F483567

General Info

Members Datasets Scaffolds Average Seq Length
853 245 1706 332

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2857553236|2857555084
Length 360
Sequence RTPAPAAPQGANPGATPAATLPALGTAGTAAPTAVSNSLPEAVRALAQADFSAVAQRFGAAGFAVAQPADGILTIKGAGERPALLISVGVHGDETGPIEMVAYLLDALSHEASQLAVNLMLCVGNIGAIRAGKRFIDADLNRMFRAERGTLAGTAEAARADQLIAATTDFFADAGPVRWHLDLHTAIRPSVYPTFAIVPEIIAEEPRRALLAWLGVAGIGAVIMNPASVGTYSYYSAEHHGAAGTTVELGRIGTLGQNDLAQFADASQALGDLLRGAPSRNAARQPHIFNTARQIIKLSDGFRMAFGKETHNFTPMQQGEEIARDGDTVYTVQHPEELVVFPNPDVRVGLRAGLMVVRVA

Samples

Sample ID Description Type Environment
1 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
28 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
44 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
45 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
72 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
73 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
74 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
75 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
76 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
90 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
109 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
206 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
207 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
208 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
209 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
210 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
211 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 2857553236 Duganella sp. R-74557 Isolate Unclassified
219 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
220 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
221 2643221556 Massilia sp. Root1485 Isolate Unclassified
222 2643221638 Duganella sp. Root336D2 Isolate Unclassified
223 2643221645 Massilia sp. Root351 Isolate Unclassified
224 2643221664 Massilia sp. Root418 Isolate Unclassified
225 2643221684 Massilia sp. Root133 Isolate Unclassified
226 2738541280 Massilia sp. GV090 Isolate Unclassified
227 2738541297 Duganella sp. GV083 Isolate Unclassified
228 2738541300 Massilia sp. GV016 Isolate Unclassified
229 2738541357 Duganella sp. GV053 Isolate Unclassified
230 2738543003 Duganella sp. GV066 Isolate Unclassified
231 2738543018 Massilia sp. GV045 Isolate Unclassified
232 2738543026 Duganella sp. GV089 Isolate Unclassified
233 2738543029 Duganella sp. GV039 Isolate Unclassified
234 2738543030 Massilia sp. GV097 Isolate Unclassified
235 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
236 2821131069 Duganella sp. 1224 Isolate Unclassified
237 2842711865 Duganella sp. R-73148 Isolate Unclassified
238 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
239 2857558681 Duganella sp. R-74565 Isolate Unclassified
240 2857564685 Duganella sp. R-74599 Isolate Unclassified
241 2904424332 Duganella sp. 1411 Isolate Rhizosphere
242 2919476304 Duganella sp. 3397 Isolate Unclassified
243 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
244 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
245 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 0
Isolates 3.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.61
Nodule 0.47
Rhizoplane 2.93
Rhizosphere 80.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001205 3300002738 Bacteria 9793
2 JGI25158J39367_1001581 3300002739 Bacteria 3939
3 JGI25152J39213_1000984 3300002773 Bacteria 13846
4 JGI25150J39212_1001562 3300002774 Bacteria 6258
5 JGI25150J39212_1002141 3300002774 Bacteria 5094
6 JGI25159J45721_1002467 3300002987 Bacteria 7011
7 JGI25159J45721_1003828 3300002987 Bacteria 5179
8 JGI25153J46596_10006574 3300003215 Bacteria 5861
9 rootH2_10009316 3300003320 Bacteria 2332
10 rootL2_10036042 3300003322 Bacteria 3053
11 rootL2_10036043 3300003322 Bacteria 2920
12 rootL2_10083718 3300003322 Bacteria 6423
13 rootL2_10223152 3300003322 Bacteria 1822
14 rootH1_10105201 3300003323 Bacteria 2960
15 JGI25161J50226_1000613 3300003374 Bacteria 14678
16 JGI25161J50226_1001395 3300003374 Bacteria 7363
17 Ga0055525_1000240 3300003759 Bacteria 57118
18 Ga0055529_1000565 3300003763 Bacteria 30558
19 Ga0055526_1000095 3300003771 Bacteria 80903
20 Ga0055526_1000190 3300003771 Bacteria 53306
21 Ga0055526_1001759 3300003771 Bacteria 15035
22 Ga0055526_1003690 3300003771 Bacteria 9575
23 Ga0055526_1007818 3300003771 Bacteria 5472
24 Ga0055537_1000174 3300003773 Bacteria 47786
25 Ga0055537_1005171 3300003773 Bacteria 3552
26 Ga0055524_1000026 3300003775 Bacteria 214653
27 Ga0055524_1000981 3300003775 Bacteria 17800
28 Ga0055524_1002417 3300003775 Bacteria 9639
29 Ga0055524_1002688 3300003775 Bacteria 9000
30 Ga0055524_1010357 3300003775 Bacteria 3719
31 Ga0055534_1000173 3300003784 Bacteria 47984
32 Ga0055534_1016629 3300003784 Bacteria 1317
33 Ga0055528_1000221 3300003790 Bacteria 48033
34 Ga0055530_10001768 3300003791 Bacteria 15073
35 Ga0055530_10011808 3300003791 Bacteria 3102
36 Ga0055531_10001784 3300003794 Bacteria 15294
37 Ga0055543_1001112 3300004625 Bacteria 11574
38 Ga0055543_1001358 3300004625 Bacteria 9890
39 Ga0065165_1000067 3300005262 Bacteria 170811
40 Ga0065165_1000557 3300005262 Bacteria 55476
41 Ga0065165_1002329 3300005262 Bacteria 16595
42 Ga0065165_1024128 3300005262 Bacteria 2049
43 Ga0070676_10190969 3300005328 Bacteria 1337
44 Ga0070680_100127346 3300005336 Bacteria 2128
45 Ga0070660_100140760 3300005339 Bacteria 1935
46 Ga0070664_100035506 3300005564 Bacteria 4185
47 Ga0075363_100194264 3300006048 Bacteria 1158
48 Ga0079104_1013115 3300006946 Bacteria 2570
49 Ga0099826_10000057 3300006948 Bacteria 66174
50 Ga0105244_10000660 3300009036 Bacteria 30257
51 Ga0105244_10004640 3300009036 Bacteria 9388
52 Ga0105240_10325661 3300009093 Bacteria 1750
53 Ga0105241_10023792 3300009174 Bacteria 4545
54 Ga0105242_10002231 3300009176 Bacteria 15286
55 Ga0157371_10000064 3300013102 Bacteria 169056
56 Ga0157374_10312477 3300013296 Bacteria 1556
57 Ga0182008_10001391 3300014497 Bacteria 16347
58 Ga0182008_10070880 3300014497 Bacteria 1714
59 Ga0182006_1000070 3300015261 Bacteria 137793
60 Ga0182006_1052061 3300015261 Bacteria 1574
61 Ga0182007_10000021 3300015262 Bacteria 193408
62 Ga0182007_10012860 3300015262 Bacteria 3210
63 Ga0182005_1000003 3300015265 Bacteria 683269
64 Ga0182005_1000009 3300015265 Bacteria 455334
65 Ga0163161_10014883 3300017792 Bacteria 5419
66 Ga0163161_10075549 3300017792 Bacteria 2473
67 Ga0213872_10000252 3300021361 Bacteria 46619
68 Ga0213872_10002540 3300021361 Bacteria 10636
69 Ga0213872_10012630 3300021361 Bacteria 3970
70 Ga0209436_100436 3300025208 Bacteria 18674
71 Ga0209436_100847 3300025208 Bacteria 12326
72 Ga0209563_100162 3300025230 Bacteria 57170
73 Ga0207425_1000006 3300025245 Bacteria 808854
74 Ga0207425_1000205 3300025245 Bacteria 47028
75 Ga0207425_1000557 3300025245 Bacteria 22130
76 Ga0209646_1000114 3300025246 Bacteria 152958
77 Ga0209677_100780 3300025253 Bacteria 16057
78 Ga0209148_1001089 3300025254 Bacteria 16423
79 Ga0209129_1000009 3300025258 Bacteria 633100
80 Ga0209565_1000006 3300025263 Bacteria 897294
81 Ga0209565_1000163 3300025263 Bacteria 87185
82 Ga0209565_1000663 3300025263 Bacteria 21967
83 Ga0209565_1007053 3300025263 Bacteria 3075
84 Ga0209455_1000063 3300025272 Bacteria 333019
85 Ga0209673_1000004 3300025273 Bacteria 896155
86 Ga0209673_1010854 3300025273 Bacteria 3805
87 Ga0209130_1000476 3300025284 Bacteria 41280
88 Ga0209130_1001030 3300025284 Bacteria 21370
89 Ga0209130_1001382 3300025284 Bacteria 16324
90 Ga0209675_1000123 3300025291 Bacteria 106157
91 Ga0209675_1000635 3300025291 Bacteria 24937
92 Ga0209675_1004820 3300025291 Bacteria 5852
93 Ga0209025_1005086 3300025294 Bacteria 10942
94 Ga0209564_1000006 3300025295 Bacteria 1100927
95 Ga0209564_1000026 3300025295 Bacteria 519154
96 Ga0209564_1000098 3300025295 Bacteria 228906
97 Ga0209564_1000420 3300025295 Bacteria 74634
98 Ga0209564_1002333 3300025295 Bacteria 15360
99 Ga0209564_1033304 3300025295 Bacteria 1535
100 Ga0209758_1000071 3300025297 Bacteria 283749
101 Ga0209758_1000270 3300025297 Bacteria 102973
102 Ga0209050_1000183 3300025298 Bacteria 142357
103 Ga0209050_1000753 3300025298 Bacteria 46582
104 Ga0209050_1001864 3300025298 Bacteria 20283
105 Ga0209256_1000013 3300025299 Bacteria 689442
106 Ga0209256_1000219 3300025299 Bacteria 106112
107 Ga0209256_1000499 3300025299 Bacteria 57588
108 Ga0209256_1001083 3300025299 Bacteria 31411
109 Ga0209256_1001601 3300025299 Bacteria 22163
110 Ga0207426_1001358 3300025302 Bacteria 20744
111 Ga0209257_1000010 3300025304 Bacteria 1158682
112 Ga0209257_1006224 3300025304 Bacteria 7826
113 Ga0207655_1004677 3300025728 Bacteria 9597
114 Ga0207705_10046551 3300025909 Bacteria 3117
115 Ga0207654_10010255 3300025911 Bacteria 4769
116 Ga0207660_10120839 3300025917 Bacteria 1984
117 Ga0207657_10032341 3300025919 Bacteria 4728
118 Ga0207657_10085364 3300025919 Bacteria 2644
119 Ga0207706_10125572 3300025933 Bacteria 2257
120 Ga0207686_10028225 3300025934 Bacteria 3296
121 Ga0207709_10011579 3300025935 Bacteria 4865
122 Ga0207667_10027260 3300025949 Bacteria 6223
123 Ga0207678_10242607 3300026067 Bacteria 1543
124 Ga0207698_10055145 3300026142 Bacteria 3061
125 Ga0209281_1003864 3300027111 Bacteria 4717
126 Ga0209282_1000087 3300027666 Bacteria 66192
127 Ga0316177_1172766 3300030731 Bacteria 1471
128 Ga0316180_1005039 3300030736 Bacteria 7066
129 Ga0316183_1124839 3300030742 Bacteria 1130
130 Ga0316182_1367475 3300030745 Bacteria 4376
131 Ga0307408_100000879 3300031548 Bacteria 23623
132 Ga0307408_100002313 3300031548 Bacteria 13517
133 Ga0307408_100008109 3300031548 Bacteria 6942
134 Ga0307408_100013562 3300031548 Bacteria 5410
135 Ga0307408_100024495 3300031548 Bacteria 4122
136 Ga0265314_10012082 3300031711 Bacteria 7077
137 Ga0307412_10256848 3300031911 Bacteria 1360
138 Ga0307416_100004160 3300032002 Bacteria 8670
139 Ga0395899_0000192 3300037312 Bacteria 90240
140 Ga0395899_0001780 3300037312 Bacteria 17854
141 Ga0395899_0019231 3300037312 Bacteria 5191
142 Ga0395899_0019480 3300037312 Bacteria 5153
143 Ga0395899_0030594 3300037312 Bacteria 4048
144 Ga0395899_0037293 3300037312 Bacteria 3644
145 Ga0395899_0125640 3300037312 Bacteria 1835
146 Ga0395899_0126059 3300037312 Bacteria 1831
147 Ga0395899_0233953 3300037312 Bacteria 1267
148 Ga0395900_0001232 3300037418 Bacteria 31460
149 Ga0395900_0009769 3300037418 Bacteria 9832
150 Ga0395900_0036042 3300037418 Bacteria 5098
151 Ga0395900_0039664 3300037418 Bacteria 4852
152 Ga0395900_0065515 3300037418 Bacteria 3732
153 Ga0395900_0099302 3300037418 Bacteria 2990
154 Ga0395900_0102779 3300037418 Bacteria 2935
155 Ga0395900_0255651 3300037418 Bacteria 1751
156 Ga0395900_0271717 3300037418 Bacteria 1689
157 Ga0395898_0005609 3300037466 Bacteria 13529
158 Ga0395898_0305099 3300037466 Bacteria 1518
159 Ga0395898_0359859 3300037466 Bacteria 1388
160 Ga0395898_0418388 3300037466 Bacteria 1277
161 Ga0395905_0043487 3300037471 Bacteria 4214
162 Ga0395905_0072804 3300037471 Bacteria 3221
163 Ga0395905_0162969 3300037471 Bacteria 2095
164 Ga0395905_0185667 3300037471 Bacteria 1951
165 Ga0395901_0000765 3300038443 Bacteria 36025
166 Ga0395901_0004814 3300038443 Bacteria 13618
167 Ga0395901_0013622 3300038443 Bacteria 8267
168 Ga0395901_0120469 3300038443 Bacteria 2757
169 Ga0395901_0217468 3300038443 Bacteria 1998
170 Ga0395901_0318901 3300038443 Bacteria 1608
171 Ga0436361_0084965 3300039447 Bacteria 10934
172 Ga0436361_0112693 3300039447 Bacteria 3852
173 Ga0436361_0176065 3300039447 Bacteria 2768
174 Ga0436361_0746884 3300039447 Bacteria 2166
175 Ga0439448_0036561 3300042005 Bacteria 1575
176 Ga0439449_0026548 3300042007 Bacteria 2161
177 Ga0439455_0006165 3300042012 Bacteria 2475
178 Ga0450904_000146 3300042139 Bacteria 15761
179 Ga0466969_0109217 3300044656 Bacteria 1296
180 Ga0466969_0113067 3300044656 Bacteria 1269
181 Ga0466965_0006320 3300044683 Bacteria 5369
182 Ga0466965_0018362 3300044683 Bacteria 3352
183 Ga0466965_0022953 3300044683 Bacteria 3010
184 Ga0466965_0045468 3300044683 Bacteria 2171
185 Ga0466965_0150166 3300044683 Bacteria 1217
186 Ga0466966_0016810 3300044684 Bacteria 4833
187 Ga0466966_0031676 3300044684 Bacteria 3428
188 Ga0466966_0124790 3300044684 Bacteria 1579
189 Ga0466966_0219799 3300044684 Bacteria 1147
190 Ga0466966_0238982 3300044684 Bacteria 1095
191 Ga0466961_0082936 3300044693 Bacteria 2027
192 Ga0466963_0071950 3300044694 Bacteria 2328
193 Ga0466964_0000119 3300044706 Bacteria 20317
194 Ga0466971_0029523 3300044719 Bacteria 2453
195 Ga0466971_0162234 3300044719 Bacteria 1046
196 Ga0466968_0000336 3300044735 Bacteria 15168
197 Ga0466970_0045537 3300044765 Bacteria 2336
198 Ga0466970_0113561 3300044765 Bacteria 1480
199 Ga0466957_0001264 3300044842 Bacteria 13167
200 Ga0466957_0011201 3300044842 Bacteria 5165
201 Ga0466960_0050437 3300044901 Bacteria 2006
202 Ga0466959_0037614 3300045049 Bacteria 3576
203 Ga0466959_0058058 3300045049 Bacteria 2819
204 Ga0466959_0122504 3300045049 Bacteria 1847
205 Ga0466958_0060471 3300045836 Bacteria 2306
206 Ga0466958_0107706 3300045836 Bacteria 1738
207 Ga0466967_0000568 3300045976 Bacteria 18156
208 Ga0495617_000043 3300046452 Bacteria 121136
209 Ga0495617_000048 3300046452 Bacteria 113357
210 Ga0495617_001501 3300046452 Bacteria 10180
211 Ga0495627_000046 3300046453 Bacteria 176186
212 Ga0495627_000247 3300046453 Bacteria 56624
213 Ga0495627_003783 3300046453 Bacteria 6527
214 Ga0495627_014437 3300046453 Bacteria 2757
215 Ga0495627_040308 3300046453 Bacteria 1438
216 Ga0495603_0048555 3300046455 Bacteria 2527
217 Ga0495603_0091179 3300046455 Bacteria 1782
218 Ga0495603_0154625 3300046455 Bacteria 1331
219 Ga0495590_0000030 3300046457 Bacteria 146237
220 Ga0495590_0000049 3300046457 Bacteria 113002
221 Ga0495590_0000194 3300046457 Bacteria 34520
222 Ga0495590_0033269 3300046457 Bacteria 1802
223 Ga0495591_000996 3300046458 Bacteria 19240
224 Ga0495638_0000105 3300046460 Bacteria 134384
225 Ga0495638_0003678 3300046460 Bacteria 11938
226 Ga0495638_0008923 3300046460 Bacteria 7069
227 Ga0495638_0016192 3300046460 Bacteria 4998
228 Ga0495638_0112362 3300046460 Bacteria 1617
229 Ga0495653_0000094 3300046463 Bacteria 74354
230 Ga0495653_0007689 3300046463 Bacteria 8821
231 Ga0495653_0039277 3300046463 Bacteria 3708
232 Ga0495653_0117040 3300046463 Bacteria 1905
233 Ga0495650_0000099 3300046471 Bacteria 215347
234 Ga0495650_0000173 3300046471 Bacteria 142734
235 Ga0495650_0000212 3300046471 Bacteria 124622
236 Ga0495650_0000227 3300046471 Bacteria 114662
237 Ga0495650_0000712 3300046471 Bacteria 42514
238 Ga0495650_0000965 3300046471 Bacteria 33010
239 Ga0495650_0002850 3300046471 Bacteria 13228
240 Ga0495650_0005244 3300046471 Bacteria 8500
241 Ga0495650_0025053 3300046471 Bacteria 2805
242 Ga0495580_0066954 3300046472 Bacteria 2513
243 Ga0495582_0001659 3300046473 Bacteria 12550
244 Ga0495582_0025907 3300046473 Bacteria 3213
245 Ga0495582_0113031 3300046473 Bacteria 1526
246 Ga0495605_0000005 3300046474 Bacteria 376973
247 Ga0495605_0000166 3300046474 Bacteria 83477
248 Ga0495605_0002561 3300046474 Bacteria 11178
249 Ga0495605_0003634 3300046474 Bacteria 9147
250 Ga0495605_0006592 3300046474 Bacteria 6652
251 Ga0495605_0014957 3300046474 Bacteria 4230
252 Ga0495605_0030194 3300046474 Bacteria 2781
253 Ga0495605_0042535 3300046474 Bacteria 2257
254 Ga0495605_0083690 3300046474 Bacteria 1489
255 Ga0495605_0124487 3300046474 Bacteria 1167
256 Ga0495639_0004731 3300046475 Bacteria 5854
257 Ga0495584_0000334 3300046491 Bacteria 32657
258 Ga0495584_0000381 3300046491 Bacteria 30594
259 Ga0495584_0000416 3300046491 Bacteria 29358
260 Ga0495584_0000755 3300046491 Bacteria 21387
261 Ga0495584_0001114 3300046491 Bacteria 16663
262 Ga0495584_0002572 3300046491 Bacteria 10236
263 Ga0495584_0002915 3300046491 Bacteria 9547
264 Ga0495584_0003787 3300046491 Bacteria 8240
265 Ga0495584_0006061 3300046491 Bacteria 6365
266 Ga0495584_0021069 3300046491 Bacteria 3310
267 Ga0495584_0030820 3300046491 Bacteria 2716
268 Ga0495584_0033434 3300046491 Bacteria 2601
269 Ga0495584_0041021 3300046491 Bacteria 2337
270 Ga0495584_0047164 3300046491 Bacteria 2172
271 Ga0495584_0057780 3300046491 Bacteria 1952
272 Ga0495584_0119209 3300046491 Bacteria 1336
273 Ga0495585_0000186 3300046492 Bacteria 66357
274 Ga0495585_0000635 3300046492 Bacteria 32413
275 Ga0495585_0000889 3300046492 Bacteria 25313
276 Ga0495585_0001049 3300046492 Bacteria 22873
277 Ga0495585_0002016 3300046492 Bacteria 15049
278 Ga0495585_0002268 3300046492 Bacteria 13898
279 Ga0495585_0005229 3300046492 Bacteria 8225
280 Ga0495585_0005760 3300046492 Bacteria 7774
281 Ga0495585_0005859 3300046492 Bacteria 7702
282 Ga0495585_0009633 3300046492 Bacteria 5783
283 Ga0495585_0017392 3300046492 Bacteria 4153
284 Ga0495585_0017981 3300046492 Bacteria 4079
285 Ga0495585_0020740 3300046492 Bacteria 3777
286 Ga0495585_0024467 3300046492 Bacteria 3462
287 Ga0495585_0030688 3300046492 Bacteria 3056
288 Ga0495585_0034000 3300046492 Bacteria 2882
289 Ga0495585_0048099 3300046492 Bacteria 2372
290 Ga0495594_0000268 3300046499 Bacteria 25591
291 Ga0495594_0047838 3300046499 Bacteria 2349
292 Ga0495596_0000282 3300046500 Bacteria 33869
293 Ga0495596_0000645 3300046500 Bacteria 21885
294 Ga0495596_0001341 3300046500 Bacteria 14167
295 Ga0495596_0002323 3300046500 Bacteria 10332
296 Ga0495596_0005703 3300046500 Bacteria 5843
297 Ga0495596_0011811 3300046500 Bacteria 3750
298 Ga0495596_0020834 3300046500 Bacteria 2680
299 Ga0495596_0036907 3300046500 Bacteria 1935
300 Ga0495596_0084604 3300046500 Bacteria 1231
301 Ga0495607_0000096 3300046501 Bacteria 92031
302 Ga0495607_0000569 3300046501 Bacteria 36001
303 Ga0495607_0000724 3300046501 Bacteria 31707
304 Ga0495607_0000761 3300046501 Bacteria 30878
305 Ga0495607_0001243 3300046501 Bacteria 22865
306 Ga0495607_0002135 3300046501 Bacteria 16497
307 Ga0495607_0002170 3300046501 Bacteria 16331
308 Ga0495607_0005681 3300046501 Bacteria 8885
309 Ga0495607_0007121 3300046501 Bacteria 7774
310 Ga0495607_0011667 3300046501 Bacteria 5839
311 Ga0495607_0019573 3300046501 Bacteria 4297
312 Ga0495607_0044535 3300046501 Bacteria 2616
313 Ga0495607_0045656 3300046501 Bacteria 2575
314 Ga0495607_0173349 3300046501 Bacteria 1087
315 Ga0495583_0000004 3300046506 Bacteria 655287
316 Ga0495583_0000202 3300046506 Bacteria 100020
317 Ga0495583_0000264 3300046506 Bacteria 86123
318 Ga0495583_0000441 3300046506 Bacteria 62379
319 Ga0495583_0000814 3300046506 Bacteria 38403
320 Ga0495583_0001286 3300046506 Bacteria 26201
321 Ga0495583_0001598 3300046506 Bacteria 22251
322 Ga0495583_0003093 3300046506 Bacteria 13166
323 Ga0495583_0008985 3300046506 Bacteria 6026
324 Ga0495583_0013482 3300046506 Bacteria 4557
325 Ga0495583_0017405 3300046506 Bacteria 3816
326 Ga0495583_0080303 3300046506 Bacteria 1417
327 Ga0495583_0104505 3300046506 Bacteria 1206
328 Ga0495583_0122548 3300046506 Bacteria 1093
329 Ga0495606_0000297 3300046507 Bacteria 85779
330 Ga0495606_0000316 3300046507 Bacteria 83307
331 Ga0495606_0000392 3300046507 Bacteria 74042
332 Ga0495606_0000407 3300046507 Bacteria 72652
333 Ga0495606_0001023 3300046507 Bacteria 40538
334 Ga0495606_0001620 3300046507 Bacteria 29381
335 Ga0495606_0001999 3300046507 Bacteria 25129
336 Ga0495606_0004430 3300046507 Bacteria 14042
337 Ga0495606_0009159 3300046507 Bacteria 8423
338 Ga0495606_0010941 3300046507 Bacteria 7462
339 Ga0495606_0013894 3300046507 Bacteria 6321
340 Ga0495606_0029868 3300046507 Bacteria 3819
341 Ga0495606_0036330 3300046507 Bacteria 3356
342 Ga0495606_0038798 3300046507 Bacteria 3218
343 Ga0495606_0079968 3300046507 Bacteria 2035
344 Ga0495606_0089712 3300046507 Bacteria 1893
345 Ga0495606_0106260 3300046507 Bacteria 1700
346 Ga0495606_0161244 3300046507 Bacteria 1308
347 Ga0495610_0000021 3300046512 Bacteria 336300
348 Ga0495610_0004163 3300046512 Bacteria 10818
349 Ga0495610_0005524 3300046512 Bacteria 8956
350 Ga0495610_0007549 3300046512 Bacteria 7203
351 Ga0495610_0010164 3300046512 Bacteria 5872
352 Ga0495610_0017653 3300046512 Bacteria 4061
353 Ga0495610_0045123 3300046512 Bacteria 2182
354 Ga0495616_0000093 3300046513 Bacteria 75781
355 Ga0495616_0003148 3300046513 Bacteria 10653
356 Ga0495616_0004567 3300046513 Bacteria 8713
357 Ga0495616_0009647 3300046513 Bacteria 5628
358 Ga0495616_0011377 3300046513 Bacteria 5104
359 Ga0495616_0014699 3300046513 Bacteria 4374
360 Ga0495616_0018466 3300046513 Bacteria 3827
361 Ga0495616_0022716 3300046513 Bacteria 3383
362 Ga0495616_0023637 3300046513 Bacteria 3304
363 Ga0495616_0024016 3300046513 Bacteria 3275
364 Ga0495616_0027019 3300046513 Bacteria 3048
365 Ga0495616_0038171 3300046513 Bacteria 2467
366 Ga0495616_0046693 3300046513 Bacteria 2184
367 Ga0495616_0053298 3300046513 Bacteria 2010
368 Ga0495616_0056296 3300046513 Bacteria 1942
369 Ga0495616_0056860 3300046513 Bacteria 1930
370 Ga0495616_0085255 3300046513 Bacteria 1504
371 Ga0495616_0128197 3300046513 Bacteria 1165
372 Ga0495616_0135948 3300046513 Bacteria 1123
373 Ga0495630_0004025 3300046517 Bacteria 10290
374 Ga0495631_0001048 3300046518 Bacteria 17158
375 Ga0495631_0002340 3300046518 Bacteria 10796
376 Ga0495631_0004353 3300046518 Bacteria 7549
377 Ga0495631_0006705 3300046518 Bacteria 5912
378 Ga0495631_0013362 3300046518 Bacteria 3987
379 Ga0495631_0024947 3300046518 Bacteria 2756
380 Ga0495631_0025730 3300046518 Bacteria 2706
381 Ga0495631_0026325 3300046518 Bacteria 2672
382 Ga0495631_0038354 3300046518 Bacteria 2130
383 Ga0495631_0045901 3300046518 Bacteria 1922
384 Ga0495631_0060192 3300046518 Bacteria 1648
385 Ga0495631_0068364 3300046518 Bacteria 1536
386 Ga0495632_0000767 3300046519 Bacteria 28772
387 Ga0495632_0001357 3300046519 Bacteria 20586
388 Ga0495632_0001660 3300046519 Bacteria 18231
389 Ga0495632_0001724 3300046519 Bacteria 17773
390 Ga0495632_0002930 3300046519 Bacteria 12519
391 Ga0495632_0006046 3300046519 Bacteria 7858
392 Ga0495632_0012234 3300046519 Bacteria 4956
393 Ga0495632_0017893 3300046519 Bacteria 3899
394 Ga0495637_0000014 3300046520 Bacteria 228956
395 Ga0495637_0000305 3300046520 Bacteria 38029
396 Ga0495637_0000773 3300046520 Bacteria 21569
397 Ga0495637_0015806 3300046520 Bacteria 3535
398 Ga0495637_0060063 3300046520 Bacteria 1563
399 Ga0495643_0000181 3300046522 Bacteria 100368
400 Ga0495643_0000671 3300046522 Bacteria 40243
401 Ga0495643_0000937 3300046522 Bacteria 30281
402 Ga0495643_0001243 3300046522 Bacteria 24444
403 Ga0495643_0001245 3300046522 Bacteria 24424
404 Ga0495643_0006755 3300046522 Bacteria 7504
405 Ga0495643_0017650 3300046522 Bacteria 4166
406 Ga0495643_0027199 3300046522 Bacteria 3217
407 Ga0495643_0042960 3300046522 Bacteria 2461
408 Ga0495643_0057050 3300046522 Bacteria 2082
409 Ga0495643_0057185 3300046522 Bacteria 2079
410 Ga0495643_0058551 3300046522 Bacteria 2050
411 Ga0495644_0000382 3300046523 Bacteria 20043
412 Ga0495644_0001305 3300046523 Bacteria 10232
413 Ga0495644_0003383 3300046523 Bacteria 6307
414 Ga0495644_0011664 3300046523 Bacteria 3383
415 Ga0495644_0012340 3300046523 Bacteria 3285
416 Ga0495644_0015007 3300046523 Bacteria 2966
417 Ga0495644_0032250 3300046523 Bacteria 1979
418 Ga0495644_0045042 3300046523 Bacteria 1659
419 Ga0495644_0055847 3300046523 Bacteria 1483
420 Ga0495648_0000008 3300046524 Bacteria 336584
421 Ga0495648_0000630 3300046524 Bacteria 37610
422 Ga0495648_0000641 3300046524 Bacteria 37280
423 Ga0495648_0002408 3300046524 Bacteria 17360
424 Ga0495648_0002619 3300046524 Bacteria 16404
425 Ga0495648_0005235 3300046524 Bacteria 10841
426 Ga0495648_0013719 3300046524 Bacteria 5972
427 Ga0495648_0014230 3300046524 Bacteria 5835
428 Ga0495648_0035338 3300046524 Bacteria 3240
429 Ga0495648_0038625 3300046524 Bacteria 3050
430 Ga0495648_0040831 3300046524 Bacteria 2937
431 Ga0495648_0071931 3300046524 Bacteria 2003
432 Ga0495663_0008141 3300046525 Bacteria 2900
433 Ga0495663_0008736 3300046525 Bacteria 2809
434 Ga0495663_0061583 3300046525 Bacteria 1181
435 Ga0495666_0014021 3300046526 Bacteria 3997
436 Ga0495666_0029609 3300046526 Bacteria 2693
437 Ga0495666_0111156 3300046526 Bacteria 1287
438 Ga0495642_0000152 3300046528 Bacteria 40332
439 Ga0495642_0000998 3300046528 Bacteria 13126
440 Ga0495642_0001319 3300046528 Bacteria 11120
441 Ga0495642_0001367 3300046528 Bacteria 10912
442 Ga0495642_0002062 3300046528 Bacteria 8349
443 Ga0495642_0002875 3300046528 Bacteria 6872
444 Ga0495642_0013297 3300046528 Bacteria 3181
445 Ga0495642_0014547 3300046528 Bacteria 3049
446 Ga0495642_0015359 3300046528 Bacteria 2976
447 Ga0495642_0018894 3300046528 Bacteria 2698
448 Ga0495642_0061264 3300046528 Bacteria 1561
449 Ga0495642_0073912 3300046528 Bacteria 1428
450 Ga0495652_0049824 3300046529 Bacteria 3583
451 Ga0495654_0000005 3300046530 Bacteria 491381
452 Ga0495654_0005741 3300046530 Bacteria 7149
453 Ga0495654_0006696 3300046530 Bacteria 6520
454 Ga0495654_0009500 3300046530 Bacteria 5330
455 Ga0495654_0012640 3300046530 Bacteria 4533
456 Ga0495654_0019573 3300046530 Bacteria 3540
457 Ga0495654_0020870 3300046530 Bacteria 3411
458 Ga0495665_0003040 3300046531 Bacteria 9060
459 Ga0495665_0015057 3300046531 Bacteria 4168
460 Ga0495665_0019062 3300046531 Bacteria 3687
461 Ga0495586_0060012 3300046535 Bacteria 2067
462 Ga0495587_0019888 3300046536 Bacteria 4148
463 Ga0495587_0066826 3300046536 Bacteria 2096
464 Ga0495587_0073973 3300046536 Bacteria 1979
465 Ga0495609_0000028 3300046538 Bacteria 219908
466 Ga0495609_0001456 3300046538 Bacteria 15692
467 Ga0495609_0002966 3300046538 Bacteria 10039
468 Ga0495609_0003418 3300046538 Bacteria 9102
469 Ga0495609_0003945 3300046538 Bacteria 8310
470 Ga0495609_0006149 3300046538 Bacteria 6174
471 Ga0495609_0007225 3300046538 Bacteria 5571
472 Ga0495609_0009016 3300046538 Bacteria 4850
473 Ga0495609_0009954 3300046538 Bacteria 4579
474 Ga0495609_0011099 3300046538 Bacteria 4301
475 Ga0495609_0017421 3300046538 Bacteria 3335
476 Ga0495609_0019760 3300046538 Bacteria 3114
477 Ga0495609_0029253 3300046538 Bacteria 2509
478 Ga0495609_0059667 3300046538 Bacteria 1687
479 Ga0495609_0063479 3300046538 Bacteria 1630
480 Ga0495597_0000310 3300046542 Bacteria 43852
481 Ga0495597_0000532 3300046542 Bacteria 31535
482 Ga0495597_0000608 3300046542 Bacteria 29332
483 Ga0495597_0001660 3300046542 Bacteria 15511
484 Ga0495597_0001872 3300046542 Bacteria 14376
485 Ga0495597_0004456 3300046542 Bacteria 7687
486 Ga0495597_0004598 3300046542 Bacteria 7529
487 Ga0495597_0012166 3300046542 Bacteria 4158
488 Ga0495597_0046718 3300046542 Bacteria 1918
489 Ga0495597_0072421 3300046542 Bacteria 1482
490 Ga0495597_0073061 3300046542 Bacteria 1475
491 Ga0495597_0076320 3300046542 Bacteria 1437
492 Ga0495622_0000129 3300046557 Bacteria 65178
493 Ga0495622_0000188 3300046557 Bacteria 49618
494 Ga0495622_0017063 3300046557 Bacteria 3380
495 Ga0495622_0019269 3300046557 Bacteria 3177
496 Ga0495633_0000357 3300046558 Bacteria 49514
497 Ga0495633_0000482 3300046558 Bacteria 40356
498 Ga0495633_0000719 3300046558 Bacteria 30043
499 Ga0495633_0002368 3300046558 Bacteria 13357
500 Ga0495633_0005377 3300046558 Bacteria 7852
501 Ga0495633_0008321 3300046558 Bacteria 5858
502 Ga0495633_0008327 3300046558 Bacteria 5855
503 Ga0495633_0010545 3300046558 Bacteria 5037
504 Ga0495633_0012347 3300046558 Bacteria 4548
505 Ga0495633_0015004 3300046558 Bacteria 4027
506 Ga0495633_0015894 3300046558 Bacteria 3896
507 Ga0495633_0018091 3300046558 Bacteria 3584
508 Ga0495633_0056839 3300046558 Bacteria 1838
509 Ga0495656_0002701 3300046615 Bacteria 5925
510 Ga0495656_0002787 3300046615 Bacteria 5845
511 Ga0495656_0006401 3300046615 Bacteria 4130
512 Ga0495656_0009302 3300046615 Bacteria 3529
513 Ga0495668_0000008 3300046616 Bacteria 498364
514 Ga0495668_0000300 3300046616 Bacteria 68118
515 Ga0495668_0001032 3300046616 Bacteria 29505
516 Ga0495668_0001841 3300046616 Bacteria 19123
517 Ga0495668_0001915 3300046616 Bacteria 18542
518 Ga0495668_0002416 3300046616 Bacteria 15427
519 Ga0495668_0007280 3300046616 Bacteria 7095
520 Ga0495668_0008374 3300046616 Bacteria 6466
521 Ga0495668_0008543 3300046616 Bacteria 6376
522 Ga0495668_0016395 3300046616 Bacteria 4306
523 Ga0495668_0030829 3300046616 Bacteria 3024
524 Ga0495668_0031634 3300046616 Bacteria 2982
525 Ga0495668_0032192 3300046616 Bacteria 2952
526 Ga0495668_0043980 3300046616 Bacteria 2482
527 Ga0495668_0080089 3300046616 Bacteria 1792
528 Ga0495668_0087471 3300046616 Bacteria 1708
529 Ga0495668_0164690 3300046616 Bacteria 1214
530 Ga0495634_0047634 3300046642 Bacteria 2887
531 Ga0495611_0000131 3300046648 Bacteria 52209
532 Ga0495611_0002991 3300046648 Bacteria 7534
533 Ga0495611_0004829 3300046648 Bacteria 5792
534 Ga0495611_0016345 3300046648 Bacteria 3172
535 Ga0495611_0019185 3300046648 Bacteria 2936
536 Ga0495611_0022023 3300046648 Bacteria 2755
537 Ga0495611_0025969 3300046648 Bacteria 2554
538 Ga0495611_0031180 3300046648 Bacteria 2345
539 Ga0495611_0056795 3300046648 Bacteria 1773
540 Ga0495611_0072163 3300046648 Bacteria 1579
541 Ga0495611_0095291 3300046648 Bacteria 1377
542 Ga0495625_0000278 3300046660 Bacteria 79607
543 Ga0495625_0002185 3300046660 Bacteria 21708
544 Ga0495625_0003794 3300046660 Bacteria 14641
545 Ga0495625_0004032 3300046660 Bacteria 14037
546 Ga0495625_0006985 3300046660 Bacteria 9953
547 Ga0495625_0007318 3300046660 Bacteria 9642
548 Ga0495625_0009103 3300046660 Bacteria 8373
549 Ga0495625_0015461 3300046660 Bacteria 6044
550 Ga0495625_0035796 3300046660 Bacteria 3655
551 Ga0495625_0044244 3300046660 Bacteria 3224
552 Ga0495625_0072408 3300046660 Bacteria 2417
553 Ga0495625_0072994 3300046660 Bacteria 2406
554 Ga0495625_0075835 3300046660 Bacteria 2352
555 Ga0495625_0142380 3300046660 Bacteria 1617
556 Ga0495659_0000007 3300046664 Bacteria 105393
557 Ga0495659_0000931 3300046664 Bacteria 10386
558 Ga0495659_0005383 3300046664 Bacteria 4026
559 Ga0495659_0025108 3300046664 Bacteria 2037
560 Ga0495659_0041694 3300046664 Bacteria 1641
561 Ga0495661_0000157 3300046665 Bacteria 80637
562 Ga0495661_0000711 3300046665 Bacteria 32864
563 Ga0495661_0002008 3300046665 Bacteria 16041
564 Ga0495661_0002128 3300046665 Bacteria 15526
565 Ga0495661_0002647 3300046665 Bacteria 13704
566 Ga0495661_0011292 3300046665 Bacteria 6062
567 Ga0495661_0011488 3300046665 Bacteria 6008
568 Ga0495661_0018406 3300046665 Bacteria 4596
569 Ga0495661_0034570 3300046665 Bacteria 3179
570 Ga0495661_0042309 3300046665 Bacteria 2808
571 Ga0495661_0045861 3300046665 Bacteria 2670
572 Ga0495661_0053986 3300046665 Bacteria 2414
573 Ga0495661_0066040 3300046665 Bacteria 2130
574 Ga0495661_0103249 3300046665 Bacteria 1600
575 Ga0495661_0166376 3300046665 Bacteria 1179
576 Ga0495588_0000113 3300046674 Bacteria 137279
577 Ga0495588_0029096 3300046674 Bacteria 2769
578 Ga0495588_0033499 3300046674 Bacteria 2594
579 Ga0495588_0034285 3300046674 Bacteria 2568
580 Ga0495588_0071717 3300046674 Bacteria 1801
581 Ga0495588_0145693 3300046674 Bacteria 1251
582 Ga0495588_0156240 3300046674 Bacteria 1206
583 Ga0495623_0011075 3300046679 Bacteria 5835
584 Ga0495623_0034053 3300046679 Bacteria 3267
585 Ga0495623_0034082 3300046679 Bacteria 3266
586 Ga0495646_0103761 3300046680 Bacteria 1627
587 Ga0495669_0000075 3300046684 Bacteria 65812
588 Ga0495669_0003735 3300046684 Bacteria 6262
589 Ga0495669_0009941 3300046684 Bacteria 4023
590 Ga0495669_0027108 3300046684 Bacteria 2505
591 Ga0495669_0061261 3300046684 Bacteria 1703
592 Ga0495669_0109691 3300046684 Bacteria 1288
593 Ga0495613_0004700 3300046689 Bacteria 10246
594 Ga0495624_0004226 3300046690 Bacteria 10550
595 Ga0495670_0002596 3300046691 Bacteria 8931
596 Ga0495670_0007804 3300046691 Bacteria 5263
597 Ga0495670_0011876 3300046691 Bacteria 4285
598 Ga0495670_0016174 3300046691 Bacteria 3668
599 Ga0495670_0018182 3300046691 Bacteria 3460
600 Ga0495670_0026938 3300046691 Bacteria 2845
601 Ga0495670_0043313 3300046691 Bacteria 2246
602 Ga0495670_0119489 3300046691 Bacteria 1368
603 Ga0495671_0000089 3300046692 Bacteria 85775
604 Ga0495671_0000702 3300046692 Bacteria 24254
605 Ga0495671_0003075 3300046692 Bacteria 10366
606 Ga0495671_0008885 3300046692 Bacteria 5643
607 Ga0495671_0018007 3300046692 Bacteria 3756
608 Ga0495671_0035545 3300046692 Bacteria 2529
609 Ga0495671_0040552 3300046692 Bacteria 2348
610 Ga0495671_0109316 3300046692 Bacteria 1350
611 Ga0495649_0000578 3300046694 Bacteria 30715
612 Ga0495649_0010624 3300046694 Bacteria 5424
613 Ga0495649_0011440 3300046694 Bacteria 5202
614 Ga0495649_0020941 3300046694 Bacteria 3665
615 Ga0495649_0024746 3300046694 Bacteria 3347
616 Ga0495649_0026929 3300046694 Bacteria 3192
617 Ga0495649_0034149 3300046694 Bacteria 2799
618 Ga0495649_0043194 3300046694 Bacteria 2461
619 Ga0495649_0048239 3300046694 Bacteria 2314
620 Ga0495649_0065826 3300046694 Bacteria 1945
621 Ga0495649_0144861 3300046694 Bacteria 1249
622 Ga0495589_0000098 3300046794 Bacteria 83860
623 Ga0495589_0000117 3300046794 Bacteria 75549
624 Ga0495589_0001348 3300046794 Bacteria 14393
625 Ga0495589_0001687 3300046794 Bacteria 12620
626 Ga0495589_0003702 3300046794 Bacteria 8245
627 Ga0495589_0008168 3300046794 Bacteria 5471
628 Ga0495589_0011816 3300046794 Bacteria 4532
629 Ga0495589_0029482 3300046794 Bacteria 2766
630 Ga0495589_0039471 3300046794 Bacteria 2358
631 Ga0495600_0006772 3300046809 Bacteria 6988
632 Ga0495600_0028830 3300046809 Bacteria 3592
633 Ga0495660_0000569 3300046810 Bacteria 29833
634 Ga0495660_0000649 3300046810 Bacteria 26996
635 Ga0495660_0000908 3300046810 Bacteria 21846
636 Ga0495660_0001250 3300046810 Bacteria 17713
637 Ga0495660_0003429 3300046810 Bacteria 9813
638 Ga0495660_0005658 3300046810 Bacteria 7473
639 Ga0495660_0008819 3300046810 Bacteria 5888
640 Ga0495660_0009288 3300046810 Bacteria 5741
641 Ga0495660_0012726 3300046810 Bacteria 4881
642 Ga0495660_0032829 3300046810 Bacteria 2914
643 Ga0495660_0051715 3300046810 Bacteria 2234
644 Ga0495660_0086736 3300046810 Bacteria 1633
645 Ga0495581_0031360 3300047315 Bacteria 3081
646 Ga0495581_0136665 3300047315 Bacteria 1429
647 Ga0495604_0021529 3300047317 Bacteria 5146
648 Ga0495604_0111071 3300047317 Bacteria 1999
649 Ga0495636_0000129 3300047318 Bacteria 30647
650 Ga0495636_0001893 3300047318 Bacteria 7993
651 Ga0495636_0047441 3300047318 Bacteria 1793
652 Ga0495674_0001330 3300047319 Bacteria 24082
653 Ga0495672_0000014 3300047320 Bacteria 505636
654 Ga0495672_0000102 3300047320 Bacteria 137373
655 Ga0495672_0000285 3300047320 Bacteria 70145
656 Ga0495672_0000464 3300047320 Bacteria 47929
657 Ga0495672_0000479 3300047320 Bacteria 47387
658 Ga0495672_0000901 3300047320 Bacteria 31123
659 Ga0495672_0003360 3300047320 Bacteria 13776
660 Ga0495672_0004008 3300047320 Bacteria 12320
661 Ga0495672_0045333 3300047320 Bacteria 2631
662 Ga0495676_0000034 3300047321 Bacteria 124977
663 Ga0495676_0013438 3300047321 Bacteria 7356
664 Ga0495676_0020091 3300047321 Bacteria 5869
665 Ga0495676_0022688 3300047321 Bacteria 5456
666 Ga0495676_0116688 3300047321 Bacteria 1948
667 Ga0495683_0000112 3300047323 Bacteria 82903
668 Ga0495683_0000317 3300047323 Bacteria 40466
669 Ga0495683_0001654 3300047323 Bacteria 14237
670 Ga0495683_0004044 3300047323 Bacteria 8414
671 Ga0495683_0008404 3300047323 Bacteria 5525
672 Ga0495683_0010368 3300047323 Bacteria 4926
673 Ga0495683_0012025 3300047323 Bacteria 4550
674 Ga0495683_0031621 3300047323 Bacteria 2697
675 Ga0495683_0034801 3300047323 Bacteria 2561
676 Ga0495687_000054 3300047443 Bacteria 194607
677 Ga0495687_000060 3300047443 Bacteria 179124
678 Ga0495687_000430 3300047443 Bacteria 51814
679 Ga0495687_000633 3300047443 Bacteria 40260
680 Ga0495687_000766 3300047443 Bacteria 34783
681 Ga0495687_000945 3300047443 Bacteria 30002
682 Ga0495687_001270 3300047443 Bacteria 23749
683 Ga0495687_001306 3300047443 Bacteria 23372
684 Ga0495687_003097 3300047443 Bacteria 12447
685 Ga0495687_033817 3300047443 Bacteria 2315
686 Ga0495687_089383 3300047443 Bacteria 1183
687 Ga0495675_0017062 3300047444 Bacteria 4597
688 Ga0495675_0059940 3300047444 Bacteria 2413
689 Ga0495677_0000012 3300047445 Bacteria 146763
690 Ga0495677_0000154 3300047445 Bacteria 32847
691 Ga0495677_0000307 3300047445 Bacteria 21215
692 Ga0495677_0002487 3300047445 Bacteria 7230
693 Ga0495677_0002542 3300047445 Bacteria 7131
694 Ga0495677_0002634 3300047445 Bacteria 7018
695 Ga0495677_0003631 3300047445 Bacteria 5981
696 Ga0495677_0005694 3300047445 Bacteria 4724
697 Ga0495677_0006061 3300047445 Bacteria 4571
698 Ga0495677_0010138 3300047445 Bacteria 3465
699 Ga0495677_0017483 3300047445 Bacteria 2600
700 Ga0495679_001374 3300047446 Bacteria 13971
701 Ga0495685_000028 3300047447 Bacteria 62587
702 Ga0495685_000915 3300047447 Bacteria 8945
703 Ga0495673_0000033 3300047469 Bacteria 354152
704 Ga0495673_0000034 3300047469 Bacteria 326920
705 Ga0495673_0000150 3300047469 Bacteria 122768
706 Ga0495673_0004721 3300047469 Bacteria 8451
707 Ga0495673_0030805 3300047469 Bacteria 2516
708 Ga0495673_0056451 3300047469 Bacteria 1699
709 Ga0495681_0000867 3300047470 Bacteria 23291
710 Ga0495681_0001226 3300047470 Bacteria 19524
711 Ga0495681_0002812 3300047470 Bacteria 12310
712 Ga0495681_0009249 3300047470 Bacteria 6092
713 Ga0495681_0020536 3300047470 Bacteria 3582
714 Ga0495681_0046324 3300047470 Bacteria 2074
715 Ga0495681_0062584 3300047470 Bacteria 1711
716 Ga0495681_0063097 3300047470 Bacteria 1701
717 Ga0495686_0000219 3300047472 Bacteria 105435
718 Ga0495686_0000646 3300047472 Bacteria 48002
719 Ga0495686_0002351 3300047472 Bacteria 18035
720 Ga0495686_0007826 3300047472 Bacteria 7948
721 Ga0495686_0070511 3300047472 Bacteria 2153
722 Ga0495593_0011876 3300047673 Bacteria 4993
723 Ga0495593_0160442 3300047673 Bacteria 1135
724 Ga0495602_0002022 3300048088 Bacteria 20408
725 Ga0495602_0015101 3300048088 Bacteria 7809
726 Ga0495614_0013726 3300048089 Bacteria 3552
727 Ga0495615_0000547 3300048090 Bacteria 5343
728 Ga0495615_0010904 3300048090 Bacteria 1832
729 Ga0495626_0000036 3300048091 Bacteria 180464
730 Ga0495626_0000044 3300048091 Bacteria 165533
731 Ga0495626_0000603 3300048091 Bacteria 35071
732 Ga0495626_0000974 3300048091 Bacteria 24662
733 Ga0495626_0003129 3300048091 Bacteria 10837
734 Ga0495626_0003749 3300048091 Bacteria 9573
735 Ga0495626_0006806 3300048091 Bacteria 6461
736 Ga0495626_0009186 3300048091 Bacteria 5352
737 Ga0495626_0012915 3300048091 Bacteria 4358
738 Ga0495626_0016326 3300048091 Bacteria 3774
739 Ga0495626_0017775 3300048091 Bacteria 3585
740 Ga0495626_0020807 3300048091 Bacteria 3264
741 Ga0495626_0022604 3300048091 Bacteria 3104
742 Ga0495626_0025623 3300048091 Bacteria 2882
743 Ga0495626_0036075 3300048091 Bacteria 2357
744 Ga0495626_0040683 3300048091 Bacteria 2194
745 Ga0495626_0050061 3300048091 Bacteria 1931
746 Ga0495626_0054840 3300048091 Bacteria 1829
747 Ga0495626_0066904 3300048091 Bacteria 1623
748 Ga0496100_0255893 3300048903 Bacteria 1297
749 Ga0496100_0274181 3300048903 Bacteria 1255
750 Ga0496101_0024765 3300048904 Bacteria 4158
751 Ga0496102_0000279 3300048905 Bacteria 65185
752 Ga0496102_0000977 3300048905 Bacteria 26896
753 Ga0496102_0017782 3300048905 Bacteria 6233
754 Ga0496102_0021095 3300048905 Bacteria 5761
755 Ga0496102_0207869 3300048905 Bacteria 1845
756 Ga0496103_0003312 3300048906 Bacteria 9853
757 Ga0496103_0040436 3300048906 Bacteria 2865
758 Ga0496103_0046076 3300048906 Bacteria 2691
759 Ga0496103_0054393 3300048906 Bacteria 2481
760 Ga0496105_0021861 3300048908 Bacteria 5178
761 Ga0496107_0141834 3300048910 Bacteria 1776
762 Ga0496108_0299468 3300048911 Bacteria 1401
763 Ga0496109_0180824 3300048912 Bacteria 1981
764 Ga0496110_0006124 3300048913 Bacteria 9485
765 Ga0496110_0134189 3300048913 Bacteria 2237
766 Ga0496111_0104541 3300048914 Bacteria 2083
767 Ga0496111_0188537 3300048914 Bacteria 1533
768 Ga0496113_0004255 3300048916 Bacteria 8769
769 Ga0496115_0006759 3300048918 Bacteria 8412
770 Ga0496115_0016150 3300048918 Bacteria 5678
771 Ga0496115_0029956 3300048918 Bacteria 4279
772 Ga0496116_0016386 3300048919 Bacteria 5800
773 Ga0496117_0000010 3300048920 Bacteria 611954
774 Ga0496118_0000009 3300048921 Bacteria 611954
775 Ga0496120_0056714 3300048923 Bacteria 2209
776 Ga0496121_0004497 3300048924 Bacteria 18689
777 Ga0496121_0061832 3300048924 Bacteria 3070
778 Ga0496121_0273976 3300048924 Bacteria 1158
779 Ga0496122_0000337 3300048925 Bacteria 101830
780 Ga0496122_0001806 3300048925 Bacteria 32791
781 Ga0496122_0004995 3300048925 Bacteria 16054
782 Ga0496122_0015811 3300048925 Bacteria 7189
783 Ga0496123_0001105 3300048926 Bacteria 40467
784 Ga0496123_0003318 3300048926 Bacteria 18231
785 Ga0496123_0004595 3300048926 Bacteria 14373
786 Ga0496123_0005635 3300048926 Bacteria 12504
787 Ga0496123_0038155 3300048926 Bacteria 3381
788 Ga0496124_0005420 3300048927 Bacteria 14367
789 Ga0496124_0014088 3300048927 Bacteria 7754
790 Ga0496124_0024144 3300048927 Bacteria 5534
791 Ga0496124_0030954 3300048927 Bacteria 4740
792 Ga0496124_0038149 3300048927 Bacteria 4173
793 Ga0496124_0183956 3300048927 Bacteria 1605
794 Ga0496124_0231032 3300048927 Bacteria 1383
795 Ga0496125_0000917 3300048928 Bacteria 46397
796 Ga0496125_0261372 3300048928 Bacteria 1084
797 Ga0495678_000076 3300049459 Bacteria 125077
798 Ga0495678_000174 3300049459 Bacteria 74631
799 Ga0495678_000175 3300049459 Bacteria 73523
800 Ga0495678_000241 3300049459 Bacteria 61623
801 Ga0495678_000466 3300049459 Bacteria 40200
802 Ga0495678_007124 3300049459 Bacteria 5842
803 Ga0495678_011524 3300049459 Bacteria 4227
804 Ga0495678_020067 3300049459 Bacteria 2967
805 Ga0495682_0000442 3300049460 Bacteria 28901
806 Ga0495682_0000482 3300049460 Bacteria 27507
807 Ga0495682_0000988 3300049460 Bacteria 16944
808 Ga0495682_0009959 3300049460 Bacteria 3697
809 Ga0495682_0012549 3300049460 Bacteria 3245
810 Ga0495682_0028841 3300049460 Bacteria 2055
811 Ga0501227_003856 3300049665 Bacteria 3239
812 Ga0501249_018351 3300049679 Bacteria 1513
813 Ga0501263_006622 3300049760 Bacteria 1342
814 Ga0501269_001308 3300049766 Bacteria 3319
815 Ga0501279_003999 3300049775 Bacteria 1930
816 Ga0501279_005421 3300049775 Bacteria 1675
817 Ga0501035_0000816 3300049822 Bacteria 33256
818 Ga0501044_0090600 3300049823 Bacteria 3085
819 Ga0500594_0001005 3300053118 Bacteria 6050
820 Ga0500618_000263 3300053125 Bacteria 40698
821 Ga0500618_006003 3300053125 Bacteria 3614
822 Ga0500586_000039 3300053145 Bacteria 23037
823 Ga0466962_0043478 3300061719 Bacteria 2149
824 2857555084 2857553236 Bacteria 6166726
825 2601666764 2600255292 Bacteria 6300551
826 2643789221 2643221554 Bacteria 6603920
827 2643799775 2643221556 Bacteria 7251154
828 2643800404 2643221556 Bacteria 7251154
829 2644215159 2643221638 Bacteria 6579467
830 2644249179 2643221645 Bacteria 7207331
831 2644355893 2643221664 Bacteria 7272945
832 2644470313 2643221684 Bacteria 7145183
833 2644474775 2643221684 Bacteria 7145183
834 2738740607 2738541280 Bacteria 6630198
835 2738825967 2738541297 Bacteria 6549566
836 2738844929 2738541300 Bacteria 6675882
837 2739149764 2738541357 Bacteria 6549408
838 2739191683 2738543003 Bacteria 6549560
839 2739277344 2738543018 Bacteria 6718814
840 2739318160 2738543026 Bacteria 6549408
841 2739336401 2738543029 Bacteria 6549249
842 2739346387 2738543030 Bacteria 6719714
843 2809143922 2808606418 Bacteria 6724496
844 2821135609 2821131069 Bacteria 6108407
845 2842714036 2842711865 Bacteria 7155354
846 2857548530 2857547612 Bacteria 6179999
847 2857562503 2857558681 Bacteria 6617694
848 2857566367 2857564685 Bacteria 6290584
849 2904430725 2904424332 Bacteria 7633521
850 2919481292 2919476304 Bacteria 5888696
851 2932413124 2932410948 Bacteria 6312192
852 2932420639 2932416698 Bacteria 6315112
853 8047678707 8047673197 Bacteria 7395230
854 JGI25154J39366_1001205
855 JGI25158J39367_1001581
856 JGI25152J39213_1000984
857 JGI25150J39212_1001562
858 JGI25150J39212_1002141
859 JGI25159J45721_1002467
860 JGI25159J45721_1003828
861 JGI25153J46596_10006574
862 rootH2_10009316
863 rootL2_10036042
864 rootL2_10036043
865 rootL2_10083718
866 rootL2_10223152
867 rootH1_10105201
868 JGI25161J50226_1000613
869 JGI25161J50226_1001395
870 Ga0055525_1000240
871 Ga0055529_1000565
872 Ga0055526_1000095
873 Ga0055526_1000190
874 Ga0055526_1001759
875 Ga0055526_1003690
876 Ga0055526_1007818
877 Ga0055537_1000174
878 Ga0055537_1005171
879 Ga0055524_1000026
880 Ga0055524_1000981
881 Ga0055524_1002417
882 Ga0055524_1002688
883 Ga0055524_1010357
884 Ga0055534_1000173
885 Ga0055534_1016629
886 Ga0055528_1000221
887 Ga0055530_10001768
888 Ga0055530_10011808
889 Ga0055531_10001784
890 Ga0055543_1001112
891 Ga0055543_1001358
892 Ga0065165_1000067
893 Ga0065165_1000557
894 Ga0065165_1002329
895 Ga0065165_1024128
896 Ga0070676_10190969
897 Ga0070680_100127346
898 Ga0070660_100140760
899 Ga0070664_100035506
900 Ga0075363_100194264
901 Ga0079104_1013115
902 Ga0099826_10000057
903 Ga0105244_10000660
904 Ga0105244_10004640
905 Ga0105240_10325661
906 Ga0105241_10023792
907 Ga0105242_10002231
908 Ga0157371_10000064
909 Ga0157374_10312477
910 Ga0182008_10001391
911 Ga0182008_10070880
912 Ga0182006_1000070
913 Ga0182006_1052061
914 Ga0182007_10000021
915 Ga0182007_10012860
916 Ga0182005_1000003
917 Ga0182005_1000009
918 Ga0163161_10014883
919 Ga0163161_10075549
920 Ga0213872_10000252
921 Ga0213872_10002540
922 Ga0213872_10012630
923 Ga0209436_100436
924 Ga0209436_100847
925 Ga0209563_100162
926 Ga0207425_1000006
927 Ga0207425_1000205
928 Ga0207425_1000557
929 Ga0209646_1000114
930 Ga0209677_100780
931 Ga0209148_1001089
932 Ga0209129_1000009
933 Ga0209565_1000006
934 Ga0209565_1000163
935 Ga0209565_1000663
936 Ga0209565_1007053
937 Ga0209455_1000063
938 Ga0209673_1000004
939 Ga0209673_1010854
940 Ga0209130_1000476
941 Ga0209130_1001030
942 Ga0209130_1001382
943 Ga0209675_1000123
944 Ga0209675_1000635
945 Ga0209675_1004820
946 Ga0209025_1005086
947 Ga0209564_1000006
948 Ga0209564_1000026
949 Ga0209564_1000098
950 Ga0209564_1000420
951 Ga0209564_1002333
952 Ga0209564_1033304
953 Ga0209758_1000071
954 Ga0209758_1000270
955 Ga0209050_1000183
956 Ga0209050_1000753
957 Ga0209050_1001864
958 Ga0209256_1000013
959 Ga0209256_1000219
960 Ga0209256_1000499
961 Ga0209256_1001083
962 Ga0209256_1001601
963 Ga0207426_1001358
964 Ga0209257_1000010
965 Ga0209257_1006224
966 Ga0207655_1004677
967 Ga0207705_10046551
968 Ga0207654_10010255
969 Ga0207660_10120839
970 Ga0207657_10032341
971 Ga0207657_10085364
972 Ga0207706_10125572
973 Ga0207686_10028225
974 Ga0207709_10011579
975 Ga0207667_10027260
976 Ga0207678_10242607
977 Ga0207698_10055145
978 Ga0209281_1003864
979 Ga0209282_1000087
980 Ga0316177_1172766
981 Ga0316180_1005039
982 Ga0316183_1124839
983 Ga0316182_1367475
984 Ga0307408_100000879
985 Ga0307408_100002313
986 Ga0307408_100008109
987 Ga0307408_100013562
988 Ga0307408_100024495
989 Ga0265314_10012082
990 Ga0307412_10256848
991 Ga0307416_100004160
992 Ga0395899_0000192
993 Ga0395899_0001780
994 Ga0395899_0019231
995 Ga0395899_0019480
996 Ga0395899_0030594
997 Ga0395899_0037293
998 Ga0395899_0125640
999 Ga0395899_0126059
1000 Ga0395899_0233953
1001 Ga0395900_0001232
1002 Ga0395900_0009769
1003 Ga0395900_0036042
1004 Ga0395900_0039664
1005 Ga0395900_0065515
1006 Ga0395900_0099302
1007 Ga0395900_0102779
1008 Ga0395900_0255651
1009 Ga0395900_0271717
1010 Ga0395898_0005609
1011 Ga0395898_0305099
1012 Ga0395898_0359859
1013 Ga0395898_0418388
1014 Ga0395905_0043487
1015 Ga0395905_0072804
1016 Ga0395905_0162969
1017 Ga0395905_0185667
1018 Ga0395901_0000765
1019 Ga0395901_0004814
1020 Ga0395901_0013622
1021 Ga0395901_0120469
1022 Ga0395901_0217468
1023 Ga0395901_0318901
1024 Ga0436361_0084965
1025 Ga0436361_0112693
1026 Ga0436361_0176065
1027 Ga0436361_0746884
1028 Ga0439448_0036561
1029 Ga0439449_0026548
1030 Ga0439455_0006165
1031 Ga0450904_000146
1032 Ga0466969_0109217
1033 Ga0466969_0113067
1034 Ga0466965_0006320
1035 Ga0466965_0018362
1036 Ga0466965_0022953
1037 Ga0466965_0045468
1038 Ga0466965_0150166
1039 Ga0466966_0016810
1040 Ga0466966_0031676
1041 Ga0466966_0124790
1042 Ga0466966_0219799
1043 Ga0466966_0238982
1044 Ga0466961_0082936
1045 Ga0466963_0071950
1046 Ga0466964_0000119
1047 Ga0466971_0029523
1048 Ga0466971_0162234
1049 Ga0466968_0000336
1050 Ga0466970_0045537
1051 Ga0466970_0113561
1052 Ga0466957_0001264
1053 Ga0466957_0011201
1054 Ga0466960_0050437
1055 Ga0466959_0037614
1056 Ga0466959_0058058
1057 Ga0466959_0122504
1058 Ga0466958_0060471
1059 Ga0466958_0107706
1060 Ga0466967_0000568
1061 Ga0495617_000043
1062 Ga0495617_000048
1063 Ga0495617_001501
1064 Ga0495627_000046
1065 Ga0495627_000247
1066 Ga0495627_003783
1067 Ga0495627_014437
1068 Ga0495627_040308
1069 Ga0495603_0048555
1070 Ga0495603_0091179
1071 Ga0495603_0154625
1072 Ga0495590_0000030
1073 Ga0495590_0000049
1074 Ga0495590_0000194
1075 Ga0495590_0033269
1076 Ga0495591_000996
1077 Ga0495638_0000105
1078 Ga0495638_0003678
1079 Ga0495638_0008923
1080 Ga0495638_0016192
1081 Ga0495638_0112362
1082 Ga0495653_0000094
1083 Ga0495653_0007689
1084 Ga0495653_0039277
1085 Ga0495653_0117040
1086 Ga0495650_0000099
1087 Ga0495650_0000173
1088 Ga0495650_0000212
1089 Ga0495650_0000227
1090 Ga0495650_0000712
1091 Ga0495650_0000965
1092 Ga0495650_0002850
1093 Ga0495650_0005244
1094 Ga0495650_0025053
1095 Ga0495580_0066954
1096 Ga0495582_0001659
1097 Ga0495582_0025907
1098 Ga0495582_0113031
1099 Ga0495605_0000005
1100 Ga0495605_0000166
1101 Ga0495605_0002561
1102 Ga0495605_0003634
1103 Ga0495605_0006592
1104 Ga0495605_0014957
1105 Ga0495605_0030194
1106 Ga0495605_0042535
1107 Ga0495605_0083690
1108 Ga0495605_0124487
1109 Ga0495639_0004731
1110 Ga0495584_0000334
1111 Ga0495584_0000381
1112 Ga0495584_0000416
1113 Ga0495584_0000755
1114 Ga0495584_0001114
1115 Ga0495584_0002572
1116 Ga0495584_0002915
1117 Ga0495584_0003787
1118 Ga0495584_0006061
1119 Ga0495584_0021069
1120 Ga0495584_0030820
1121 Ga0495584_0033434
1122 Ga0495584_0041021
1123 Ga0495584_0047164
1124 Ga0495584_0057780
1125 Ga0495584_0119209
1126 Ga0495585_0000186
1127 Ga0495585_0000635
1128 Ga0495585_0000889
1129 Ga0495585_0001049
1130 Ga0495585_0002016
1131 Ga0495585_0002268
1132 Ga0495585_0005229
1133 Ga0495585_0005760
1134 Ga0495585_0005859
1135 Ga0495585_0009633
1136 Ga0495585_0017392
1137 Ga0495585_0017981
1138 Ga0495585_0020740
1139 Ga0495585_0024467
1140 Ga0495585_0030688
1141 Ga0495585_0034000
1142 Ga0495585_0048099
1143 Ga0495594_0000268
1144 Ga0495594_0047838
1145 Ga0495596_0000282
1146 Ga0495596_0000645
1147 Ga0495596_0001341
1148 Ga0495596_0002323
1149 Ga0495596_0005703
1150 Ga0495596_0011811
1151 Ga0495596_0020834
1152 Ga0495596_0036907
1153 Ga0495596_0084604
1154 Ga0495607_0000096
1155 Ga0495607_0000569
1156 Ga0495607_0000724
1157 Ga0495607_0000761
1158 Ga0495607_0001243
1159 Ga0495607_0002135
1160 Ga0495607_0002170
1161 Ga0495607_0005681
1162 Ga0495607_0007121
1163 Ga0495607_0011667
1164 Ga0495607_0019573
1165 Ga0495607_0044535
1166 Ga0495607_0045656
1167 Ga0495607_0173349
1168 Ga0495583_0000004
1169 Ga0495583_0000202
1170 Ga0495583_0000264
1171 Ga0495583_0000441
1172 Ga0495583_0000814
1173 Ga0495583_0001286
1174 Ga0495583_0001598
1175 Ga0495583_0003093
1176 Ga0495583_0008985
1177 Ga0495583_0013482
1178 Ga0495583_0017405
1179 Ga0495583_0080303
1180 Ga0495583_0104505
1181 Ga0495583_0122548
1182 Ga0495606_0000297
1183 Ga0495606_0000316
1184 Ga0495606_0000392
1185 Ga0495606_0000407
1186 Ga0495606_0001023
1187 Ga0495606_0001620
1188 Ga0495606_0001999
1189 Ga0495606_0004430
1190 Ga0495606_0009159
1191 Ga0495606_0010941
1192 Ga0495606_0013894
1193 Ga0495606_0029868
1194 Ga0495606_0036330
1195 Ga0495606_0038798
1196 Ga0495606_0079968
1197 Ga0495606_0089712
1198 Ga0495606_0106260
1199 Ga0495606_0161244
1200 Ga0495610_0000021
1201 Ga0495610_0004163
1202 Ga0495610_0005524
1203 Ga0495610_0007549
1204 Ga0495610_0010164
1205 Ga0495610_0017653
1206 Ga0495610_0045123
1207 Ga0495616_0000093
1208 Ga0495616_0003148
1209 Ga0495616_0004567
1210 Ga0495616_0009647
1211 Ga0495616_0011377
1212 Ga0495616_0014699
1213 Ga0495616_0018466
1214 Ga0495616_0022716
1215 Ga0495616_0023637
1216 Ga0495616_0024016
1217 Ga0495616_0027019
1218 Ga0495616_0038171
1219 Ga0495616_0046693
1220 Ga0495616_0053298
1221 Ga0495616_0056296
1222 Ga0495616_0056860
1223 Ga0495616_0085255
1224 Ga0495616_0128197
1225 Ga0495616_0135948
1226 Ga0495630_0004025
1227 Ga0495631_0001048
1228 Ga0495631_0002340
1229 Ga0495631_0004353
1230 Ga0495631_0006705
1231 Ga0495631_0013362
1232 Ga0495631_0024947
1233 Ga0495631_0025730
1234 Ga0495631_0026325
1235 Ga0495631_0038354
1236 Ga0495631_0045901
1237 Ga0495631_0060192
1238 Ga0495631_0068364
1239 Ga0495632_0000767
1240 Ga0495632_0001357
1241 Ga0495632_0001660
1242 Ga0495632_0001724
1243 Ga0495632_0002930
1244 Ga0495632_0006046
1245 Ga0495632_0012234
1246 Ga0495632_0017893
1247 Ga0495637_0000014
1248 Ga0495637_0000305
1249 Ga0495637_0000773
1250 Ga0495637_0015806
1251 Ga0495637_0060063
1252 Ga0495643_0000181
1253 Ga0495643_0000671
1254 Ga0495643_0000937
1255 Ga0495643_0001243
1256 Ga0495643_0001245
1257 Ga0495643_0006755
1258 Ga0495643_0017650
1259 Ga0495643_0027199
1260 Ga0495643_0042960
1261 Ga0495643_0057050
1262 Ga0495643_0057185
1263 Ga0495643_0058551
1264 Ga0495644_0000382
1265 Ga0495644_0001305
1266 Ga0495644_0003383
1267 Ga0495644_0011664
1268 Ga0495644_0012340
1269 Ga0495644_0015007
1270 Ga0495644_0032250
1271 Ga0495644_0045042
1272 Ga0495644_0055847
1273 Ga0495648_0000008
1274 Ga0495648_0000630
1275 Ga0495648_0000641
1276 Ga0495648_0002408
1277 Ga0495648_0002619
1278 Ga0495648_0005235
1279 Ga0495648_0013719
1280 Ga0495648_0014230
1281 Ga0495648_0035338
1282 Ga0495648_0038625
1283 Ga0495648_0040831
1284 Ga0495648_0071931
1285 Ga0495663_0008141
1286 Ga0495663_0008736
1287 Ga0495663_0061583
1288 Ga0495666_0014021
1289 Ga0495666_0029609
1290 Ga0495666_0111156
1291 Ga0495642_0000152
1292 Ga0495642_0000998
1293 Ga0495642_0001319
1294 Ga0495642_0001367
1295 Ga0495642_0002062
1296 Ga0495642_0002875
1297 Ga0495642_0013297
1298 Ga0495642_0014547
1299 Ga0495642_0015359
1300 Ga0495642_0018894
1301 Ga0495642_0061264
1302 Ga0495642_0073912
1303 Ga0495652_0049824
1304 Ga0495654_0000005
1305 Ga0495654_0005741
1306 Ga0495654_0006696
1307 Ga0495654_0009500
1308 Ga0495654_0012640
1309 Ga0495654_0019573
1310 Ga0495654_0020870
1311 Ga0495665_0003040
1312 Ga0495665_0015057
1313 Ga0495665_0019062
1314 Ga0495586_0060012
1315 Ga0495587_0019888
1316 Ga0495587_0066826
1317 Ga0495587_0073973
1318 Ga0495609_0000028
1319 Ga0495609_0001456
1320 Ga0495609_0002966
1321 Ga0495609_0003418
1322 Ga0495609_0003945
1323 Ga0495609_0006149
1324 Ga0495609_0007225
1325 Ga0495609_0009016
1326 Ga0495609_0009954
1327 Ga0495609_0011099
1328 Ga0495609_0017421
1329 Ga0495609_0019760
1330 Ga0495609_0029253
1331 Ga0495609_0059667
1332 Ga0495609_0063479
1333 Ga0495597_0000310
1334 Ga0495597_0000532
1335 Ga0495597_0000608
1336 Ga0495597_0001660
1337 Ga0495597_0001872
1338 Ga0495597_0004456
1339 Ga0495597_0004598
1340 Ga0495597_0012166
1341 Ga0495597_0046718
1342 Ga0495597_0072421
1343 Ga0495597_0073061
1344 Ga0495597_0076320
1345 Ga0495622_0000129
1346 Ga0495622_0000188
1347 Ga0495622_0017063
1348 Ga0495622_0019269
1349 Ga0495633_0000357
1350 Ga0495633_0000482
1351 Ga0495633_0000719
1352 Ga0495633_0002368
1353 Ga0495633_0005377
1354 Ga0495633_0008321
1355 Ga0495633_0008327
1356 Ga0495633_0010545
1357 Ga0495633_0012347
1358 Ga0495633_0015004
1359 Ga0495633_0015894
1360 Ga0495633_0018091
1361 Ga0495633_0056839
1362 Ga0495656_0002701
1363 Ga0495656_0002787
1364 Ga0495656_0006401
1365 Ga0495656_0009302
1366 Ga0495668_0000008
1367 Ga0495668_0000300
1368 Ga0495668_0001032
1369 Ga0495668_0001841
1370 Ga0495668_0001915
1371 Ga0495668_0002416
1372 Ga0495668_0007280
1373 Ga0495668_0008374
1374 Ga0495668_0008543
1375 Ga0495668_0016395
1376 Ga0495668_0030829
1377 Ga0495668_0031634
1378 Ga0495668_0032192
1379 Ga0495668_0043980
1380 Ga0495668_0080089
1381 Ga0495668_0087471
1382 Ga0495668_0164690
1383 Ga0495634_0047634
1384 Ga0495611_0000131
1385 Ga0495611_0002991
1386 Ga0495611_0004829
1387 Ga0495611_0016345
1388 Ga0495611_0019185
1389 Ga0495611_0022023
1390 Ga0495611_0025969
1391 Ga0495611_0031180
1392 Ga0495611_0056795
1393 Ga0495611_0072163
1394 Ga0495611_0095291
1395 Ga0495625_0000278
1396 Ga0495625_0002185
1397 Ga0495625_0003794
1398 Ga0495625_0004032
1399 Ga0495625_0006985
1400 Ga0495625_0007318
1401 Ga0495625_0009103
1402 Ga0495625_0015461
1403 Ga0495625_0035796
1404 Ga0495625_0044244
1405 Ga0495625_0072408
1406 Ga0495625_0072994
1407 Ga0495625_0075835
1408 Ga0495625_0142380
1409 Ga0495659_0000007
1410 Ga0495659_0000931
1411 Ga0495659_0005383
1412 Ga0495659_0025108
1413 Ga0495659_0041694
1414 Ga0495661_0000157
1415 Ga0495661_0000711
1416 Ga0495661_0002008
1417 Ga0495661_0002128
1418 Ga0495661_0002647
1419 Ga0495661_0011292
1420 Ga0495661_0011488
1421 Ga0495661_0018406
1422 Ga0495661_0034570
1423 Ga0495661_0042309
1424 Ga0495661_0045861
1425 Ga0495661_0053986
1426 Ga0495661_0066040
1427 Ga0495661_0103249
1428 Ga0495661_0166376
1429 Ga0495588_0000113
1430 Ga0495588_0029096
1431 Ga0495588_0033499
1432 Ga0495588_0034285
1433 Ga0495588_0071717
1434 Ga0495588_0145693
1435 Ga0495588_0156240
1436 Ga0495623_0011075
1437 Ga0495623_0034053
1438 Ga0495623_0034082
1439 Ga0495646_0103761
1440 Ga0495669_0000075
1441 Ga0495669_0003735
1442 Ga0495669_0009941
1443 Ga0495669_0027108
1444 Ga0495669_0061261
1445 Ga0495669_0109691
1446 Ga0495613_0004700
1447 Ga0495624_0004226
1448 Ga0495670_0002596
1449 Ga0495670_0007804
1450 Ga0495670_0011876
1451 Ga0495670_0016174
1452 Ga0495670_0018182
1453 Ga0495670_0026938
1454 Ga0495670_0043313
1455 Ga0495670_0119489
1456 Ga0495671_0000089
1457 Ga0495671_0000702
1458 Ga0495671_0003075
1459 Ga0495671_0008885
1460 Ga0495671_0018007
1461 Ga0495671_0035545
1462 Ga0495671_0040552
1463 Ga0495671_0109316
1464 Ga0495649_0000578
1465 Ga0495649_0010624
1466 Ga0495649_0011440
1467 Ga0495649_0020941
1468 Ga0495649_0024746
1469 Ga0495649_0026929
1470 Ga0495649_0034149
1471 Ga0495649_0043194
1472 Ga0495649_0048239
1473 Ga0495649_0065826
1474 Ga0495649_0144861
1475 Ga0495589_0000098
1476 Ga0495589_0000117
1477 Ga0495589_0001348
1478 Ga0495589_0001687
1479 Ga0495589_0003702
1480 Ga0495589_0008168
1481 Ga0495589_0011816
1482 Ga0495589_0029482
1483 Ga0495589_0039471
1484 Ga0495600_0006772
1485 Ga0495600_0028830
1486 Ga0495660_0000569
1487 Ga0495660_0000649
1488 Ga0495660_0000908
1489 Ga0495660_0001250
1490 Ga0495660_0003429
1491 Ga0495660_0005658
1492 Ga0495660_0008819
1493 Ga0495660_0009288
1494 Ga0495660_0012726
1495 Ga0495660_0032829
1496 Ga0495660_0051715
1497 Ga0495660_0086736
1498 Ga0495581_0031360
1499 Ga0495581_0136665
1500 Ga0495604_0021529
1501 Ga0495604_0111071
1502 Ga0495636_0000129
1503 Ga0495636_0001893
1504 Ga0495636_0047441
1505 Ga0495674_0001330
1506 Ga0495672_0000014
1507 Ga0495672_0000102
1508 Ga0495672_0000285
1509 Ga0495672_0000464
1510 Ga0495672_0000479
1511 Ga0495672_0000901
1512 Ga0495672_0003360
1513 Ga0495672_0004008
1514 Ga0495672_0045333
1515 Ga0495676_0000034
1516 Ga0495676_0013438
1517 Ga0495676_0020091
1518 Ga0495676_0022688
1519 Ga0495676_0116688
1520 Ga0495683_0000112
1521 Ga0495683_0000317
1522 Ga0495683_0001654
1523 Ga0495683_0004044
1524 Ga0495683_0008404
1525 Ga0495683_0010368
1526 Ga0495683_0012025
1527 Ga0495683_0031621
1528 Ga0495683_0034801
1529 Ga0495687_000054
1530 Ga0495687_000060
1531 Ga0495687_000430
1532 Ga0495687_000633
1533 Ga0495687_000766
1534 Ga0495687_000945
1535 Ga0495687_001270
1536 Ga0495687_001306
1537 Ga0495687_003097
1538 Ga0495687_033817
1539 Ga0495687_089383
1540 Ga0495675_0017062
1541 Ga0495675_0059940
1542 Ga0495677_0000012
1543 Ga0495677_0000154
1544 Ga0495677_0000307
1545 Ga0495677_0002487
1546 Ga0495677_0002542
1547 Ga0495677_0002634
1548 Ga0495677_0003631
1549 Ga0495677_0005694
1550 Ga0495677_0006061
1551 Ga0495677_0010138
1552 Ga0495677_0017483
1553 Ga0495679_001374
1554 Ga0495685_000028
1555 Ga0495685_000915
1556 Ga0495673_0000033
1557 Ga0495673_0000034
1558 Ga0495673_0000150
1559 Ga0495673_0004721
1560 Ga0495673_0030805
1561 Ga0495673_0056451
1562 Ga0495681_0000867
1563 Ga0495681_0001226
1564 Ga0495681_0002812
1565 Ga0495681_0009249
1566 Ga0495681_0020536
1567 Ga0495681_0046324
1568 Ga0495681_0062584
1569 Ga0495681_0063097
1570 Ga0495686_0000219
1571 Ga0495686_0000646
1572 Ga0495686_0002351
1573 Ga0495686_0007826
1574 Ga0495686_0070511
1575 Ga0495593_0011876
1576 Ga0495593_0160442
1577 Ga0495602_0002022
1578 Ga0495602_0015101
1579 Ga0495614_0013726
1580 Ga0495615_0000547
1581 Ga0495615_0010904
1582 Ga0495626_0000036
1583 Ga0495626_0000044
1584 Ga0495626_0000603
1585 Ga0495626_0000974
1586 Ga0495626_0003129
1587 Ga0495626_0003749
1588 Ga0495626_0006806
1589 Ga0495626_0009186
1590 Ga0495626_0012915
1591 Ga0495626_0016326
1592 Ga0495626_0017775
1593 Ga0495626_0020807
1594 Ga0495626_0022604
1595 Ga0495626_0025623
1596 Ga0495626_0036075
1597 Ga0495626_0040683
1598 Ga0495626_0050061
1599 Ga0495626_0054840
1600 Ga0495626_0066904
1601 Ga0496100_0255893
1602 Ga0496100_0274181
1603 Ga0496101_0024765
1604 Ga0496102_0000279
1605 Ga0496102_0000977
1606 Ga0496102_0017782
1607 Ga0496102_0021095
1608 Ga0496102_0207869
1609 Ga0496103_0003312
1610 Ga0496103_0040436
1611 Ga0496103_0046076
1612 Ga0496103_0054393
1613 Ga0496105_0021861
1614 Ga0496107_0141834
1615 Ga0496108_0299468
1616 Ga0496109_0180824
1617 Ga0496110_0006124
1618 Ga0496110_0134189
1619 Ga0496111_0104541
1620 Ga0496111_0188537
1621 Ga0496113_0004255
1622 Ga0496115_0006759
1623 Ga0496115_0016150
1624 Ga0496115_0029956
1625 Ga0496116_0016386
1626 Ga0496117_0000010
1627 Ga0496118_0000009
1628 Ga0496120_0056714
1629 Ga0496121_0004497
1630 Ga0496121_0061832
1631 Ga0496121_0273976
1632 Ga0496122_0000337
1633 Ga0496122_0001806
1634 Ga0496122_0004995
1635 Ga0496122_0015811
1636 Ga0496123_0001105
1637 Ga0496123_0003318
1638 Ga0496123_0004595
1639 Ga0496123_0005635
1640 Ga0496123_0038155
1641 Ga0496124_0005420
1642 Ga0496124_0014088
1643 Ga0496124_0024144
1644 Ga0496124_0030954
1645 Ga0496124_0038149
1646 Ga0496124_0183956
1647 Ga0496124_0231032
1648 Ga0496125_0000917
1649 Ga0496125_0261372
1650 Ga0495678_000076
1651 Ga0495678_000174
1652 Ga0495678_000175
1653 Ga0495678_000241
1654 Ga0495678_000466
1655 Ga0495678_007124
1656 Ga0495678_011524
1657 Ga0495678_020067
1658 Ga0495682_0000442
1659 Ga0495682_0000482
1660 Ga0495682_0000988
1661 Ga0495682_0009959
1662 Ga0495682_0012549
1663 Ga0495682_0028841
1664 Ga0501227_003856
1665 Ga0501249_018351
1666 Ga0501263_006622
1667 Ga0501269_001308
1668 Ga0501279_003999
1669 Ga0501279_005421
1670 Ga0501035_0000816
1671 Ga0501044_0090600
1672 Ga0500594_0001005
1673 Ga0500618_000263
1674 Ga0500618_006003
1675 Ga0500586_000039
1676 Ga0466962_0043478
1677 2857555084
1678 2601666764
1679 2643789221
1680 2643799775
1681 2643800404
1682 2644215159
1683 2644249179
1684 2644355893
1685 2644470313
1686 2644474775
1687 2738740607
1688 2738825967
1689 2738844929
1690 2739149764
1691 2739191683
1692 2739277344
1693 2739318160
1694 2739336401
1695 2739346387
1696 2809143922
1697 2821135609
1698 2842714036
1699 2857548530
1700 2857562503
1701 2857566367
1702 2904430725
1703 2919481292
1704 2932413124
1705 2932420639
1706 8047678707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04952

AstE_AspA

Succinylglutamate desuccinylase / Aspartoacylase family

284

359

0.97

PF24827

80

274

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yw6-assembly1.cif.gz_B crystal structure of succinylglutamate desuccinylase from escherichia coli, northeast structural genomics target et72. 0.921 37 335
2g9d-assembly1.cif.gz_A crystal structure of succinylglutamate desuccinylase from vibrio cholerae, northeast structural genomics target vcr20 0.8995 38 333
2bco-assembly1.cif.gz_A x-ray structure of succinylglutamate desuccinalase from vibrio parahaemolyticus (rimd 2210633) at the resolution 2.3 a, northeast structural genomics target vpr14 0.8993 45 335
1yw6-assembly1.cif.gz_A crystal structure of succinylglutamate desuccinylase from escherichia coli, northeast structural genomics target et72. 0.8734 29 335
1yw6-assembly1.cif.gz_B crystal structure of succinylglutamate desuccinylase from escherichia coli, northeast structural genomics target et72. 0.8541 37 335
ID Description Score Start End Superfamily
af_P76215_1_322_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.908 29 335 3.40.630.10
af_P76215_1_322_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8647 29 335 3.40.630.10
1yw4B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8372 2 335 3.40.630.10
2g9dA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8286 38 275 3.40.630.10
1yw4B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8011 2 335 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A0D8L666-F1-model_v4 deleted 0.9797 267 335
AF-A0A1S2N9U4-F1-model_v4 Succinylglutamate desuccinylase (EC 3.5.1.96) 0.9789 14 335 GO:0008270
GO:0009017
GO:0016788
GO:0019544
GO:0019545
AF-A0A4Q3K1J3-F1-model_v4 deleted 0.9751 90 335
AF-A0A381H3R7-F1-model_v4 deleted 0.9713 223 335
AF-A0A7H4MI56-F1-model_v4 Succinylglutamate desuccinylase (EC 3.5.1.96) 0.9708 259 335 GO:0009017
GO:0016788
GO:0046872

Map