689_10653300 3300025942 Bacteria 886
387 Ga0207661_10038621 3300025944 Bacteria 3743
388 Ga0207661_10799434 3300025944 Bacteria 868
389 Ga0207679_10023078 3300025945 Bacteria 4248
390 Ga0207667_10008704 3300025949 Bacteria 12029
391 Ga0207667_10015762 3300025949 Bacteria 8570
392 Ga0207651_10014737 3300025960 Bacteria 4523
393 Ga0207651_10066916 3300025960 Bacteria 2526
394 Ga0207712_10002383 3300025961 Bacteria 12182
395 Ga0207712_10008093 3300025961 Bacteria 6651
396 Ga0207668_10097860 3300025972 Bacteria 2172
397 Ga0207640_10041946 3300025981 Bacteria 2914
398 Ga0207640_10117583 3300025981 Bacteria 1898
399 Ga0207640_10230495 3300025981 Bacteria 1424
400 Ga0207640_10402962 3300025981 Bacteria 1114
401 Ga0207658_10010583 3300025986 Bacteria 6267
402 Ga0207658_10029130 3300025986 Bacteria 3895
403 Ga0207658_10039364 3300025986 Bacteria 3411
404 Ga0207677_10004853 3300026023 Bacteria 7256
405 Ga0207677_10019078 3300026023 Bacteria 4132
406 Ga0207703_10014955 3300026035 Bacteria 6055
407 Ga0207703_10024943 3300026035 Bacteria 4704
408 Ga0207703_10072035 3300026035 Bacteria 2856
409 Ga0207639_10657331 3300026041 Bacteria 970
410 Ga0207678_10000464 3300026067 Bacteria 36746
411 Ga0207678_10691855 3300026067 Bacteria 897
412 Ga0207708_10011861 3300026075 Bacteria 6489
413 Ga0207708_10082139 3300026075 Bacteria 2477
414 Ga0207708_10379530 3300026075 Bacteria 1165
415 Ga0207708_10452851 3300026075 Bacteria 1069
416 Ga0207702_10229162 3300026078 Bacteria 1735
417 Ga0207641_10009679 3300026088 Bacteria 7940
418 Ga0207641_10015606 3300026088 Bacteria 6225
419 Ga0207641_10115063 3300026088 Bacteria 2391
420 Ga0207641_10459667 3300026088 Bacteria 1231
421 Ga0207648_10000189 3300026089 Bacteria 64801
422 Ga0207648_10015036 3300026089 Bacteria 7127
423 Ga0207648_10459721 3300026089 Bacteria 1160
424 Ga0207676_10000304 3300026095 Bacteria 42178
425 Ga0207676_10007112 3300026095 Bacteria 7931
426 Ga0207676_10026418 3300026095 Bacteria 4319
427 Ga0207676_10093156 3300026095 Bacteria 2479
428 Ga0207676_10489054 3300026095 Bacteria 1167
429 Ga0207674_10000224 3300026116 Bacteria 70660
430 Ga0207674_10368821 3300026116 Bacteria 1388
431 Ga0207675_100000043 3300026118 Bacteria 89667
432 Ga0207675_100000137 3300026118 Bacteria 62412
433 Ga0207675_100019121 3300026118 Bacteria 6395
434 Ga0207675_100042371 3300026118 Bacteria 4250
435 Ga0207683_10011248 3300026121 Bacteria 7630
436 Ga0207683_10023264 3300026121 Bacteria 5327
437 Ga0207683_10031886 3300026121 Bacteria 4576
438 Ga0207683_10188941 3300026121 Bacteria 1870
439 Ga0207683_10498685 3300026121 Bacteria 1124
440 Ga0207698_10001141 3300026142 Bacteria 15454
441 Ga0209281_1000002 3300027111 Bacteria 1924012
442 Ga0209983_1013907 3300027665 Bacteria 1656
443 Ga0209813_10002831 3300027866 Bacteria 4014
444 Ga0209974_10019699 3300027876 Bacteria 2237
445 Ga0207428_10000018 3300027907 Bacteria 293117
446 Ga0207428_10000043 3300027907 Bacteria 198931
447 Ga0207428_10275384 3300027907 Bacteria 1250
448 Ga0268266_10010399 3300028379 Bacteria 8133
449 Ga0268266_10041792 3300028379 Bacteria 3914
450 Ga0268266_10227150 3300028379 Bacteria 1718
451 Ga0268265_10000264 3300028380 Bacteria 59642
452 Ga0268265_10023793 3300028380 Bacteria 4323
453 Ga0268265_10032629 3300028380 Bacteria 3776
454 Ga0268265_10103258 3300028380 Bacteria 2308
455 Ga0268265_10214672 3300028380 Bacteria 1679
456 Ga0268265_10477623 3300028380 Bacteria 1170
457 Ga0268264_10000071 3300028381 Bacteria 267236
458 Ga0268264_10120771 3300028381 Bacteria 2309
459 Ga0268264_10238196 3300028381 Bacteria 1684
460 Ga0268264_10522847 3300028381 Bacteria 1160
461 Ga0265323_10075991 3300028653 Unclassified 1140
462 Ga0307515_10003406 3300028794 Bacteria 33481
463 Ga0307515_10006103 3300028794 Bacteria 24230
464 Ga0307515_10027473 3300028794 Bacteria 9726
465 Ga0307515_10068694 3300028794 Bacteria 4861
466 Ga0307515_10307019 3300028794 Bacteria 1265
467 Ga0307515_10347750 3300028794 Bacteria 1131
468 Ga0265338_10040980 3300028800 Bacteria 4339
469 Ga0307512_10066250 3300030522 Bacteria 2730
470 Ga0265332_10056750 3300031238 Bacteria 1678
471 Ga0265339_10270648 3300031249 Bacteria 817
472 Ga0265316_10000349 3300031344 Bacteria 51876
473 Ga0307513_10105713 3300031456 Bacteria 2823
474 Ga0307513_10393839 3300031456 Bacteria 1121
475 Ga0307509_10004212 3300031507 Bacteria 20986
476 Ga0307408_100002690 3300031548 Bacteria 12339
477 Ga0307408_100012733 3300031548 Bacteria 5577
478 Ga0307408_100345880 3300031548 Bacteria 1260
479 Ga0307408_100419130 3300031548 Bacteria 1154
480 Ga0307408_100749231 3300031548 Bacteria 882
481 Ga0307508_10000048 3300031616 Bacteria 137587
482 Ga0307508_10344018 3300031616 Bacteria 1083
483 Ga0265314_10011769 3300031711 Bacteria 7196
484 Ga0265314_10058937 3300031711 Bacteria 2629
485 Ga0265342_10081350 3300031712 Bacteria 1870
486 Ga0307516_10346404 3300031730 Bacteria 1152
487 Ga0307405_10006369 3300031731 Bacteria 5802
488 Ga0307405_10009680 3300031731 Bacteria 4953
489 Ga0307405_10253818 3300031731 Bacteria 1310
490 Ga0307413_10056193 3300031824 Bacteria 2399
491 Ga0307413_10190893 3300031824 Bacteria 1471
492 Ga0307518_10233755 3300031838 Bacteria 1187
493 Ga0307410_10108851 3300031852 Bacteria 2002
494 Ga0307410_10161971 3300031852 Bacteria 1677
495 Ga0307410_10189257 3300031852 Bacteria 1564
496 Ga0307406_10009322 3300031901 Bacteria 5501
497 Ga0307406_10081421 3300031901 Bacteria 2153
498 Ga0307406_10087312 3300031901 Bacteria 2090
499 Ga0307406_10200855 3300031901 Bacteria 1467
500 Ga0307407_10065456 3300031903 Bacteria 2140
501 Ga0307407_10496013 3300031903 Bacteria 894
502 Ga0307412_10014216 3300031911 Bacteria 4690
503 Ga0307412_10022171 3300031911 Bacteria 3889
504 Ga0307412_10064124 3300031911 Bacteria 2481
505 Ga0307412_10085707 3300031911 Bacteria 2190
506 Ga0307412_10103139 3300031911 Bacteria 2021
507 Ga0307412_10104851 3300031911 Bacteria 2007
508 Ga0307412_10264090 3300031911 Bacteria 1344
509 Ga0307412_10625517 3300031911 Bacteria 915
510 Ga0307412_10960940 3300031911 Bacteria 752
511 Ga0307409_100134923 3300031995 Bacteria 2116
512 Ga0307409_100542934 3300031995 Bacteria 1140
513 Ga0307416_100004163 3300032002 Bacteria 8670
514 Ga0307416_100050988 3300032002 Bacteria 3302
515 Ga0307416_100367942 3300032002 Bacteria 1462
516 Ga0307416_101294113 3300032002 Bacteria 835
517 Ga0307414_10002973 3300032004 Bacteria 8971
518 Ga0307414_10055406 3300032004 Bacteria 2776
519 Ga0307414_10075866 3300032004 Bacteria 2441
520 Ga0307414_10108443 3300032004 Bacteria 2106
521 Ga0307411_10000528 3300032005 Bacteria 13457
522 Ga0307411_10017762 3300032005 Bacteria 4064
523 Ga0307411_10745652 3300032005 Bacteria 857
524 Ga0307415_100011676 3300032126 Bacteria 5040
525 Ga0307415_100752758 3300032126 Bacteria 885
526 Ga0307510_10218823 3300033180 Bacteria 1418
527 Ga0373940_0052288 3300035088 Bacteria 1150
528 Ga0373943_0267748 3300035170 Bacteria 963
529 Ga0316574_0340729 3300035398 Bacteria 950
530 Ga0373931_0003751 3300035691 Bacteria 6870
531 Ga0373931_0408658 3300035691 Bacteria 861
532 Ga0373937_0024289 3300036401 Bacteria 5465
533 Ga0373937_0048181 3300036401 Bacteria 3900
534 Ga0373937_0099401 3300036401 Bacteria 2699
535 Ga0373937_0341582 3300036401 Bacteria 1418
536 Ga0373925_0062160 3300037068 Bacteria 2808
537 Ga0373925_0376142 3300037068 Bacteria 1156
538 Ga0436364_0516927 3300037853 Bacteria 1938
539 Ga0436364_0791589 3300037853 Bacteria 3861
540 Ga0436365_1599716 3300039437 Bacteria 29460
541 Ga0436361_0057254 3300039447 Bacteria 8651
542 Ga0436361_0606718 3300039447 Bacteria 5397
543 Ga0436361_0991571 3300039447 Bacteria 8152
544 Ga0436361_1094211 3300039447 Bacteria 10053
545 Ga0439438_000002 3300041405 Bacteria 618223
546 Ga0439447_004906 3300041407 Bacteria 4525
547 Ga0451839_1570770 3300041496 Unclassified 1598
548 Ga0451841_0746418 3300041498 Bacteria 1276
549 Ga0451851_0269188 3300041507 Bacteria 1515
550 Ga0451843_1443981 3300041509 Bacteria 793
551 Ga0439441_024856 3300042001 Bacteria 1128
552 Ga0439464_0009337 3300042439 Bacteria 2581
553 Ga0439464_0011418 3300042439 Bacteria 2354
554 Ga0450893_0000595 3300042532 Bacteria 5170
555 Ga0451577_0503113 3300042876 Bacteria 1100
556 Ga0439440_0021028 3300042993 Bacteria 1468
557 Ga0466972_0074519 3300044658 Bacteria 1617
558 Ga0453684_0063816 3300044712 Bacteria 4708
559 Ga0453684_0110535 3300044712 Bacteria 3340
560 Ga0453684_0194669 3300044712 Bacteria 2368
561 Ga0453684_1344060 3300044712 Bacteria 743
562 Ga0466957_0285841 3300044842 Bacteria 1105
563 Ga0451576_0246624 3300045051 Bacteria 1866
564 Ga0495617_000554 3300046452 Bacteria 19232
565 Ga0495627_073813 3300046453 Bacteria 994
566 Ga0495590_0003858 3300046457 Bacteria 6100
567 Ga0495580_0000143 3300046472 Bacteria 51276
568 Ga0495580_0422069 3300046472 Bacteria 897
569 Ga0495584_0001236 3300046491 Bacteria 15593
570 Ga0495584_0211580 3300046491 Bacteria 986
571 Ga0495584_0315117 3300046491 Bacteria 794
572 Ga0495585_0000050 3300046492 Bacteria 119283
573 Ga0495585_0000053 3300046492 Bacteria 115559
574 Ga0495585_0002270 3300046492 Bacteria 13878
575 Ga0495585_0019274 3300046492 Bacteria 3934
576 Ga0495596_0004585 3300046500 Bacteria 6703
577 Ga0495607_0032804 3300046501 Bacteria 3165
578 Ga0495583_0000318 3300046506 Bacteria 76178
579 Ga0495583_0046727 3300046506 Bacteria 1995
580 Ga0495606_0076693 3300046507 Bacteria 2088
581 Ga0495606_0153892 3300046507 Bacteria 1347
582 Ga0495610_0000012 3300046512 Bacteria 517442
583 Ga0495616_0000860 3300046513 Bacteria 22061
584 Ga0495616_0002305 3300046513 Bacteria 12769
585 Ga0495616_0023292 3300046513 Bacteria 3332
586 Ga0495643_0080075 3300046522 Bacteria 1701
587 Ga0495648_0000080 3300046524 Bacteria 126026
588 Ga0495648_0000320 3300046524 Bacteria 53330
589 Ga0495654_0001046 3300046530 Bacteria 20265
590 Ga0495654_0028958 3300046530 Bacteria 2828
591 Ga0495654_0086072 3300046530 Bacteria 1465
592 Ga0495665_0010830 3300046531 Bacteria 4934
593 Ga0495598_0028406 3300046537 Bacteria 1551
594 Ga0495609_0003471 3300046538 Bacteria 9018
595 Ga0495597_0000687 3300046542 Bacteria 27336
596 Ga0495633_0001928 3300046558 Bacteria 15107
597 Ga0495633_0021967 3300046558 Bacteria 3184
598 Ga0495668_0000001 3300046616 Bacteria 1013420
599 Ga0495668_0005283 3300046616 Bacteria 8832
600 Ga0495611_0209906 3300046648 Bacteria 907
601 Ga0495625_0000362 3300046660 Bacteria 69497
602 Ga0495625_0031630 3300046660 Bacteria 3933
603 Ga0495588_0264778 3300046674 Unclassified 906
604 Ga0495670_0002312 3300046691 Bacteria 9417
605 Ga0495671_0000006 3300046692 Bacteria 500471
606 Ga0495660_0000484 3300046810 Bacteria 33161
607 Ga0495604_0047813 3300047317 Bacteria 3331
608 Ga0495636_0010356 3300047318 Bacteria 3682
609 Ga0495683_0000079 3300047323 Bacteria 96333
610 Ga0495681_0050816 3300047470 Bacteria 1952
611 Ga0495686_0060297 3300047472 Bacteria 2359
612 Ga0495615_0057830 3300048090 Bacteria 1016
613 Ga0495626_0078800 3300048091 Bacteria 1467
614 Ga0495626_0095229 3300048091 Bacteria 1304
615 Ga0495626_0138329 3300048091 Bacteria 1034
616 Ga0496100_0594439 3300048903 Bacteria 859
617 Ga0496102_0001755 3300048905 Bacteria 18917
618 Ga0496102_0036708 3300048905 Bacteria 4416
619 Ga0496102_0047207 3300048905 Bacteria 3912
620 Ga0496102_0102899 3300048905 Bacteria 2655
621 Ga0496102_0839520 3300048905 Bacteria 841
622 Ga0496104_0014231 3300048907 Bacteria 7181
623 Ga0496104_1067454 3300048907 Bacteria 711
624 Ga0496106_0014891 3300048909 Bacteria 5753
625 Ga0496107_0029674 3300048910 Bacteria 3893
626 Ga0496107_0030293 3300048910 Bacteria 3857
627 Ga0496109_0061532 3300048912 Bacteria 3432
628 Ga0496112_0005601 3300048915 Bacteria 10892
629 Ga0496112_0349570 3300048915 Bacteria 1421
630 Ga0496113_0033418 3300048916 Bacteria 3745
631 Ga0496113_0303190 3300048916 Unclassified 1279
632 Ga0496113_0425505 3300048916 Bacteria 1067
633 Ga0496114_1025408 3300048917 Bacteria 709
634 Ga0496121_0153883 3300048924 Bacteria 1689
635 Ga0496122_0008622 3300048925 Bacteria 10945
636 Ga0496123_0009128 3300048926 Bacteria 8972
637 Ga0496124_0098966 3300048927 Bacteria 2365
638 Ga0496126_0031046 3300048929 Bacteria 5054
639 Ga0496126_0395996 3300048929 Bacteria 1121
640 Ga0501310_003920 3300049130 Bacteria 1473
641 Ga0495682_0040174 3300049460 Bacteria 1716
642 Ga0501295_000664 3300049518 Bacteria 3227
643 Ga0501300_004637 3300049523 Bacteria 2033
644 Ga0501032_0127621 3300049569 Bacteria 1679
645 Ga0501033_0003236 3300049570 Bacteria 13474
646 Ga0501033_0010481 3300049570 Bacteria 7110
647 Ga0501033_0033222 3300049570 Bacteria 3874
648 Ga0501033_0084621 3300049570 Bacteria 2324
649 Ga0501033_0099157 3300049570 Bacteria 2127
650 Ga0501033_0106255 3300049570 Bacteria 2045
651 Ga0501033_0177232 3300049570 Bacteria 1529
652 Ga0501034_0014593 3300049571 Bacteria 8088
653 Ga0501034_0029450 3300049571 Bacteria 5580
654 Ga0501034_0043880 3300049571 Bacteria 4522
655 Ga0501034_0113887 3300049571 Bacteria 2694
656 Ga0501036_0001437 3300049572 Bacteria 18309
657 Ga0501036_0083371 3300049572 Bacteria 2702
658 Ga0501036_0179170 3300049572 Bacteria 1784
659 Ga0501036_0184880 3300049572 Bacteria 1754
660 Ga0501037_0005886 3300049573 Bacteria 8960
661 Ga0501037_0017242 3300049573 Bacteria 5317
662 Ga0501037_0074982 3300049573 Bacteria 2457
663 Ga0501037_0109552 3300049573 Bacteria 1990
664 Ga0501038_0002195 3300049574 Bacteria 18153
665 Ga0501038_0009271 3300049574 Bacteria 9026
666 Ga0501038_0418042 3300049574 Bacteria 1035
667 Ga0501039_0034416 3300049575 Bacteria 3909
668 Ga0501039_0123174 3300049575 Bacteria 2032
669 Ga0501039_0313667 3300049575 Bacteria 1233
670 Ga0501040_0000010 3300049576 Bacteria 80841
671 Ga0501040_0077260 3300049576 Bacteria 2303
672 Ga0501041_0008456 3300049577 Bacteria 6055
673 Ga0501041_0040286 3300049577 Bacteria 2835
674 Ga0501041_0150534 3300049577 Bacteria 1453
675 Ga0501042_0000323 3300049578 Bacteria 23831
676 Ga0501042_0074718 3300049578 Bacteria 2425
677 Ga0501043_0023855 3300049579 Bacteria 4798
678 Ga0501043_0025869 3300049579 Bacteria 4604
679 Ga0501043_0124534 3300049579 Bacteria 2021
680 Ga0501043_0299341 3300049579 Bacteria 1229
681 Ga0501046_0004727 3300049580 Bacteria 12284
682 Ga0501046_0123836 3300049580 Bacteria 1965
683 Ga0501046_0135376 3300049580 Bacteria 1866
684 Ga0501047_0000984 3300049581 Bacteria 28735
685 Ga0501047_0009139 3300049581 Bacteria 9356
686 Ga0501047_0093597 3300049581 Bacteria 2884
687 Ga0501047_0106118 3300049581 Bacteria 2689
688 Ga0501047_0186772 3300049581 Bacteria 1938
689 Ga0501047_0250758 3300049581 Bacteria 1619
690 Ga0501047_0302899 3300049581 Unclassified 1440
691 Ga0501047_0305728 3300049581 Bacteria 1432
692 Ga0501048_0020833 3300049582 Bacteria 4804
693 Ga0501048_0084795 3300049582 Bacteria 2234
694 Ga0501068_0024875 3300049584 Bacteria 3519
695 Ga0501070_0070755 3300049586 Bacteria 2888
696 Ga0501070_0082962 3300049586 Bacteria 2653
697 Ga0501070_0121976 3300049586 Bacteria 2154
698 Ga0501070_0130847 3300049586 Bacteria 2073
699 Ga0501070_0298675 3300049586 Bacteria 1312
700 Ga0501071_0020060 3300049587 Bacteria 4644
701 Ga0501071_0084352 3300049587 Bacteria 2328
702 Ga0501072_0033851 3300049588 Bacteria 4003
703 Ga0501072_0039242 3300049588 Bacteria 3718
704 Ga0501072_0150802 3300049588 Bacteria 1853
705 Ga0501073_0116260 3300049589 Bacteria 1854
706 Ga0501073_0330784 3300049589 Bacteria 1052
707 Ga0501074_0135492 3300049590 Bacteria 1761
708 Ga0501075_0000090 3300049591 Bacteria 41736
709 Ga0501075_0058090 3300049591 Bacteria 2913
710 Ga0501076_0003453 3300049592 Bacteria 11085
711 Ga0501076_0019707 3300049592 Bacteria 5158
712 Ga0501076_0597280 3300049592 Bacteria 911
713 Ga0501077_0000017 3300049593 Bacteria 86892
714 Ga0501077_0043870 3300049593 Bacteria 2841
715 Ga0501077_0226542 3300049593 Bacteria 1188
716 Ga0501211_000027 3300049658 Bacteria 10788
717 Ga0501222_005706 3300049662 Bacteria 1674
718 Ga0501223_020669 3300049663 Bacteria 1288
719 Ga0501227_001013 3300049665 Bacteria 6227
720 Ga0501233_030032 3300049668 Bacteria 1222
721 Ga0501235_004365 3300049669 Bacteria 3059
722 Ga0501236_017275 3300049670 Bacteria 1030
723 Ga0501253_001290 3300049683 Bacteria 2508
724 Ga0501255_000775 3300049684 Bacteria 2334
725 Ga0501257_000064 3300049686 Bacteria 29858
726 Ga0501221_000998 3300049704 Bacteria 4650
727 Ga0501229_006708 3300049706 Bacteria 1426
728 Ga0501079_0000063 3300049741 Bacteria 48461
729 Ga0501079_0133991 3300049741 Bacteria 1928
730 Ga0501080_0020796 3300049742 Bacteria 6075
731 Ga0501080_0054679 3300049742 Bacteria 3717
732 Ga0501081_0000085 3300049743 Bacteria 37187
733 Ga0501081_0044647 3300049743 Bacteria 3042
734 Ga0501081_0081609 3300049743 Bacteria 2265
735 Ga0501081_0378437 3300049743 Bacteria 1046
736 Ga0501083_0057315 3300049744 Bacteria 2608
737 Ga0501262_001434 3300049759 Bacteria 2674
738 Ga0501267_000696 3300049764 Bacteria 2696
739 Ga0501268_008679 3300049765 Bacteria 1546
740 Ga0501269_010095 3300049766 Bacteria 1146
741 Ga0501274_003133 3300049771 Bacteria 1325
742 Ga0501280_004097 3300049776 Bacteria 2168
743 Ga0501282_019814 3300049778 Bacteria 737
744 Ga0501283_019534 3300049779 Bacteria 1073
745 Ga0501035_0002403 3300049822 Bacteria 18351
746 Ga0501035_0003576 3300049822 Bacteria 14852
747 Ga0501035_0010161 3300049822 Bacteria 8736
748 Ga0501035_0011687 3300049822 Bacteria 8137
749 Ga0501035_0038689 3300049822 Bacteria 4318
750 Ga0501035_0099678 3300049822 Bacteria 2550
751 Ga0501035_0367969 3300049822 Bacteria 1200
752 Ga0501035_0553431 3300049822 Bacteria 942
753 Ga0501044_0003486 3300049823 Bacteria 17718
754 Ga0501044_0013688 3300049823 Bacteria 8767
755 Ga0501044_0019918 3300049823 Bacteria 7166
756 Ga0501044_0023203 3300049823 Bacteria 6602
757 Ga0501044_0093581 3300049823 Bacteria 3030
758 Ga0501044_0248177 3300049823 Bacteria 1722
759 Ga0501045_0004295 3300049824 Bacteria 9827
760 Ga0501045_0056311 3300049824 Bacteria 2875
761 nmdc:mga00v17_412249_c1 3300050491 Bacteria 878
762 nmdc:mga0yw44_250829_c1 3300050492 Bacteria 1178
763 nmdc:mga0k408_139038_c1 3300050493 Bacteria 1444
764 nmdc:mga0k408_33801_c1 3300050493 Bacteria 2926
765 nmdc:mga0k408_7914_c1 3300050493 Bacteria 5692
766 nmdc:mga06z11_118651_c1 3300050494 Bacteria 1473
767 nmdc:mga06z11_3889_c1 3300050494 Bacteria 5823
768 nmdc:mga07m45_15425_c1 3300050496 Bacteria 4080
769 nmdc:mga07m45_46577_c1 3300050496 Bacteria 2437
770 nmdc:mga07m45_5812_c1 3300050496 Bacteria 6184
771 nmdc:mga05p37_13597_c1 3300050507 Bacteria 9754
772 nmdc:mga05p37_23630_c1 3300050507 Bacteria 7462
773 nmdc:mga09592_11219_c1 3300050508 Bacteria 7291
774 nmdc:mga09592_61725_c1 3300050508 Bacteria 3170
775 nmdc:mga0qj67_11191_c1 3300050509 Bacteria 6719
776 nmdc:mga0qj67_32483_c1 3300050509 Bacteria 4070
777 nmdc:mga0qj67_387_c1 3300050509 Bacteria 30412
778 nmdc:mga0qj67_503545_c1 3300050509 Bacteria 973
779 nmdc:mga06r32_14997_c1 3300050510 Bacteria 7034
780 nmdc:mga06r32_33713_c1 3300050510 Bacteria 4824
781 nmdc:mga06r32_497125_c1 3300050510 Bacteria 1197
782 nmdc:mga08y16_12498_c2 3300050511 Bacteria 5604
783 nmdc:mga08y16_162264_c1 3300050511 Bacteria 2322
784 nmdc:mga08y16_267526_c1 3300050511 Bacteria 1765
785 nmdc:mga08y16_95098_c1 3300050511 Bacteria 3104
786 nmdc:mga0n895_148318_c1 3300050512 Bacteria 2375
787 nmdc:mga0n895_531651_c1 3300050512 Bacteria 1183
788 nmdc:mga0n895_81312_c1 3300050512 Bacteria 3229
789 nmdc:mga0rr50_101551_c1 3300050513 Bacteria 2261
790 nmdc:mga0rr50_60001_c1 3300050513 Bacteria 2859
791 nmdc:mga0a205_25112_c1 3300050515 Bacteria 5673
792 nmdc:mga0sz30_227324_c1 3300050516 Bacteria 830
793 Ga0500643_036169 3300053087 Bacteria 1476
794 Ga0500643_079371 3300053087 Bacteria 903
795 Ga0500643_081047 3300053087 Bacteria 891
796 Ga0500643_103732 3300053087 Bacteria 770
797 Ga0500641_0103669 3300053096 Bacteria 1221
798 Ga0500557_020196 3300053105 Bacteria 1891
799 Ga0500562_000349 3300053108 Bacteria 11114
800 Ga0500592_000217 3300053116 Bacteria 10476
801 Ga0500608_010809 3300053122 Bacteria 3934
802 Ga0500618_000391 3300053125 Bacteria 30070
803 Ga0500642_0000002 3300053130 Bacteria 795093
804 Ga0500658_0014928 3300053134 Bacteria 2879
805 Ga0500564_186009 3300053138 Bacteria 863
806 Ga0500604_0035494 3300053151 Bacteria 1484
807 Ga0500616_0004492 3300053153 Bacteria 9917
808 Ga0500622_0000023 3300053156 Bacteria 251170
809 Ga0500622_0283844 3300053156 Bacteria 712
810 Ga0500627_0000027 3300053158 Bacteria 99420
811 Ga0500627_0000230 3300053158 Bacteria 15971
812 Ga0501084_0033174 3300054114 Bacteria 4318
813 Ga0501082_0000908 3300060353 Bacteria 26064
814 Ga0501082_0046584 3300060353 Bacteria 3737
815 Ga0501082_0224781 3300060353 Bacteria 1633
816 Ga0530510_0132847 3300061734 Bacteria 1831
817 Ga0530510_0300547 3300061734 Bacteria 1201
818 2547374908 2547132103 Bacteria 5115736
819 2501077461 2501025502 Bacteria 9641094
820 2511092593 2510917013 Bacteria 9951648
821 2513557193 2513237082 Bacteria 8640282
822 2513562819 2513237083 Bacteria 8410967
823 2515683113 2515154122 Bacteria 8609520
824 2526211242 2526164512 Bacteria 4025691
825 2643835631 2643221563 Bacteria 4726935
826 2644056557 2643221608 Bacteria 4724829
827 2687583839 2687453130 Bacteria 4227172
828 2722885979 2721755523 Bacteria 6430384
829 2745162240 2744054655 Bacteria 3552603
830 2746090958 2744054900 Bacteria 8399525
831 2746093507 2744054901 Bacteria 8397047
832 2812368642 2811994881 Bacteria 6298475
833 2823422660 2823421272 Bacteria 5372474
834 2839144253 2839138175 Bacteria 6549354
835 2842326359 2842324504 Bacteria 9364110
836 2842351122 2842348783 Bacteria 9002918
837 2842455670 2842454564 Bacteria 8730687
838 2843695697 2843690924 Bacteria 5169057
839 2857505825 2857504554 Bacteria 5369913
840 2857568318 2857564685 Bacteria 6290584
841 2881104249 2881101125 Bacteria 4590519
842 2881928003 2881927736 Bacteria 3993927
843 2887379156 2887375801 Bacteria 5334027
844 2887631410 2887630918 Bacteria 3239855
845 2895516954 2895511927 Bacteria 6802080
846 2919501933 2919501602 Bacteria 5286340
847 2919509092 2919506607 Bacteria 3392955
848 2923522701 2923519811 Bacteria 6298479
849 2926063606 2926063275 Bacteria 5285848
850 2932423370 2932422444 Bacteria 4678430
851 2974320744 2974320154 Bacteria 4571377
852 2998344880 2998344455 Bacteria 4222996
853 8003955977 8003955200 Bacteria 8601927
854 JGI24750J21931_1016224
855 JGI24749J21850_1028161
856 JGI24744J21845_10039574
857 JGI24034J26672_10006470
858 rootL2_10083363
859 Ga0055526_1013787
860 Ga0055537_1005105
861 Ga0055524_1001263
862 Ga0055536_1003133
863 Ga0055536_1004801
864 Ga0055536_1005155
865 Ga0055534_1010687
866 Ga0055530_10000310
867 Ga0055531_10002945
868 Ga0055531_10007831
869 Ga0055531_10027351
870 Ga0058692_1000431
871 Ga0065704_10148704
872 Ga0065715_10100239
873 Ga0065707_10029968
874 Ga0070658_10002553
875 Ga0070676_10260264
876 Ga0070676_10261845
877 Ga0070683_100358925
878 Ga0070683_100508954
879 Ga0070690_100003142
880 Ga0070670_100006524
881 Ga0070670_100026480
882 Ga0070670_100134969
883 Ga0070670_100304558
884 Ga0070670_100468456
885 Ga0070670_100556076
886 Ga0070677_10006039
887 Ga0070677_10091383
888 Ga0068869_100001182
889 Ga0068869_100017486
890 Ga0068869_100557786
891 Ga0068869_100942753
892 Ga0070666_10026489
893 Ga0070666_10144040
894 Ga0070680_100177831
895 Ga0070660_100003289
896 Ga0070660_100018896
897 Ga0070689_100008082
898 Ga0070687_100000376
899 Ga0070661_100036204
900 Ga0070661_100245864
901 Ga0070668_100613705
902 Ga0070669_100000001
903 Ga0070669_100169463
904 Ga0070675_100004297
905 Ga0070675_100018240
906 Ga0070675_100022287
907 Ga0070671_100000002
908 Ga0070671_100029085
909 Ga0070671_100041611
910 Ga0070674_100000167
911 Ga0070673_100056243
912 Ga0070688_100000491
913 Ga0070688_100233179
914 Ga0070659_100000743
915 Ga0070659_100000820
916 Ga0070659_100004983
917 Ga0070659_100030874
918 Ga0070659_100091984
919 Ga0070667_100004785
920 Ga0070703_10031602
921 Ga0070701_10043469
922 Ga0070705_100000983
923 Ga0070705_100005445
924 Ga0070705_100482493
925 Ga0070700_100025169
926 Ga0070700_100295253
927 Ga0070694_100324945
928 Ga0070708_100040828
929 Ga0070663_100015868
930 Ga0070663_100501343
931 Ga0070678_100003331
932 Ga0070678_100006518
933 Ga0070678_100020327
934 Ga0070662_100002454
935 Ga0070681_10001866
936 Ga0070681_10015969
937 Ga0070681_10095047
938 Ga0070681_10176869
939 Ga0070681_10351413
940 Ga0068867_100014253
941 Ga0068867_100127993
942 Ga0070685_10000312
943 Ga0070706_100003178
944 Ga0070707_100130219
945 Ga0070679_100022623
946 Ga0070679_100055690
947 Ga0070679_100226611
948 Ga0070679_100403233
949 Ga0070684_100044363
950 Ga0068853_100005451
951 Ga0068853_100007924
952 Ga0068853_100501382
953 Ga0070672_100011434
954 Ga0070672_100441412
955 Ga0070686_100004704
956 Ga0070696_100033486
957 Ga0070696_100047787
958 Ga0070693_100000389
959 Ga0070693_100307119
960 Ga0070665_100058556
961 Ga0070665_100181062
962 Ga0070665_100273288
963 Ga0070704_100018066
964 Ga0070704_100193390
965 Ga0068855_100001278
966 Ga0068855_100001819
967 Ga0070664_100011160
968 Ga0068857_100214791
969 Ga0068854_100032491
970 Ga0068854_100057209
971 Ga0068854_100707637
972 Ga0068856_100012081
973 Ga0068856_100020253
974 Ga0068856_100295606
975 Ga0068856_100669876
976 Ga0070702_100349868
977 Ga0068852_100004791
978 Ga0068852_100251423
979 Ga0068859_100002725
980 Ga0068864_100000323
981 Ga0068864_100040657
982 Ga0068864_100162383
983 Ga0068864_100207846
984 Ga0068861_100001192
985 Ga0068861_100002755
986 Ga0068861_100033317
987 Ga0068851_10000396
988 Ga0068870_10000513
989 Ga0068870_10001473
990 Ga0068870_10059711
991 Ga0068870_10138612
992 Ga0068863_100011337
993 Ga0068863_100017755
994 Ga0068863_100081617
995 Ga0068863_100084708
996 Ga0068863_100288715
997 Ga0068863_100290501
998 Ga0068858_100024171
999 Ga0068858_100107416
1000 Ga0068858_100230425
1001 Ga0068858_100682680
1002 Ga0068860_100057650
1003 Ga0068860_100286332
1004 Ga0068860_100296685
1005 Ga0068862_100000856
1006 Ga0068862_100004739
1007 Ga0068862_100019061
1008 Ga0068862_100204582
1009 Ga0081455_10035349
1010 Ga0081455_10159847
1011 Ga0081540_1000069
1012 Ga0081540_1000394
1013 Ga0075365_10065906
1014 Ga0075368_10000982
1015 Ga0075363_100071829
1016 Ga0075432_10126682
1017 Ga0070715_10070721
1018 Ga0070715_10097515
1019 Ga0075362_10010431
1020 Ga0075367_10014576
1021 Ga0075367_10018531
1022 Ga0075366_10068062
1023 Ga0097621_100000838
1024 Ga0097621_100016607
1025 Ga0097621_100103834
1026 Ga0075370_10091817
1027 Ga0068871_100000675
1028 Ga0068871_100000829
1029 Ga0068871_100054493
1030 Ga0068871_100191445
1031 Ga0075428_100593091
1032 Ga0075430_100005542
1033 Ga0075430_100018913
1034 Ga0075430_100334527
1035 Ga0075431_100001427
1036 Ga0075431_100248618
1037 Ga0075431_100416241
1038 Ga0075431_100625367
1039 Ga0075433_10064014
1040 Ga0075434_100084101
1041 Ga0075429_100054288
1042 Ga0097620_100002725
1043 Ga0079104_1000020
1044 Ga0075435_100060907
1045 Ga0105244_10069369
1046 Ga0105250_10000684
1047 Ga0105240_10001833
1048 Ga0105240_10103614
1049 Ga0111539_10001473
1050 Ga0111539_10118726
1051 Ga0111539_10191639
1052 Ga0105245_10001784
1053 Ga0105247_10000499
1054 Ga0105247_10001755
1055 Ga0105247_10092067
1056 Ga0114129_10005737
1057 Ga0114129_10028119
1058 Ga0114129_10034844
1059 Ga0114129_10845816
1060 Ga0114129_11530976
1061 Ga0105243_10003516
1062 Ga0105243_10040411
1063 Ga0105241_10099312
1064 Ga0105241_10106187
1065 Ga0105241_10491433
1066 Ga0105241_10623475
1067 Ga0105242_10000776
1068 Ga0105242_10016603
1069 Ga0105248_10052796
1070 Ga0105248_10270480
1071 Ga0105237_10000240
1072 Ga0105237_10151970
1073 Ga0105238_10001156
1074 Ga0105238_10002207
1075 Ga0105238_10046900
1076 Ga0105249_10002404
1077 Ga0105249_10064841
1078 Ga0105239_10003666
1079 Ga0105239_10261190
1080 Ga0105246_10005681
1081 Ga0157373_10001212
1082 Ga0157373_10009846
1083 Ga0157371_10001038
1084 Ga0157371_10004495
1085 Ga0157371_10017286
1086 Ga0157370_10000662
1087 Ga0157370_10002750
1088 Ga0157370_10008238
1089 Ga0157369_10024719
1090 Ga0157374_10000876
1091 Ga0157374_10593162
1092 Ga0157378_10000880
1093 Ga0157378_10183652
1094 Ga0157378_10420922
1095 Ga0163162_10001408
1096 Ga0163162_10017854
1097 Ga0163162_10468019
1098 Ga0163162_10867132
1099 Ga0163162_11403658
1100 Ga0157372_10013278
1101 Ga0157372_10030186
1102 Ga0157375_10012511
1103 Ga0157375_10080250
1104 Ga0157375_10265028
1105 Ga0163163_10071581
1106 Ga0163163_10076193
1107 Ga0163163_10158478
1108 Ga0157380_10011035
1109 Ga0157380_10032233
1110 Ga0157380_10152128
1111 Ga0157377_10000421
1112 Ga0157379_10002360
1113 Ga0157379_10095916
1114 Ga0157379_10223518
1115 Ga0157379_10330518
1116 Ga0157379_10416273
1117 Ga0157376_10004912
1118 Ga0157376_10047151
1119 Ga0157376_10066788
1120 Ga0157376_10081219
1121 Ga0182007_10043767
1122 Ga0183369_1007
1123 Ga0163161_10019395
1124 Ga0213872_10000211
1125 Ga0213872_10029040
1126 Ga0213876_10000987
1127 Ga0213876_10130061
1128 Ga0209674_100635
1129 Ga0209026_1000037
1130 Ga0209565_1001442
1131 Ga0209675_1000025
1132 Ga0209675_1003444
1133 Ga0209676_1000198
1134 Ga0209676_1001165
1135 Ga0209676_1001500
1136 Ga0209676_1050538
1137 Ga0209025_1028558
1138 Ga0209025_1096882
1139 Ga0209564_1003296
1140 Ga0209758_1007867
1141 Ga0209050_1000104
1142 Ga0209050_1002306
1143 Ga0209050_1013188
1144 Ga0209256_1000964
1145 Ga0209257_1000860
1146 Ga0209257_1001790
1147 Ga0209257_1003091
1148 Ga0209257_1018503
1149 Ga0207697_10000248
1150 Ga0207697_10001354
1151 Ga0207697_10004831
1152 Ga0207656_10007391
1153 Ga0207656_10048795
1154 Ga0207696_1002516
1155 Ga0207682_10000093
1156 Ga0207682_10001426
1157 Ga0207642_10099894
1158 Ga0207710_10004910
1159 Ga0207710_10036099
1160 Ga0207688_10022722
1161 Ga0207680_10000256
1162 Ga0207680_10021323
1163 Ga0207680_10124747
1164 Ga0207680_10139928
1165 Ga0207647_10020714
1166 Ga0207647_10272005
1167 Ga0207645_10000101
1168 Ga0207645_10139169
1169 Ga0207643_10000166
1170 Ga0207643_10002758
1171 Ga0207643_10163904
1172 Ga0207643_10209240
1173 Ga0207705_10029847
1174 Ga0207705_10061876
1175 Ga0207684_10008871
1176 Ga0207654_10414508
1177 Ga0207707_10012137
1178 Ga0207707_10013190
1179 Ga0207707_10092784
1180 Ga0207707_10138615
1181 Ga0207707_10145645
1182 Ga0207695_10087457
1183 Ga0207695_10114082
1184 Ga0207663_10391493
1185 Ga0207660_10294296
1186 Ga0207662_10000010
1187 Ga0207657_10000353
1188 Ga0207657_10030005
1189 Ga0207657_10038401
1190 Ga0207649_10045312
1191 Ga0207649_10056595
1192 Ga0207652_10023091
1193 Ga0207652_10168974
1194 Ga0207652_10327530
1195 Ga0207646_10041233
1196 Ga0207681_10000002
1197 Ga0207681_10019058
1198 Ga0207694_10000623
1199 Ga0207694_10021700
1200 Ga0207694_10062426
1201 Ga0207650_10003185
1202 Ga0207650_10024028
1203 Ga0207650_10201645
1204 Ga0207650_10219288
1205 Ga0207659_10020488
1206 Ga0207659_10109120
1207 Ga0207659_10680183
1208 Ga0207687_10001680
1209 Ga0207687_10085191
1210 Ga0207700_10026229
1211 Ga0207644_10000002
1212 Ga0207644_10169640
1213 Ga0207644_10189599
1214 Ga0207644_10596442
1215 Ga0207644_10869035
1216 Ga0207690_10000424
1217 Ga0207690_10001856
1218 Ga0207690_10003818
1219 Ga0207690_10327261
1220 Ga0207706_10000077
1221 Ga0207706_10008405
1222 Ga0207686_10471912
1223 Ga0207709_10000055
1224 Ga0207709_10021881
1225 Ga0207670_10018583
1226 Ga0207669_10031514
1227 Ga0207704_10009730
1228 Ga0207704_10441779
1229 Ga0207665_10117829
1230 Ga0207665_10170312
1231 Ga0207691_10000033
1232 Ga0207691_10000680
1233 Ga0207691_10004283
1234 Ga0207711_10036711
1235 Ga0207711_10675841
1236 Ga0207689_10003350
1237 Ga0207689_10032746
1238 Ga0207689_10403368
1239 Ga0207689_10653300
1240 Ga0207661_10038621
1241 Ga0207661_10799434
1242 Ga0207679_10023078
1243 Ga0207667_10008704
1244 Ga0207667_10015762
1245 Ga0207651_10014737
1246 Ga0207651_10066916
1247 Ga0207712_10002383
1248 Ga0207712_10008093
1249 Ga0207668_10097860
1250 Ga0207640_10041946
1251 Ga0207640_10117583
1252 Ga0207640_10230495
1253 Ga0207640_10402962
1254 Ga0207658_10010583
1255 Ga0207658_10029130
1256 Ga0207658_10039364
1257 Ga0207677_10004853
1258 Ga0207677_10019078
1259 Ga0207703_10014955
1260 Ga0207703_10024943
1261 Ga0207703_10072035
1262 Ga0207639_10657331
1263 Ga0207678_10000464
1264 Ga0207678_10691855
1265 Ga0207708_10011861
1266 Ga0207708_10082139
1267 Ga0207708_10379530
1268 Ga0207708_10452851
1269 Ga0207702_10229162
1270 Ga0207641_10009679
1271 Ga0207641_10015606
1272 Ga0207641_10115063
1273 Ga0207641_10459667
1274 Ga0207648_10000189
1275 Ga0207648_10015036
1276 Ga0207648_10459721
1277 Ga0207676_10000304
1278 Ga0207676_10007112
1279 Ga0207676_10026418
1280 Ga0207676_10093156
1281 Ga0207676_10489054
1282 Ga0207674_10000224
1283 Ga0207674_10368821
1284 Ga0207675_100000043
1285 Ga0207675_100000137
1286 Ga0207675_100019121
1287 Ga0207675_100042371
1288 Ga0207683_10011248
1289 Ga0207683_10023264
1290 Ga0207683_10031886
1291 Ga0207683_10188941
1292 Ga0207683_10498685
1293 Ga0207698_10001141
1294 Ga0209281_1000002
1295 Ga0209983_1013907
1296 Ga0209813_10002831
1297 Ga0209974_10019699
1298 Ga0207428_10000018
1299 Ga0207428_10000043
1300 Ga0207428_10275384
1301 Ga0268266_10010399
1302 Ga0268266_10041792
1303 Ga0268266_10227150
1304 Ga0268265_10000264
1305 Ga0268265_10023793
1306 Ga0268265_10032629
1307 Ga0268265_10103258
1308 Ga0268265_10214672
1309 Ga0268265_10477623
1310 Ga0268264_10000071
1311 Ga0268264_10120771
1312 Ga0268264_10238196
1313 Ga0268264_10522847
1314 Ga0265323_10075991
1315 Ga0307515_10003406
1316 Ga0307515_10006103
1317 Ga0307515_10027473
1318 Ga0307515_10068694
1319 Ga0307515_10307019
1320 Ga0307515_10347750
1321 Ga0265338_10040980
1322 Ga0307512_10066250
1323 Ga0265332_10056750
1324 Ga0265339_10270648
1325 Ga0265316_10000349
1326 Ga0307513_10105713
1327 Ga0307513_10393839
1328 Ga0307509_10004212
1329 Ga0307408_100002690
1330 Ga0307408_100012733
1331 Ga0307408_100345880
1332 Ga0307408_100419130
1333 Ga0307408_100749231
1334 Ga0307508_10000048
1335 Ga0307508_10344018
1336 Ga0265314_10011769
1337 Ga0265314_10058937
1338 Ga0265342_10081350
1339 Ga0307516_10346404
1340 Ga0307405_10006369
1341 Ga0307405_10009680
1342 Ga0307405_10253818
1343 Ga0307413_10056193
1344 Ga0307413_10190893
1345 Ga0307518_10233755
1346 Ga0307410_10108851
1347 Ga0307410_10161971
1348 Ga0307410_10189257
1349 Ga0307406_10009322
1350 Ga0307406_10081421
1351 Ga0307406_10087312
1352 Ga0307406_10200855
1353 Ga0307407_10065456
1354 Ga0307407_10496013
1355 Ga0307412_10014216
1356 Ga0307412_10022171
1357 Ga0307412_10064124
1358 Ga0307412_10085707
1359 Ga0307412_10103139
1360 Ga0307412_10104851
1361 Ga0307412_10264090
1362 Ga0307412_10625517
1363 Ga0307412_10960940
1364 Ga0307409_100134923
1365 Ga0307409_100542934
1366 Ga0307416_100004163
1367 Ga0307416_100050988
1368 Ga0307416_100367942
1369 Ga0307416_101294113
1370 Ga0307414_10002973
1371 Ga0307414_10055406
1372 Ga0307414_10075866
1373 Ga0307414_10108443
1374 Ga0307411_10000528
1375 Ga0307411_10017762
1376 Ga0307411_10745652
1377 Ga0307415_100011676
1378 Ga0307415_100752758
1379 Ga0307510_10218823
1380 Ga0373940_0052288
1381 Ga0373943_0267748
1382 Ga0316574_0340729
1383 Ga0373931_0003751
1384 Ga0373931_0408658
1385 Ga0373937_0024289
1386 Ga0373937_0048181
1387 Ga0373937_0099401
1388 Ga0373937_0341582
1389 Ga0373925_0062160
1390 Ga0373925_0376142
1391 Ga0436364_0516927
1392 Ga0436364_0791589
1393 Ga0436365_1599716
1394 Ga0436361_0057254
1395 Ga0436361_0606718
1396 Ga0436361_0991571
1397 Ga0436361_1094211
1398 Ga0439438_000002
1399 Ga0439447_004906
1400 Ga0451839_1570770
1401 Ga0451841_0746418
1402 Ga0451851_0269188
1403 Ga0451843_1443981
1404 Ga0439441_024856
1405 Ga0439464_0009337
1406 Ga0439464_0011418
1407 Ga0450893_0000595
1408 Ga0451577_0503113
1409 Ga0439440_0021028
1410 Ga0466972_0074519
1411 Ga0453684_0063816
1412 Ga0453684_0110535
1413 Ga0453684_0194669
1414 Ga0453684_1344060
1415 Ga0466957_0285841
1416 Ga0451576_0246624
1417 Ga0495617_000554
1418 Ga0495627_073813
1419 Ga0495590_0003858
1420 Ga0495580_0000143
1421 Ga0495580_0422069
1422 Ga0495584_0001236
1423 Ga0495584_0211580
1424 Ga0495584_0315117
1425 Ga0495585_0000050
1426 Ga0495585_0000053
1427 Ga0495585_0002270
1428 Ga0495585_0019274
1429 Ga0495596_0004585
1430 Ga0495607_0032804
1431 Ga0495583_0000318
1432 Ga0495583_0046727
1433 Ga0495606_0076693
1434 Ga0495606_0153892
1435 Ga0495610_0000012
1436 Ga0495616_0000860
1437 Ga0495616_0002305
1438 Ga0495616_0023292
1439 Ga0495643_0080075
1440 Ga0495648_0000080
1441 Ga0495648_0000320
1442 Ga0495654_0001046
1443 Ga0495654_0028958
1444 Ga0495654_0086072
1445 Ga0495665_0010830
1446 Ga0495598_0028406
1447 Ga0495609_0003471
1448 Ga0495597_0000687
1449 Ga0495633_0001928
1450 Ga0495633_0021967
1451 Ga0495668_0000001
1452 Ga0495668_0005283
1453 Ga0495611_0209906
1454 Ga0495625_0000362
1455 Ga0495625_0031630
1456 Ga0495588_0264778
1457 Ga0495670_0002312
1458 Ga0495671_0000006
1459 Ga0495660_0000484
1460 Ga0495604_0047813
1461 Ga0495636_0010356
1462 Ga0495683_0000079
1463 Ga0495681_0050816
1464 Ga0495686_0060297
1465 Ga0495615_0057830
1466 Ga0495626_0078800
1467 Ga0495626_0095229
1468 Ga0495626_0138329
1469 Ga0496100_0594439
1470 Ga0496102_0001755
1471 Ga0496102_0036708
1472 Ga0496102_0047207
1473 Ga0496102_0102899
1474 Ga0496102_0839520
1475 Ga0496104_0014231
1476 Ga0496104_1067454
1477 Ga0496106_0014891
1478 Ga0496107_0029674
1479 Ga0496107_0030293
1480 Ga0496109_0061532
1481 Ga0496112_0005601
1482 Ga0496112_0349570
1483 Ga0496113_0033418
1484 Ga0496113_0303190
1485 Ga0496113_0425505
1486 Ga0496114_1025408
1487 Ga0496121_0153883
1488 Ga0496122_0008622
1489 Ga0496123_0009128
1490 Ga0496124_0098966
1491 Ga0496126_0031046
1492 Ga0496126_0395996
1493 Ga0501310_003920
1494 Ga0495682_0040174
1495 Ga0501295_000664
1496 Ga0501300_004637
1497 Ga0501032_0127621
1498 Ga0501033_0003236
1499 Ga0501033_0010481
1500 Ga0501033_0033222
1501 Ga0501033_0084621
1502 Ga0501033_0099157
1503 Ga0501033_0106255
1504 Ga0501033_0177232
1505 Ga0501034_0014593
1506 Ga0501034_0029450
1507 Ga0501034_0043880
1508 Ga0501034_0113887
1509 Ga0501036_0001437
1510 Ga0501036_0083371
1511 Ga0501036_0179170
1512 Ga0501036_0184880
1513 Ga0501037_0005886
1514 Ga0501037_0017242
1515 Ga0501037_0074982
1516 Ga0501037_0109552
1517 Ga0501038_0002195
1518 Ga0501038_0009271
1519 Ga0501038_0418042
1520 Ga0501039_0034416
1521 Ga0501039_0123174
1522 Ga0501039_0313667
1523 Ga0501040_0000010
1524 Ga0501040_0077260
1525 Ga0501041_0008456
1526 Ga0501041_0040286
1527 Ga0501041_0150534
1528 Ga0501042_0000323
1529 Ga0501042_0074718
1530 Ga0501043_0023855
1531 Ga0501043_0025869
1532 Ga0501043_0124534
1533 Ga0501043_0299341
1534 Ga0501046_0004727
1535 Ga0501046_0123836
1536 Ga0501046_0135376
1537 Ga0501047_0000984
1538 Ga0501047_0009139
1539 Ga0501047_0093597
1540 Ga0501047_0106118
1541 Ga0501047_0186772
1542 Ga0501047_0250758
1543 Ga0501047_0302899
1544 Ga0501047_0305728
1545 Ga0501048_0020833
1546 Ga0501048_0084795
1547 Ga0501068_0024875
1548 Ga0501070_0070755
1549 Ga0501070_0082962
1550 Ga0501070_0121976
1551 Ga0501070_0130847
1552 Ga0501070_0298675
1553 Ga0501071_0020060
1554 Ga0501071_0084352
1555 Ga0501072_0033851
1556 Ga0501072_0039242
1557 Ga0501072_0150802
1558 Ga0501073_0116260
1559 Ga0501073_0330784
1560 Ga0501074_0135492
1561 Ga0501075_0000090
1562 Ga0501075_0058090
1563 Ga0501076_0003453
1564 Ga0501076_0019707
1565 Ga0501076_0597280
1566 Ga0501077_0000017
1567 Ga0501077_0043870
1568 Ga0501077_0226542
1569 Ga0501211_000027
1570 Ga0501222_005706
1571 Ga0501223_020669
1572 Ga0501227_001013
1573 Ga0501233_030032
1574 Ga0501235_004365
1575 Ga0501236_017275
1576 Ga0501253_001290
1577 Ga0501255_000775
1578 Ga0501257_000064
1579 Ga0501221_000998
1580 Ga0501229_006708
1581 Ga0501079_0000063
1582 Ga0501079_0133991
1583 Ga0501080_0020796
1584 Ga0501080_0054679
1585 Ga0501081_0000085
1586 Ga0501081_0044647
1587 Ga0501081_0081609
1588 Ga0501081_0378437
1589 Ga0501083_0057315
1590 Ga0501262_001434
1591 Ga0501267_000696
1592 Ga0501268_008679
1593 Ga0501269_010095
1594 Ga0501274_003133
1595 Ga0501280_004097
1596 Ga0501282_019814
1597 Ga0501283_019534
1598 Ga0501035_0002403
1599 Ga0501035_0003576
1600 Ga0501035_0010161
1601 Ga0501035_0011687
1602 Ga0501035_0038689
1603 Ga0501035_0099678
1604 Ga0501035_0367969
1605 Ga0501035_0553431
1606 Ga0501044_0003486
1607 Ga0501044_0013688
1608 Ga0501044_0019918
1609 Ga0501044_0023203
1610 Ga0501044_0093581
1611 Ga0501044_0248177
1612 Ga0501045_0004295
1613 Ga0501045_0056311
1614 nmdc:mga00v17_412249_c1
1615 nmdc:mga0yw44_250829_c1
1616 nmdc:mga0k408_139038_c1
1617 nmdc:mga0k408_33801_c1
1618 nmdc:mga0k408_7914_c1
1619 nmdc:mga06z11_118651_c1
1620 nmdc:mga06z11_3889_c1
1621 nmdc:mga07m45_15425_c1
1622 nmdc:mga07m45_46577_c1
1623 nmdc:mga07m45_5812_c1
1624 nmdc:mga05p37_13597_c1
1625 nmdc:mga05p37_23630_c1
1626 nmdc:mga09592_11219_c1
1627 nmdc:mga09592_61725_c1
1628 nmdc:mga0qj67_11191_c1
1629 nmdc:mga0qj67_32483_c1
1630 nmdc:mga0qj67_387_c1
1631 nmdc:mga0qj67_503545_c1
1632 nmdc:mga06r32_14997_c1
1633 nmdc:mga06r32_33713_c1
1634 nmdc:mga06r32_497125_c1
1635 nmdc:mga08y16_12498_c2
1636 nmdc:mga08y16_162264_c1
1637 nmdc:mga08y16_267526_c1
1638 nmdc:mga08y16_95098_c1
1639 nmdc:mga0n895_148318_c1
1640 nmdc:mga0n895_531651_c1
1641 nmdc:mga0n895_81312_c1
1642 nmdc:mga0rr50_101551_c1
1643 nmdc:mga0rr50_60001_c1
1644 nmdc:mga0a205_25112_c1
1645 nmdc:mga0sz30_227324_c1
1646 Ga0500643_036169
1647 Ga0500643_079371
1648 Ga0500643_081047
1649 Ga0500643_103732
1650 Ga0500641_0103669
1651 Ga0500557_020196
1652 Ga0500562_000349
1653 Ga0500592_000217
1654 Ga0500608_010809
1655 Ga0500618_000391
1656 Ga0500642_0000002
1657 Ga0500658_0014928
1658 Ga0500564_186009
1659 Ga0500604_0035494
1660 Ga0500616_0004492
1661 Ga0500622_0000023
1662 Ga0500622_0283844
1663 Ga0500627_0000027
1664 Ga0500627_0000230
1665 Ga0501084_0033174
1666 Ga0501082_0000908
1667 Ga0501082_0046584
1668 Ga0501082_0224781
1669 Ga0530510_0132847
1670 Ga0530510_0300547
1671 2547374908
1672 2501077461
1673 2511092593
1674 2513557193
1675 2513562819
1676 2515683113
1677 2526211242
1678 2643835631
1679 2644056557
1680 2687583839
1681 2722885979
1682 2745162240
1683 2746090958
1684 2746093507
1685 2812368642
1686 2823422660
1687 2839144253
1688 2842326359
1689 2842351122
1690 2842455670
1691 2843695697
1692 2857505825
1693 2857568318
1694 2881104249
1695 2881928003
1696 2887379156
1697 2887631410
1698 2895516954
1699 2919501933
1700 2919509092
1701 2923522701
1702 2926063606
1703 2932423370
1704 2974320744
1705 2998344880
1706 8003955977

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18331

PKHD_C

PKHD-type hydroxylase C-terminal domain

223

265

0.99

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

122

217

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9797 2 226
3dkq-assembly1.cif.gz_C-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9616 1 226
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9425 2 226
3dkq-assembly1.cif.gz_A-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9418 1 226
3dkq-assembly1.cif.gz_C-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9362 1 226
ID Description Score Start End Superfamily
3dkqA02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9654 180 226 4.10.860.20
3dkqC02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9645 180 226 4.10.860.20
3dkqC01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.963 2 178 2.60.120.620
3dkqA02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9456 180 226 4.10.860.20
3dkqC02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9448 180 226 4.10.860.20
ID Description Score Start End GO Terms
AF-A0A1H8NHS7-F1-model_v4 PKHD-type hydroxylase 0.9975 1 199 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A399IX52-F1-model_v4 Fe2+-dependent dioxygenase 0.9968 1 226 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A377TSW3-F1-model_v4 Iron-uptake factor PiuC (EC 1.14.11.-) 0.9959 111 191 GO:0006879
GO:0006974
GO:0016706
AF-A0A1I3CYU9-F1-model_v4 PKHD-type hydroxylase 0.9952 1 226 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-G6XFC2-F1-model_v4 Putative hydroxylase 0.9944 1 226 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418

Map