F483572

General Info

Members Datasets Scaffolds Average Seq Length
854 251 1708 135

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100036186|Ga0070714_1000361862
Length 147
Sequence MARVPSRHAWGFAFSEISRHRDAGRARVLADSNCVLIDELEREWRDALCRKDMERLQALVHRDFLLIGTRSTGPFMMNRQVEVRDATVFDNMMIGTVQARWRLKYLGRSIEDCVFLTDVWVKDEGRWQAIRRHSTPAPAGACDLKGE

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
184 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
201 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 3.16
Rhizosphere 96.6
Stem 0
Stem Tuber 0
Unclassified 8.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100036186 3300005435 Bacteria 4139
2 JGI24752J21851_1033251 3300001976 Bacteria 683
3 JGI24747J21853_1003908 3300001978 Bacteria 1309
4 JGI24740J21852_10021801 3300001979 Bacteria 2215
5 JGI24740J21852_10053770 3300001979 Bacteria 1140
6 JGI24740J21852_10067802 3300001979 Unclassified 964
7 JGI24740J21852_10104779 3300001979 Unclassified 717
8 JGI24739J22299_10012780 3300001989 Bacteria 3077
9 JGI24739J22299_10088317 3300001989 Bacteria 946
10 JGI24737J22298_10014199 3300001990 Bacteria 2587
11 JGI24737J22298_10016841 3300001990 Bacteria 2359
12 JGI24743J22301_10003394 3300001991 Bacteria 2517
13 JGI24735J21928_10002140 3300002067 Bacteria 6953
14 JGI24735J21928_10014828 3300002067 Bacteria 2439
15 JGI24745J21846_1009482 3300002073 Bacteria 1104
16 JGI24738J21930_10007344 3300002075 Bacteria 2547
17 JGI24738J21930_10044252 3300002075 Bacteria 905
18 JGI24744J21845_10000055 3300002077 Bacteria 13381
19 JGI24744J21845_10089105 3300002077 Unclassified 566
20 JGI24742J22300_10010994 3300002244 Bacteria 1500
21 Ga0065704_10291073 3300005289 Bacteria 903
22 Ga0065715_10330324 3300005293 Bacteria 985
23 Ga0070658_10007529 3300005327 Bacteria 8787
24 Ga0070658_10019242 3300005327 Bacteria 5469
25 Ga0070658_10025349 3300005327 Bacteria 4755
26 Ga0070658_10148654 3300005327 Bacteria 1960
27 Ga0070658_10182464 3300005327 Bacteria 1766
28 Ga0070658_10273336 3300005327 Bacteria 1437
29 Ga0070658_10959533 3300005327 Unclassified 743
30 Ga0070676_10004251 3300005328 Bacteria 7527
31 Ga0070676_10145470 3300005328 Bacteria 1513
32 Ga0070676_10278123 3300005328 Bacteria 1127
33 Ga0070683_100019017 3300005329 Bacteria 6095
34 Ga0070683_100172414 3300005329 Bacteria 2053
35 Ga0070683_100392138 3300005329 Bacteria 1324
36 Ga0070683_100675957 3300005329 Bacteria 989
37 Ga0070690_100462654 3300005330 Unclassified 942
38 Ga0070670_100177334 3300005331 Bacteria 1849
39 Ga0070670_100736880 3300005331 Bacteria 887
40 Ga0070677_10009387 3300005333 Bacteria 3315
41 Ga0068869_100196342 3300005334 Bacteria 1589
42 Ga0068869_100303658 3300005334 Bacteria 1289
43 Ga0068869_101536991 3300005334 Bacteria 591
44 Ga0070666_10009331 3300005335 Bacteria 6113
45 Ga0070666_10021579 3300005335 Bacteria 4174
46 Ga0070666_10340076 3300005335 Bacteria 1072
47 Ga0070680_100002432 3300005336 Bacteria 13797
48 Ga0070680_100005513 3300005336 Bacteria 9579
49 Ga0070680_100053617 3300005336 Bacteria 3292
50 Ga0070680_100131326 3300005336 Bacteria 2095
51 Ga0070680_100509936 3300005336 Bacteria 1029
52 Ga0070680_100604808 3300005336 Unclassified 941
53 Ga0070680_100607577 3300005336 Bacteria 939
54 Ga0070682_100041566 3300005337 Bacteria 2834
55 Ga0070682_100843571 3300005337 Unclassified 748
56 Ga0068868_100032532 3300005338 Bacteria 4013
57 Ga0068868_100085855 3300005338 Bacteria 2529
58 Ga0068868_100186385 3300005338 Bacteria 1724
59 Ga0068868_100539636 3300005338 Unclassified 1026
60 Ga0068868_100712910 3300005338 Bacteria 898
61 Ga0070660_100019741 3300005339 Bacteria 4943
62 Ga0070660_100029896 3300005339 Bacteria 4085
63 Ga0070660_100037460 3300005339 Bacteria 3677
64 Ga0070660_100127129 3300005339 Bacteria 2037
65 Ga0070660_100153297 3300005339 Bacteria 1854
66 Ga0070660_100166992 3300005339 Bacteria 1776
67 Ga0070660_100212323 3300005339 Bacteria 1571
68 Ga0070660_100226243 3300005339 Bacteria 1521
69 Ga0070660_100781288 3300005339 Bacteria 803
70 Ga0070660_100785943 3300005339 Unclassified 800
71 Ga0070660_100787198 3300005339 Unclassified 799
72 Ga0070691_10325031 3300005341 Bacteria 847
73 Ga0070687_100038691 3300005343 Bacteria 2392
74 Ga0070687_100383776 3300005343 Bacteria 916
75 Ga0070661_100057631 3300005344 Bacteria 2846
76 Ga0070661_100075836 3300005344 Bacteria 2478
77 Ga0070661_100142394 3300005344 Bacteria 1808
78 Ga0070661_100151892 3300005344 Bacteria 1751
79 Ga0070661_100213325 3300005344 Bacteria 1478
80 Ga0070661_100379166 3300005344 Bacteria 1115
81 Ga0070692_10031841 3300005345 Bacteria 2647
82 Ga0070692_10120867 3300005345 Bacteria 1461
83 Ga0070692_10778940 3300005345 Unclassified 651
84 Ga0070668_100053802 3300005347 Bacteria 3104
85 Ga0070668_100529766 3300005347 Bacteria 1023
86 Ga0070668_100544430 3300005347 Bacteria 1010
87 Ga0070668_100573105 3300005347 Bacteria 985
88 Ga0070669_100038870 3300005353 Bacteria 3456
89 Ga0070669_100187147 3300005353 Bacteria 1622
90 Ga0070669_100274046 3300005353 Bacteria 1350
91 Ga0070669_100313642 3300005353 Bacteria 1265
92 Ga0070669_100701360 3300005353 Bacteria 855
93 Ga0070675_100022320 3300005354 Bacteria 5057
94 Ga0070675_100159534 3300005354 Bacteria 1939
95 Ga0070675_100608643 3300005354 Unclassified 991
96 Ga0070671_100036337 3300005355 Bacteria 4085
97 Ga0070671_100203211 3300005355 Bacteria 1680
98 Ga0070674_100086865 3300005356 Bacteria 2247
99 Ga0070674_100109065 3300005356 Bacteria 2029
100 Ga0070674_100829203 3300005356 Bacteria 801
101 Ga0070674_102206463 3300005356 Unclassified 503
102 Ga0070673_100011901 3300005364 Bacteria 5958
103 Ga0070673_100112245 3300005364 Bacteria 2262
104 Ga0070673_100379226 3300005364 Bacteria 1260
105 Ga0070673_100516919 3300005364 Bacteria 1081
106 Ga0070673_100642726 3300005364 Unclassified 970
107 Ga0070673_101356516 3300005364 Unclassified 668
108 Ga0070659_100012039 3300005366 Bacteria 6404
109 Ga0070659_100024629 3300005366 Bacteria 4615
110 Ga0070659_100125313 3300005366 Bacteria 2084
111 Ga0070659_100174550 3300005366 Bacteria 1762
112 Ga0070659_100197328 3300005366 Bacteria 1656
113 Ga0070659_100349682 3300005366 Bacteria 1240
114 Ga0070659_100403163 3300005366 Bacteria 1155
115 Ga0070659_100495578 3300005366 Bacteria 1041
116 Ga0070667_100018568 3300005367 Bacteria 5769
117 Ga0070667_100081208 3300005367 Bacteria 2774
118 Ga0070667_100240698 3300005367 Bacteria 1615
119 Ga0070709_10044075 3300005434 Bacteria 2761
120 Ga0070714_100095396 3300005435 Bacteria 2612
121 Ga0070714_100120567 3300005435 Bacteria 2333
122 Ga0070714_100191201 3300005435 Bacteria 1868
123 Ga0070714_100326088 3300005435 Bacteria 1437
124 Ga0070713_100005100 3300005436 Bacteria 8935
125 Ga0070713_100065022 3300005436 Bacteria 3063
126 Ga0070713_100165898 3300005436 Bacteria 1975
127 Ga0070713_100388894 3300005436 Unclassified 1301
128 Ga0070663_100065855 3300005455 Bacteria 2624
129 Ga0070663_100509490 3300005455 Unclassified 1000
130 Ga0070663_100571243 3300005455 Bacteria 948
131 Ga0070678_100004224 3300005456 Bacteria 8115
132 Ga0070678_100009114 3300005456 Bacteria 5989
133 Ga0070678_100063425 3300005456 Bacteria 2734
134 Ga0070678_100119549 3300005456 Bacteria 2075
135 Ga0070662_100005197 3300005457 Bacteria 8305
136 Ga0070662_100018155 3300005457 Bacteria 4755
137 Ga0070662_100072350 3300005457 Bacteria 2545
138 Ga0070662_100318324 3300005457 Bacteria 1268
139 Ga0070662_100497510 3300005457 Bacteria 1016
140 Ga0070662_100871747 3300005457 Unclassified 767
141 Ga0070681_10080063 3300005458 Bacteria 3223
142 Ga0070681_10284714 3300005458 Bacteria 1563
143 Ga0070681_10296169 3300005458 Bacteria 1528
144 Ga0068867_100002035 3300005459 Bacteria 14144
145 Ga0068867_100020963 3300005459 Bacteria 4661
146 Ga0070685_10278927 3300005466 Bacteria 1118
147 Ga0070685_10697814 3300005466 Bacteria 740
148 Ga0070706_100254739 3300005467 Bacteria 1639
149 Ga0070679_100077172 3300005530 Bacteria 3320
150 Ga0070679_100088147 3300005530 Bacteria 3090
151 Ga0070679_100144448 3300005530 Bacteria 2357
152 Ga0070679_100362113 3300005530 Bacteria 1397
153 Ga0070679_100370709 3300005530 Bacteria 1379
154 Ga0070679_100433735 3300005530 Bacteria 1259
155 Ga0070679_100829557 3300005530 Bacteria 868
156 Ga0070684_100101991 3300005535 Bacteria 2565
157 Ga0070684_100152215 3300005535 Bacteria 2096
158 Ga0070684_100210151 3300005535 Bacteria 1773
159 Ga0068853_100010905 3300005539 Bacteria 7364
160 Ga0068853_100079727 3300005539 Bacteria 2863
161 Ga0068853_100099466 3300005539 Bacteria 2569
162 Ga0068853_100144427 3300005539 Bacteria 2137
163 Ga0068853_100147081 3300005539 Bacteria 2118
164 Ga0068853_100175357 3300005539 Bacteria 1942
165 Ga0068853_101495863 3300005539 Bacteria 654
166 Ga0070672_100016213 3300005543 Bacteria 5329
167 Ga0070672_100099437 3300005543 Bacteria 2358
168 Ga0070672_100448923 3300005543 Bacteria 1110
169 Ga0070686_100036653 3300005544 Bacteria 3038
170 Ga0070696_100017065 3300005546 Bacteria 4898
171 Ga0070693_100040100 3300005547 Bacteria 2627
172 Ga0070693_100073186 3300005547 Bacteria 2024
173 Ga0070693_100521509 3300005547 Bacteria 846
174 Ga0070665_100006320 3300005548 Bacteria 12090
175 Ga0070665_100053630 3300005548 Bacteria 4044
176 Ga0070665_100064471 3300005548 Bacteria 3674
177 Ga0068855_100048667 3300005563 Bacteria 5003
178 Ga0068855_100050120 3300005563 Bacteria 4921
179 Ga0068855_100111070 3300005563 Bacteria 3147
180 Ga0068855_100207682 3300005563 Bacteria 2202
181 Ga0068855_100208992 3300005563 Bacteria 2194
182 Ga0068855_100243286 3300005563 Bacteria 2009
183 Ga0068855_100267980 3300005563 Bacteria 1900
184 Ga0068855_101095760 3300005563 Bacteria 833
185 Ga0070664_100021210 3300005564 Bacteria 5352
186 Ga0070664_100105909 3300005564 Bacteria 2449
187 Ga0070664_100114810 3300005564 Bacteria 2353
188 Ga0070664_100203269 3300005564 Bacteria 1768
189 Ga0070664_100441537 3300005564 Bacteria 1194
190 Ga0070664_101170914 3300005564 Bacteria 725
191 Ga0070664_101786668 3300005564 Unclassified 583
192 Ga0068857_100019007 3300005577 Bacteria 6028
193 Ga0068857_100023828 3300005577 Bacteria 5388
194 Ga0068857_100062570 3300005577 Bacteria 3308
195 Ga0068857_100482680 3300005577 Bacteria 1161
196 Ga0068857_101037990 3300005577 Unclassified 790
197 Ga0068854_100031274 3300005578 Bacteria 3698
198 Ga0068854_100092871 3300005578 Bacteria 2248
199 Ga0068854_100154935 3300005578 Bacteria 1769
200 Ga0068854_100187654 3300005578 Bacteria 1618
201 Ga0068854_100212190 3300005578 Bacteria 1527
202 Ga0068854_100508400 3300005578 Bacteria 1016
203 Ga0068854_101438166 3300005578 Bacteria 624
204 Ga0068854_101662933 3300005578 Bacteria 583
205 Ga0068856_100051981 3300005614 Bacteria 4040
206 Ga0068856_100098357 3300005614 Bacteria 2916
207 Ga0068856_100144207 3300005614 Bacteria 2389
208 Ga0068856_100172945 3300005614 Bacteria 2172
209 Ga0068856_100629053 3300005614 Bacteria 1094
210 Ga0068856_100796554 3300005614 Bacteria 965
211 Ga0068856_100848773 3300005614 Bacteria 932
212 Ga0068856_101075420 3300005614 Bacteria 822
213 Ga0068856_101339043 3300005614 Bacteria 731
214 Ga0068856_101346078 3300005614 Bacteria 729
215 Ga0068856_101928691 3300005614 Unclassified 601
216 Ga0070702_100975996 3300005615 Unclassified 669
217 Ga0068852_100001069 3300005616 Bacteria 18099
218 Ga0068852_100016289 3300005616 Bacteria 5791
219 Ga0068852_100021969 3300005616 Bacteria 5107
220 Ga0068852_100076960 3300005616 Bacteria 2947
221 Ga0068852_100098987 3300005616 Bacteria 2627
222 Ga0068852_100172565 3300005616 Bacteria 2028
223 Ga0068852_100187189 3300005616 Bacteria 1950
224 Ga0068852_100189039 3300005616 Bacteria 1942
225 Ga0068852_100403049 3300005616 Bacteria 1346
226 Ga0068852_100571183 3300005616 Bacteria 1133
227 Ga0068852_100909462 3300005616 Bacteria 897
228 Ga0068859_100028161 3300005617 Bacteria 5633
229 Ga0068859_100048003 3300005617 Bacteria 4290
230 Ga0068859_100573868 3300005617 Unclassified 1222
231 Ga0068864_100155118 3300005618 Bacteria 2078
232 Ga0068864_100197960 3300005618 Bacteria 1844
233 Ga0068864_100486578 3300005618 Bacteria 1185
234 Ga0068866_10048109 3300005718 Bacteria 2154
235 Ga0068866_10050117 3300005718 Bacteria 2119
236 Ga0068861_100211480 3300005719 Bacteria 1634
237 Ga0068861_100370429 3300005719 Unclassified 1262
238 Ga0068861_100815273 3300005719 Bacteria 877
239 Ga0068851_10008929 3300005834 Bacteria 4648
240 Ga0068851_10030743 3300005834 Bacteria 2665
241 Ga0068851_10039813 3300005834 Bacteria 2361
242 Ga0068851_10197961 3300005834 Bacteria 1120
243 Ga0068870_10068941 3300005840 Unclassified 1923
244 Ga0068870_10283983 3300005840 Bacteria 1039
245 Ga0068870_10346497 3300005840 Bacteria 952
246 Ga0068863_100005224 3300005841 Bacteria 12814
247 Ga0068863_100005699 3300005841 Bacteria 12229
248 Ga0068863_100037268 3300005841 Bacteria 4630
249 Ga0068863_100365270 3300005841 Bacteria 1408
250 Ga0068863_100916996 3300005841 Bacteria 877
251 Ga0068858_100164300 3300005842 Bacteria 2091
252 Ga0068858_100232956 3300005842 Bacteria 1746
253 Ga0068858_101050915 3300005842 Unclassified 799
254 Ga0068860_100028404 3300005843 Bacteria 5384
255 Ga0068860_100192759 3300005843 Bacteria 1973
256 Ga0068860_100295886 3300005843 Bacteria 1585
257 Ga0068860_100554667 3300005843 Unclassified 1151
258 Ga0068862_100012521 3300005844 Bacteria 7021
259 Ga0068862_100034938 3300005844 Bacteria 4255
260 Ga0068862_100344161 3300005844 Bacteria 1382
261 Ga0068862_100880869 3300005844 Bacteria 879
262 Ga0070717_10320000 3300006028 Bacteria 1382
263 Ga0070715_10790453 3300006163 Bacteria 575
264 Ga0070716_100114965 3300006173 Bacteria 1674
265 Ga0070712_100055548 3300006175 Bacteria 2774
266 Ga0075366_10136992 3300006195 Bacteria 1478
267 Ga0097621_100013004 3300006237 Bacteria 6187
268 Ga0097621_100362425 3300006237 Bacteria 1291
269 Ga0068871_100013255 3300006358 Bacteria 6113
270 Ga0068871_100023199 3300006358 Bacteria 4795
271 Ga0075429_100952659 3300006880 Bacteria 751
272 Ga0068865_100364330 3300006881 Bacteria 1175
273 Ga0097620_100028158 3300006931 Bacteria 5633
274 Ga0097620_100048003 3300006931 Bacteria 4290
275 Ga0097620_100573783 3300006931 Unclassified 1222
276 Ga0105240_10056083 3300009093 Bacteria 4931
277 Ga0105240_10211090 3300009093 Bacteria 2269
278 Ga0105240_10224311 3300009093 Bacteria 2187
279 Ga0111539_13473188 3300009094 Unclassified 506
280 Ga0105245_10037973 3300009098 Bacteria 4283
281 Ga0105245_10065426 3300009098 Bacteria 3288
282 Ga0114129_10672017 3300009147 Bacteria 1334
283 Ga0105243_10012496 3300009148 Bacteria 6420
284 Ga0105243_10064552 3300009148 Bacteria 2938
285 Ga0105243_10210720 3300009148 Bacteria 1711
286 Ga0105241_10154098 3300009174 Bacteria 1882
287 Ga0105241_10349370 3300009174 Bacteria 1283
288 Ga0105241_11204122 3300009174 Unclassified 717
289 Ga0105242_10054494 3300009176 Bacteria 3269
290 Ga0105242_10324709 3300009176 Bacteria 1413
291 Ga0105242_11410618 3300009176 Bacteria 724
292 Ga0105248_10085838 3300009177 Bacteria 3542
293 Ga0105248_10149205 3300009177 Bacteria 2638
294 Ga0105248_10589610 3300009177 Bacteria 1254
295 Ga0105248_11494295 3300009177 Bacteria 765
296 Ga0105237_10029154 3300009545 Bacteria 5614
297 Ga0105238_10016800 3300009551 Bacteria 7418
298 Ga0105238_10070567 3300009551 Bacteria 3492
299 Ga0105238_10324055 3300009551 Bacteria 1527
300 Ga0105238_10457204 3300009551 Bacteria 1274
301 Ga0105238_10556030 3300009551 Bacteria 1152
302 Ga0105238_10658903 3300009551 Bacteria 1057
303 Ga0105238_11398598 3300009551 Bacteria 727
304 Ga0105249_10651164 3300009553 Bacteria 1111
305 Ga0105249_12503674 3300009553 Unclassified 588
306 Ga0105239_10081790 3300010375 Bacteria 3555
307 Ga0105239_10083657 3300010375 Bacteria 3514
308 Ga0105239_11762993 3300010375 Bacteria 717
309 Ga0105246_10053188 3300011119 Bacteria 2786
310 Ga0105246_10542597 3300011119 Bacteria 995
311 Ga0157373_10012135 3300013100 Bacteria 6333
312 Ga0157373_10012753 3300013100 Bacteria 6176
313 Ga0157373_10068364 3300013100 Bacteria 2511
314 Ga0157373_10083663 3300013100 Bacteria 2249
315 Ga0157373_10137199 3300013100 Bacteria 1720
316 Ga0157373_10158947 3300013100 Bacteria 1590
317 Ga0157373_10256689 3300013100 Bacteria 1237
318 Ga0157373_10471548 3300013100 Bacteria 905
319 Ga0157373_11240516 3300013100 Bacteria 563
320 Ga0157373_11515958 3300013100 Unclassified 512
321 Ga0157371_10015031 3300013102 Bacteria 5818
322 Ga0157371_10020854 3300013102 Bacteria 4820
323 Ga0157371_10038044 3300013102 Bacteria 3443
324 Ga0157371_10060879 3300013102 Bacteria 2676
325 Ga0157371_10065257 3300013102 Bacteria 2578
326 Ga0157371_10073976 3300013102 Bacteria 2413
327 Ga0157371_10094710 3300013102 Bacteria 2116
328 Ga0157371_10119389 3300013102 Bacteria 1874
329 Ga0157371_10163424 3300013102 Bacteria 1590
330 Ga0157371_10279714 3300013102 Bacteria 1205
331 Ga0157371_10368839 3300013102 Bacteria 1047
332 Ga0157371_11335813 3300013102 Bacteria 555
333 Ga0157370_10048284 3300013104 Bacteria 4077
334 Ga0157370_10048564 3300013104 Bacteria 4065
335 Ga0157370_10065056 3300013104 Bacteria 3451
336 Ga0157370_10086927 3300013104 Bacteria 2937
337 Ga0157370_10089261 3300013104 Bacteria 2896
338 Ga0157370_10139727 3300013104 Bacteria 2257
339 Ga0157370_10577613 3300013104 Bacteria 1030
340 Ga0157369_10007383 3300013105 Bacteria 12652
341 Ga0157369_10031051 3300013105 Bacteria 5888
342 Ga0157369_10067972 3300013105 Bacteria 3829
343 Ga0157369_10125164 3300013105 Bacteria 2726
344 Ga0157369_10132459 3300013105 Bacteria 2641
345 Ga0157369_10135588 3300013105 Bacteria 2606
346 Ga0157369_10208604 3300013105 Bacteria 2048
347 Ga0157369_10213157 3300013105 Bacteria 2024
348 Ga0157369_10472729 3300013105 Bacteria 1297
349 Ga0157369_10610836 3300013105 Bacteria 1125
350 Ga0157369_10649490 3300013105 Bacteria 1088
351 Ga0157369_12073942 3300013105 Bacteria 577
352 Ga0157369_12556255 3300013105 Unclassified 517
353 Ga0157374_10050975 3300013296 Bacteria 3850
354 Ga0157374_10079406 3300013296 Bacteria 3109
355 Ga0157374_10107964 3300013296 Bacteria 2675
356 Ga0157374_10464772 3300013296 Bacteria 1267
357 Ga0157374_10564921 3300013296 Bacteria 1146
358 Ga0157374_10987084 3300013296 Unclassified 861
359 Ga0157374_11503172 3300013296 Unclassified 697
360 Ga0157378_10021644 3300013297 Bacteria 5654
361 Ga0157378_10033817 3300013297 Bacteria 4521
362 Ga0163162_10056100 3300013306 Bacteria 3968
363 Ga0163162_10161503 3300013306 Bacteria 2362
364 Ga0157372_10008752 3300013307 Bacteria 10748
365 Ga0157372_10065325 3300013307 Bacteria 4085
366 Ga0157372_10185390 3300013307 Bacteria 2410
367 Ga0157372_10988526 3300013307 Bacteria 975
368 Ga0157372_11740037 3300013307 Unclassified 717
369 Ga0157375_10016314 3300013308 Bacteria 6668
370 Ga0157375_10027659 3300013308 Bacteria 5304
371 Ga0157375_10312787 3300013308 Bacteria 1735
372 Ga0157375_11810632 3300013308 Bacteria 724
373 Ga0163163_10237948 3300014325 Bacteria 1870
374 Ga0163163_10405083 3300014325 Bacteria 1422
375 Ga0157380_10527351 3300014326 Bacteria 1153
376 Ga0157377_10056992 3300014745 Bacteria 2220
377 Ga0157377_10201160 3300014745 Bacteria 1265
378 Ga0157379_11281722 3300014968 Bacteria 707
379 Ga0157376_10185201 3300014969 Bacteria 1906
380 Ga0157376_10492334 3300014969 Bacteria 1203
381 Ga0157376_10717075 3300014969 Unclassified 1007
382 Ga0163161_10571810 3300017792 Unclassified 929
383 Ga0206354_11586023 3300020081 Bacteria 1471
384 Ga0206353_10738842 3300020082 Bacteria 7517
385 Ga0207697_10011008 3300025315 Bacteria 3839
386 Ga0207697_10034325 3300025315 Bacteria 2077
387 Ga0207697_10066762 3300025315 Bacteria 1503
388 Ga0207697_10155131 3300025315 Bacteria 997
389 Ga0207656_10025165 3300025321 Bacteria 2414
390 Ga0207656_10275334 3300025321 Bacteria 829
391 Ga0207656_10331235 3300025321 Unclassified 757
392 Ga0207656_10540296 3300025321 Unclassified 593
393 Ga0207682_10001342 3300025893 Bacteria 11341
394 Ga0207642_10086534 3300025899 Bacteria 1536
395 Ga0207710_10057212 3300025900 Bacteria 1761
396 Ga0207688_10009382 3300025901 Bacteria 5329
397 Ga0207688_10265839 3300025901 Bacteria 1042
398 Ga0207688_10337600 3300025901 Bacteria 926
399 Ga0207688_10734798 3300025901 Bacteria 625
400 Ga0207680_10003327 3300025903 Bacteria 7573
401 Ga0207680_10007066 3300025903 Bacteria 5454
402 Ga0207680_10630441 3300025903 Bacteria 767
403 Ga0207647_10019866 3300025904 Bacteria 4511
404 Ga0207647_10038542 3300025904 Bacteria 3020
405 Ga0207647_10073031 3300025904 Bacteria 2068
406 Ga0207647_10219558 3300025904 Bacteria 1096
407 Ga0207685_10519340 3300025905 Bacteria 629
408 Ga0207699_10008885 3300025906 Bacteria 4980
409 Ga0207645_10002319 3300025907 Bacteria 15052
410 Ga0207645_10015407 3300025907 Bacteria 5079
411 Ga0207645_10106104 3300025907 Bacteria 1816
412 Ga0207645_10265082 3300025907 Bacteria 1138
413 Ga0207643_10072411 3300025908 Bacteria 1985
414 Ga0207643_10150036 3300025908 Bacteria 1397
415 Ga0207705_10021914 3300025909 Bacteria 4558
416 Ga0207705_10033619 3300025909 Bacteria 3664
417 Ga0207705_10080315 3300025909 Bacteria 2376
418 Ga0207705_10103966 3300025909 Bacteria 2092
419 Ga0207705_10111793 3300025909 Bacteria 2019
420 Ga0207705_10138049 3300025909 Bacteria 1819
421 Ga0207705_10166359 3300025909 Bacteria 1658
422 Ga0207705_10482361 3300025909 Bacteria 962
423 Ga0207684_10159692 3300025910 Bacteria 1941
424 Ga0207654_10598661 3300025911 Bacteria 786
425 Ga0207654_10848306 3300025911 Unclassified 661
426 Ga0207707_10051960 3300025912 Bacteria 3569
427 Ga0207707_10129047 3300025912 Bacteria 2211
428 Ga0207707_10172177 3300025912 Bacteria 1892
429 Ga0207707_10287192 3300025912 Bacteria 1424
430 Ga0207707_10419268 3300025912 Bacteria 1148
431 Ga0207707_10423305 3300025912 Bacteria 1141
432 Ga0207695_10039931 3300025913 Bacteria 5039
433 Ga0207695_10115246 3300025913 Bacteria 2662
434 Ga0207695_10543926 3300025913 Bacteria 1043
435 Ga0207671_10489321 3300025914 Bacteria 981
436 Ga0207660_10000059 3300025917 Bacteria 56766
437 Ga0207660_10001202 3300025917 Bacteria 17345
438 Ga0207660_10009838 3300025917 Bacteria 6191
439 Ga0207660_10078092 3300025917 Bacteria 2425
440 Ga0207660_10537099 3300025917 Bacteria 950
441 Ga0207662_10023202 3300025918 Bacteria 3563
442 Ga0207657_10012830 3300025919 Bacteria 8246
443 Ga0207657_10014934 3300025919 Bacteria 7546
444 Ga0207657_10029689 3300025919 Bacteria 4973
445 Ga0207657_10031052 3300025919 Bacteria 4843
446 Ga0207657_10034236 3300025919 Bacteria 4571
447 Ga0207657_10036827 3300025919 Bacteria 4376
448 Ga0207657_10093145 3300025919 Bacteria 2510
449 Ga0207657_10145426 3300025919 Bacteria 1934
450 Ga0207657_10725073 3300025919 Bacteria 771
451 Ga0207657_10736022 3300025919 Unclassified 764
452 Ga0207657_11313120 3300025919 Unclassified 546
453 Ga0207649_10027742 3300025920 Bacteria 3327
454 Ga0207649_10044044 3300025920 Bacteria 2731
455 Ga0207649_10107540 3300025920 Bacteria 1857
456 Ga0207649_10125061 3300025920 Bacteria 1739
457 Ga0207649_10343523 3300025920 Bacteria 1103
458 Ga0207649_10565012 3300025920 Bacteria 872
459 Ga0207649_10840692 3300025920 Bacteria 718
460 Ga0207649_10857960 3300025920 Unclassified 711
461 Ga0207652_10018990 3300025921 Bacteria 5645
462 Ga0207652_10124163 3300025921 Bacteria 2299
463 Ga0207652_10276410 3300025921 Bacteria 1515
464 Ga0207652_10706897 3300025921 Bacteria 899
465 Ga0207652_11193810 3300025921 Bacteria 662
466 Ga0207681_10008022 3300025923 Bacteria 6460
467 Ga0207681_10031395 3300025923 Bacteria 3469
468 Ga0207681_10830529 3300025923 Bacteria 772
469 Ga0207694_10000966 3300025924 Bacteria 25308
470 Ga0207694_10330707 3300025924 Bacteria 1259
471 Ga0207694_10594715 3300025924 Bacteria 930
472 Ga0207694_11594506 3300025924 Bacteria 550
473 Ga0207650_10004781 3300025925 Bacteria 9254
474 Ga0207650_10019021 3300025925 Bacteria 4828
475 Ga0207650_10075522 3300025925 Bacteria 2543
476 Ga0207659_10196454 3300025926 Bacteria 1608
477 Ga0207687_10107523 3300025927 Bacteria 2064
478 Ga0207687_10160373 3300025927 Bacteria 1725
479 Ga0207687_10169601 3300025927 Bacteria 1682
480 Ga0207700_10115712 3300025928 Bacteria 2166
481 Ga0207700_10258425 3300025928 Bacteria 1490
482 Ga0207700_10462894 3300025928 Bacteria 1119
483 Ga0207664_10013598 3300025929 Bacteria 5850
484 Ga0207664_10016311 3300025929 Bacteria 5417
485 Ga0207664_10023570 3300025929 Bacteria 4614
486 Ga0207664_10116219 3300025929 Bacteria 2232
487 Ga0207664_10125235 3300025929 Bacteria 2156
488 Ga0207664_10609540 3300025929 Bacteria 980
489 Ga0207644_10000142 3300025931 Bacteria 51611
490 Ga0207644_10554064 3300025931 Bacteria 952
491 Ga0207690_10002953 3300025932 Bacteria 10245
492 Ga0207690_10046793 3300025932 Bacteria 2867
493 Ga0207690_10088152 3300025932 Bacteria 2185
494 Ga0207690_10125542 3300025932 Bacteria 1870
495 Ga0207690_10269397 3300025932 Bacteria 1322
496 Ga0207690_10299348 3300025932 Unclassified 1258
497 Ga0207690_10429579 3300025932 Bacteria 1058
498 Ga0207690_10447098 3300025932 Bacteria 1038
499 Ga0207690_10472911 3300025932 Bacteria 1010
500 Ga0207706_10005721 3300025933 Bacteria 11580
501 Ga0207706_10019092 3300025933 Bacteria 6166
502 Ga0207706_10037307 3300025933 Bacteria 4316
503 Ga0207706_10086882 3300025933 Bacteria 2749
504 Ga0207706_10145933 3300025933 Bacteria 2081
505 Ga0207706_10451867 3300025933 Unclassified 1111
506 Ga0207686_10301444 3300025934 Bacteria 1190
507 Ga0207709_10572962 3300025935 Bacteria 891
508 Ga0207709_10705767 3300025935 Bacteria 808
509 Ga0207669_10018773 3300025937 Bacteria 3584
510 Ga0207669_10065902 3300025937 Bacteria 2249
511 Ga0207704_10016287 3300025938 Bacteria 3817
512 Ga0207665_10100078 3300025939 Bacteria 2022
513 Ga0207691_10006169 3300025940 Bacteria 11586
514 Ga0207691_10024129 3300025940 Bacteria 5719
515 Ga0207691_10043385 3300025940 Bacteria 4145
516 Ga0207691_10044757 3300025940 Bacteria 4073
517 Ga0207691_11592727 3300025940 Bacteria 531
518 Ga0207711_10029289 3300025941 Bacteria 4642
519 Ga0207711_10171135 3300025941 Bacteria 1971
520 Ga0207711_10350779 3300025941 Bacteria 1366
521 Ga0207711_10386494 3300025941 Bacteria 1299
522 Ga0207711_10798801 3300025941 Bacteria 879
523 Ga0207689_10012587 3300025942 Bacteria 7226
524 Ga0207689_10047729 3300025942 Bacteria 3533
525 Ga0207661_10071102 3300025944 Bacteria 2842
526 Ga0207661_10085121 3300025944 Bacteria 2620
527 Ga0207661_10231631 3300025944 Bacteria 1636
528 Ga0207679_10016598 3300025945 Bacteria 4893
529 Ga0207679_10107503 3300025945 Bacteria 2195
530 Ga0207679_10314524 3300025945 Bacteria 1354
531 Ga0207679_10318756 3300025945 Bacteria 1345
532 Ga0207679_11253184 3300025945 Bacteria 681
533 Ga0207667_10005262 3300025949 Bacteria 15787
534 Ga0207667_10029624 3300025949 Bacteria 5935
535 Ga0207667_10039670 3300025949 Bacteria 5017
536 Ga0207667_10040206 3300025949 Bacteria 4980
537 Ga0207667_10098120 3300025949 Bacteria 3023
538 Ga0207667_10338450 3300025949 Bacteria 1536
539 Ga0207667_11101816 3300025949 Bacteria 777
540 Ga0207651_10005732 3300025960 Bacteria 6414
541 Ga0207651_10010290 3300025960 Bacteria 5175
542 Ga0207651_10426995 3300025960 Bacteria 1132
543 Ga0207651_10973357 3300025960 Bacteria 757
544 Ga0207712_10510139 3300025961 Bacteria 1029
545 Ga0207668_10018267 3300025972 Bacteria 4408
546 Ga0207668_10261158 3300025972 Unclassified 1411
547 Ga0207668_10368207 3300025972 Bacteria 1206
548 Ga0207640_10062397 3300025981 Bacteria 2473
549 Ga0207640_10067242 3300025981 Bacteria 2397
550 Ga0207640_10100206 3300025981 Bacteria 2029
551 Ga0207640_10244932 3300025981 Bacteria 1388
552 Ga0207640_10264000 3300025981 Bacteria 1343
553 Ga0207640_10339783 3300025981 Bacteria 1202
554 Ga0207640_10471741 3300025981 Bacteria 1039
555 Ga0207640_11193247 3300025981 Bacteria 676
556 Ga0207658_10027405 3300025986 Bacteria 4002
557 Ga0207658_10920118 3300025986 Bacteria 796
558 Ga0207677_10005002 3300026023 Bacteria 7159
559 Ga0207677_10077416 3300026023 Bacteria 2372
560 Ga0207677_10298819 3300026023 Bacteria 1329
561 Ga0207677_10955081 3300026023 Bacteria 775
562 Ga0207677_10982498 3300026023 Unclassified 765
563 Ga0207703_10241762 3300026035 Bacteria 1623
564 Ga0207639_10000744 3300026041 Bacteria 22249
565 Ga0207639_10154043 3300026041 Bacteria 1928
566 Ga0207639_10276366 3300026041 Bacteria 1475
567 Ga0207639_10836987 3300026041 Bacteria 858
568 Ga0207639_11020424 3300026041 Unclassified 775
569 Ga0207678_10008634 3300026067 Bacteria 8980
570 Ga0207678_10010248 3300026067 Bacteria 8226
571 Ga0207678_10032194 3300026067 Bacteria 4570
572 Ga0207678_10058363 3300026067 Bacteria 3321
573 Ga0207678_10067799 3300026067 Bacteria 3062
574 Ga0207702_10043057 3300026078 Bacteria 3789
575 Ga0207702_10150028 3300026078 Bacteria 2119
576 Ga0207702_10153445 3300026078 Bacteria 2097
577 Ga0207702_10176712 3300026078 Bacteria 1963
578 Ga0207702_10204038 3300026078 Bacteria 1834
579 Ga0207702_10271492 3300026078 Bacteria 1600
580 Ga0207702_10501619 3300026078 Bacteria 1183
581 Ga0207702_10698785 3300026078 Bacteria 999
582 Ga0207702_11014447 3300026078 Bacteria 823
583 Ga0207702_11247363 3300026078 Bacteria 737
584 Ga0207641_10006875 3300026088 Bacteria 9522
585 Ga0207641_10025415 3300026088 Bacteria 4883
586 Ga0207641_10067548 3300026088 Bacteria 3063
587 Ga0207641_10170134 3300026088 Bacteria 1988
588 Ga0207641_10856120 3300026088 Bacteria 901
589 Ga0207648_10002458 3300026089 Bacteria 19911
590 Ga0207648_10011602 3300026089 Bacteria 8297
591 Ga0207648_10019695 3300026089 Bacteria 6088
592 Ga0207676_10097044 3300026095 Bacteria 2434
593 Ga0207676_10348835 3300026095 Bacteria 1368
594 Ga0207676_10674280 3300026095 Bacteria 999
595 Ga0207674_10000065 3300026116 Bacteria 109485
596 Ga0207674_10002824 3300026116 Bacteria 21598
597 Ga0207674_10003445 3300026116 Bacteria 19357
598 Ga0207674_10014766 3300026116 Bacteria 8616
599 Ga0207674_10235128 3300026116 Bacteria 1780
600 Ga0207674_10434534 3300026116 Bacteria 1269
601 Ga0207674_11208187 3300026116 Unclassified 726
602 Ga0207675_100036554 3300026118 Bacteria 4581
603 Ga0207675_100147162 3300026118 Bacteria 2240
604 Ga0207675_100340165 3300026118 Bacteria 1469
605 Ga0207683_10002271 3300026121 Bacteria 16845
606 Ga0207683_10013861 3300026121 Bacteria 6875
607 Ga0207683_10025083 3300026121 Bacteria 5141
608 Ga0207683_10026610 3300026121 Bacteria 4994
609 Ga0207698_10003907 3300026142 Bacteria 9024
610 Ga0207698_10011411 3300026142 Bacteria 5761
611 Ga0207698_10011695 3300026142 Bacteria 5704
612 Ga0207698_10036738 3300026142 Bacteria 3599
613 Ga0207698_10079985 3300026142 Bacteria 2631
614 Ga0207698_10093067 3300026142 Bacteria 2474
615 Ga0207698_10223892 3300026142 Bacteria 1702
616 Ga0207698_10545829 3300026142 Bacteria 1135
617 Ga0207698_10606264 3300026142 Bacteria 1080
618 Ga0207698_10683636 3300026142 Bacteria 1020
619 Ga0207698_11053160 3300026142 Bacteria 825
620 Ga0268266_10045835 3300028379 Bacteria 3742
621 Ga0268266_10057167 3300028379 Bacteria 3356
622 Ga0268265_10077818 3300028380 Bacteria 2606
623 Ga0268265_10092192 3300028380 Bacteria 2424
624 Ga0268265_10169604 3300028380 Bacteria 1864
625 Ga0268264_10020803 3300028381 Bacteria 5362
626 Ga0268264_10106161 3300028381 Bacteria 2451
627 Ga0307413_10638425 3300031824 Bacteria 877
628 Ga0307407_10149918 3300031903 Bacteria 1514
629 Ga0307409_100115233 3300031995 Bacteria 2262
630 Ga0307409_102729320 3300031995 Unclassified 522
631 Ga0307414_10438030 3300032004 Bacteria 1143
632 Ga0307411_10037200 3300032005 Bacteria 3058
633 Ga0373948_0152515 3300034817 Unclassified 578
634 Ga0373938_0199973 3300034957 Unclassified 553
635 Ga0373952_0160837 3300035092 Bacteria 636
636 Ga0373952_0290951 3300035092 Unclassified 506
637 Ga0373960_0069579 3300035121 Bacteria 1086
638 Ga0373943_0011671 3300035170 Bacteria 3955
639 Ga0373946_0011556 3300035171 Bacteria 3297
640 Ga0373942_0099976 3300035207 Unclassified 885
641 Ga0373931_0051628 3300035691 Bacteria 2191
642 Ga0373931_0784072 3300035691 Bacteria 634
643 Ga0373935_0006536 3300035692 Bacteria 6964
644 Ga0373935_0020199 3300035692 Bacteria 4067
645 Ga0373927_0022086 3300035695 Bacteria 4170
646 Ga0373947_0006264 3300035725 Bacteria 6916
647 Ga0373937_1473378 3300036401 Bacteria 628
648 Ga0373937_1474027 3300036401 Unclassified 628
649 Ga0373925_0249024 3300037068 Bacteria 1424
650 Ga0395899_0000113 3300037312 Bacteria 136163
651 Ga0395899_0006469 3300037312 Bacteria 9076
652 Ga0395899_0013449 3300037312 Bacteria 6260
653 Ga0395899_0019176 3300037312 Bacteria 5198
654 Ga0395899_0020590 3300037312 Bacteria 5000
655 Ga0395899_0060907 3300037312 Bacteria 2780
656 Ga0395899_0063573 3300037312 Bacteria 2715
657 Ga0395899_0066680 3300037312 Bacteria 2642
658 Ga0395899_0100246 3300037312 Bacteria 2091
659 Ga0395899_0106552 3300037312 Bacteria 2018
660 Ga0395899_0109688 3300037312 Bacteria 1985
661 Ga0395899_0284882 3300037312 Bacteria 1123
662 Ga0395899_0959713 3300037312 Unclassified 518
663 Ga0395900_0000365 3300037418 Bacteria 65054
664 Ga0395900_0000964 3300037418 Bacteria 37445
665 Ga0395900_0008087 3300037418 Bacteria 10828
666 Ga0395900_0011278 3300037418 Bacteria 9140
667 Ga0395900_0013562 3300037418 Bacteria 8325
668 Ga0395900_0023762 3300037418 Bacteria 6270
669 Ga0395900_0024613 3300037418 Bacteria 6161
670 Ga0395900_0056333 3300037418 Bacteria 4046
671 Ga0395900_0069852 3300037418 Bacteria 3610
672 Ga0395900_0086813 3300037418 Bacteria 3215
673 Ga0395900_0091354 3300037418 Bacteria 3129
674 Ga0395900_0093890 3300037418 Bacteria 3081
675 Ga0395900_0158283 3300037418 Bacteria 2312
676 Ga0395900_0167586 3300037418 Bacteria 2238
677 Ga0395900_0198808 3300037418 Bacteria 2029
678 Ga0395900_0252090 3300037418 Unclassified 1766
679 Ga0395900_0353100 3300037418 Bacteria 1443
680 Ga0395900_0513194 3300037418 Unclassified 1147
681 Ga0395900_0692766 3300037418 Bacteria 953
682 Ga0395900_1335932 3300037418 Unclassified 630
683 Ga0395900_1458714 3300037418 Bacteria 597
684 Ga0395898_0000306 3300037466 Bacteria 115940
685 Ga0395898_0008363 3300037466 Bacteria 10939
686 Ga0395898_0022122 3300037466 Bacteria 6441
687 Ga0395898_0038340 3300037466 Bacteria 4750
688 Ga0395898_0049745 3300037466 Bacteria 4106
689 Ga0395898_0088936 3300037466 Bacteria 2973
690 Ga0395898_0247782 3300037466 Bacteria 1699
691 Ga0395898_0256801 3300037466 Bacteria 1666
692 Ga0395898_0281130 3300037466 Bacteria 1587
693 Ga0395898_0329735 3300037466 Bacteria 1455
694 Ga0395898_0476492 3300037466 Bacteria 1187
695 Ga0395898_0746893 3300037466 Bacteria 920
696 Ga0395898_0919109 3300037466 Bacteria 813
697 Ga0395898_1290038 3300037466 Unclassified 660
698 Ga0395898_1292840 3300037466 Unclassified 659
699 Ga0395905_0000005 3300037471 Bacteria 557808
700 Ga0395905_0002956 3300037471 Bacteria 18463
701 Ga0395905_0009966 3300037471 Bacteria 9258
702 Ga0395905_0011079 3300037471 Bacteria 8728
703 Ga0395905_0016924 3300037471 Bacteria 6925
704 Ga0395905_0019166 3300037471 Bacteria 6488
705 Ga0395905_0021922 3300037471 Bacteria 6041
706 Ga0395905_0026212 3300037471 Bacteria 5497
707 Ga0395905_0026426 3300037471 Bacteria 5473
708 Ga0395905_0032743 3300037471 Bacteria 4886
709 Ga0395905_0039456 3300037471 Bacteria 4429
710 Ga0395905_0058925 3300037471 Bacteria 3590
711 Ga0395905_0059475 3300037471 Bacteria 3572
712 Ga0395905_0088779 3300037471 Bacteria 2897
713 Ga0395905_0131320 3300037471 Bacteria 2355
714 Ga0395905_0153323 3300037471 Bacteria 2167
715 Ga0395905_0200174 3300037471 Bacteria 1872
716 Ga0395905_0231601 3300037471 Bacteria 1727
717 Ga0395905_0399924 3300037471 Bacteria 1268
718 Ga0395905_0968691 3300037471 Bacteria 754
719 Ga0395905_0997386 3300037471 Bacteria 740
720 Ga0395905_1230778 3300037471 Unclassified 652
721 Ga0395905_1618297 3300037471 Unclassified 552
722 Ga0395905_1786056 3300037471 Unclassified 520
723 Ga0395901_0000248 3300038443 Bacteria 67155
724 Ga0395901_0001201 3300038443 Bacteria 27555
725 Ga0395901_0005488 3300038443 Bacteria 12849
726 Ga0395901_0012068 3300038443 Bacteria 8766
727 Ga0395901_0020064 3300038443 Bacteria 6839
728 Ga0395901_0033619 3300038443 Bacteria 5294
729 Ga0395901_0036467 3300038443 Bacteria 5083
730 Ga0395901_0037974 3300038443 Bacteria 4981
731 Ga0395901_0053500 3300038443 Bacteria 4194
732 Ga0395901_0071571 3300038443 Bacteria 3613
733 Ga0395901_0112322 3300038443 Bacteria 2861
734 Ga0395901_0188653 3300038443 Bacteria 2162
735 Ga0395901_0221755 3300038443 Bacteria 1976
736 Ga0395901_0230144 3300038443 Bacteria 1935
737 Ga0395901_0232464 3300038443 Bacteria 1924
738 Ga0395901_0264959 3300038443 Bacteria 1788
739 Ga0395901_0266208 3300038443 Bacteria 1783
740 Ga0395901_0320938 3300038443 Bacteria 1602
741 Ga0395901_0368635 3300038443 Bacteria 1480
742 Ga0395901_0963436 3300038443 Bacteria 831
743 Ga0395901_1348648 3300038443 Bacteria 673
744 Ga0395901_1584638 3300038443 Unclassified 609
745 Ga0395901_1585893 3300038443 Bacteria 608
746 Ga0395901_1695383 3300038443 Unclassified 583
747 Ga0450905_000308 3300042142 Bacteria 5840
748 Ga0450889_000193 3300042144 Bacteria 6640
749 Ga0439464_0000878 3300042439 Bacteria 6694
750 Ga0450916_011021 3300042530 Bacteria 1137
751 Ga0466969_0053432 3300044656 Bacteria 1982
752 Ga0466969_0236065 3300044656 Bacteria 830
753 Ga0466972_0013931 3300044658 Bacteria 4033
754 Ga0466972_0333981 3300044658 Unclassified 709
755 Ga0466965_0146056 3300044683 Bacteria 1234
756 Ga0466966_0014830 3300044684 Bacteria 5157
757 Ga0466966_0115883 3300044684 Bacteria 1649
758 Ga0466966_0206842 3300044684 Bacteria 1187
759 Ga0466966_0379329 3300044684 Bacteria 849
760 Ga0466966_0535935 3300044684 Bacteria 704
761 Ga0466961_0019333 3300044693 Bacteria 4383
762 Ga0466961_0067398 3300044693 Bacteria 2273
763 Ga0466961_0071576 3300044693 Bacteria 2200
764 Ga0466963_0011010 3300044694 Bacteria 5499
765 Ga0466963_0026975 3300044694 Bacteria 3674
766 Ga0466963_0073469 3300044694 Bacteria 2305
767 Ga0466963_0106910 3300044694 Bacteria 1919
768 Ga0466963_0109725 3300044694 Bacteria 1893
769 Ga0466963_0200529 3300044694 Bacteria 1396
770 Ga0466963_0312157 3300044694 Bacteria 1106
771 Ga0466963_1223523 3300044694 Unclassified 527
772 Ga0466964_0012076 3300044706 Bacteria 3268
773 Ga0466971_0008654 3300044719 Bacteria 4441
774 Ga0466968_0014457 3300044735 Bacteria 3120
775 Ga0466970_0042966 3300044765 Bacteria 2404
776 Ga0466957_0010249 3300044842 Bacteria 5371
777 Ga0466957_0010341 3300044842 Bacteria 5351
778 Ga0466957_0086722 3300044842 Bacteria 1956
779 Ga0466957_0147311 3300044842 Bacteria 1520
780 Ga0466957_0388337 3300044842 Bacteria 953
781 Ga0466960_0024453 3300044901 Bacteria 2724
782 Ga0466959_0015101 3300045049 Bacteria 5626
783 Ga0466959_0129688 3300045049 Bacteria 1787
784 Ga0466959_0992697 3300045049 Unclassified 559
785 Ga0466958_0004622 3300045836 Bacteria 7295
786 Ga0466958_0032876 3300045836 Bacteria 3088
787 Ga0466958_0094076 3300045836 Bacteria 1856
788 Ga0466958_0160209 3300045836 Bacteria 1421
789 Ga0466967_0031731 3300045976 Bacteria 4452
790 Ga0466967_0048036 3300045976 Bacteria 3725
791 Ga0466967_0059029 3300045976 Bacteria 3393
792 Ga0466967_0077920 3300045976 Bacteria 2985
793 Ga0466967_0092983 3300045976 Bacteria 2743
794 Ga0466967_0107463 3300045976 Bacteria 2559
795 Ga0466967_0115004 3300045976 Bacteria 2477
796 Ga0466967_0142167 3300045976 Bacteria 2236
797 Ga0466967_0142274 3300045976 Bacteria 2235
798 Ga0466967_0160602 3300045976 Bacteria 2109
799 Ga0466967_0182596 3300045976 Bacteria 1980
800 Ga0466967_0418201 3300045976 Bacteria 1306
801 Ga0466967_0476505 3300045976 Bacteria 1222
802 Ga0466967_0570544 3300045976 Bacteria 1115
803 Ga0466967_0824391 3300045976 Bacteria 921
804 Ga0466967_0857472 3300045976 Unclassified 903
805 Ga0495643_0148301 3300046522 Bacteria 1164
806 Ga0495663_0259036 3300046525 Unclassified 619
807 Ga0495586_0575452 3300046535 Bacteria 650
808 Ga0495587_0666300 3300046536 Unclassified 571
809 Ga0495621_0000060 3300046539 Bacteria 21095
810 Ga0495633_0027524 3300046558 Bacteria 2779
811 Ga0495659_0023971 3300046664 Bacteria 2077
812 Ga0495669_0027423 3300046684 Bacteria 2492
813 Ga0495669_0162582 3300046684 Bacteria 1060
814 Ga0495670_0000649 3300046691 Bacteria 16588
815 Ga0496100_0001630 3300048903 Bacteria 11108
816 Ga0496101_0002764 3300048904 Bacteria 10775
817 Ga0496101_0113492 3300048904 Bacteria 2042
818 Ga0496102_0029658 3300048905 Bacteria 4896
819 Ga0496103_0059996 3300048906 Bacteria 2364
820 Ga0496104_0025877 3300048907 Bacteria 5412
821 Ga0496105_0116908 3300048908 Bacteria 2199
822 Ga0496106_0019173 3300048909 Bacteria 5072
823 Ga0496107_0000863 3300048910 Bacteria 17819
824 Ga0496107_0221134 3300048910 Bacteria 1409
825 Ga0496107_0633147 3300048910 Unclassified 789
826 Ga0496108_0000954 3300048911 Bacteria 22471
827 Ga0496109_0008004 3300048912 Bacteria 8962
828 Ga0496109_0349477 3300048912 Bacteria 1397
829 Ga0496109_1069929 3300048912 Bacteria 744
830 Ga0496110_0000754 3300048913 Bacteria 22407
831 Ga0496110_0058166 3300048913 Bacteria 3405
832 Ga0496111_0000069 3300048914 Bacteria 42302
833 Ga0496111_0183123 3300048914 Bacteria 1557
834 Ga0496112_0004068 3300048915 Bacteria 12275
835 Ga0496112_0005549 3300048915 Bacteria 10933
836 Ga0496112_0112500 3300048915 Bacteria 2693
837 Ga0496112_0395488 3300048915 Bacteria 1322
838 Ga0496112_0475481 3300048915 Bacteria 1186
839 Ga0496112_1179228 3300048915 Bacteria 683
840 Ga0496113_0007460 3300048916 Bacteria 7042
841 Ga0496113_0007666 3300048916 Bacteria 6965
842 Ga0501047_0775060 3300049581 Unclassified 774
843 Ga0501068_0022903 3300049584 Bacteria 3657
844 Ga0501068_0091248 3300049584 Bacteria 1880
845 Ga0501079_0600648 3300049741 Unclassified 866
846 Ga0501080_0041798 3300049742 Bacteria 4270
847 Ga0501044_0805947 3300049823 Bacteria 818
848 nmdc:mga0k408_110604_c1 3300050493 Bacteria 1624
849 nmdc:mga05p37_867572_c1 3300050507 Bacteria 978
850 nmdc:mga09592_133478_c1 3300050508 Bacteria 2137
851 Ga0466962_0007173 3300061719 Bacteria 5337
852 Ga0466962_0048447 3300061719 Bacteria 2030
853 Ga0466962_0424683 3300061719 Bacteria 667
854 Ga0530510_0235793 3300061734 Bacteria 1362
855 Ga0070714_100036186
856 JGI24752J21851_1033251
857 JGI24747J21853_1003908
858 JGI24740J21852_10021801
859 JGI24740J21852_10053770
860 JGI24740J21852_10067802
861 JGI24740J21852_10104779
862 JGI24739J22299_10012780
863 JGI24739J22299_10088317
864 JGI24737J22298_10014199
865 JGI24737J22298_10016841
866 JGI24743J22301_10003394
867 JGI24735J21928_10002140
868 JGI24735J21928_10014828
869 JGI24745J21846_1009482
870 JGI24738J21930_10007344
871 JGI24738J21930_10044252
872 JGI24744J21845_10000055
873 JGI24744J21845_10089105
874 JGI24742J22300_10010994
875 Ga0065704_10291073
876 Ga0065715_10330324
877 Ga0070658_10007529
878 Ga0070658_10019242
879 Ga0070658_10025349
880 Ga0070658_10148654
881 Ga0070658_10182464
882 Ga0070658_10273336
883 Ga0070658_10959533
884 Ga0070676_10004251
885 Ga0070676_10145470
886 Ga0070676_10278123
887 Ga0070683_100019017
888 Ga0070683_100172414
889 Ga0070683_100392138
890 Ga0070683_100675957
891 Ga0070690_100462654
892 Ga0070670_100177334
893 Ga0070670_100736880
894 Ga0070677_10009387
895 Ga0068869_100196342
896 Ga0068869_100303658
897 Ga0068869_101536991
898 Ga0070666_10009331
899 Ga0070666_10021579
900 Ga0070666_10340076
901 Ga0070680_100002432
902 Ga0070680_100005513
903 Ga0070680_100053617
904 Ga0070680_100131326
905 Ga0070680_100509936
906 Ga0070680_100604808
907 Ga0070680_100607577
908 Ga0070682_100041566
909 Ga0070682_100843571
910 Ga0068868_100032532
911 Ga0068868_100085855
912 Ga0068868_100186385
913 Ga0068868_100539636
914 Ga0068868_100712910
915 Ga0070660_100019741
916 Ga0070660_100029896
917 Ga0070660_100037460
918 Ga0070660_100127129
919 Ga0070660_100153297
920 Ga0070660_100166992
921 Ga0070660_100212323
922 Ga0070660_100226243
923 Ga0070660_100781288
924 Ga0070660_100785943
925 Ga0070660_100787198
926 Ga0070691_10325031
927 Ga0070687_100038691
928 Ga0070687_100383776
929 Ga0070661_100057631
930 Ga0070661_100075836
931 Ga0070661_100142394
932 Ga0070661_100151892
933 Ga0070661_100213325
934 Ga0070661_100379166
935 Ga0070692_10031841
936 Ga0070692_10120867
937 Ga0070692_10778940
938 Ga0070668_100053802
939 Ga0070668_100529766
940 Ga0070668_100544430
941 Ga0070668_100573105
942 Ga0070669_100038870
943 Ga0070669_100187147
944 Ga0070669_100274046
945 Ga0070669_100313642
946 Ga0070669_100701360
947 Ga0070675_100022320
948 Ga0070675_100159534
949 Ga0070675_100608643
950 Ga0070671_100036337
951 Ga0070671_100203211
952 Ga0070674_100086865
953 Ga0070674_100109065
954 Ga0070674_100829203
955 Ga0070674_102206463
956 Ga0070673_100011901
957 Ga0070673_100112245
958 Ga0070673_100379226
959 Ga0070673_100516919
960 Ga0070673_100642726
961 Ga0070673_101356516
962 Ga0070659_100012039
963 Ga0070659_100024629
964 Ga0070659_100125313
965 Ga0070659_100174550
966 Ga0070659_100197328
967 Ga0070659_100349682
968 Ga0070659_100403163
969 Ga0070659_100495578
970 Ga0070667_100018568
971 Ga0070667_100081208
972 Ga0070667_100240698
973 Ga0070709_10044075
974 Ga0070714_100095396
975 Ga0070714_100120567
976 Ga0070714_100191201
977 Ga0070714_100326088
978 Ga0070713_100005100
979 Ga0070713_100065022
980 Ga0070713_100165898
981 Ga0070713_100388894
982 Ga0070663_100065855
983 Ga0070663_100509490
984 Ga0070663_100571243
985 Ga0070678_100004224
986 Ga0070678_100009114
987 Ga0070678_100063425
988 Ga0070678_100119549
989 Ga0070662_100005197
990 Ga0070662_100018155
991 Ga0070662_100072350
992 Ga0070662_100318324
993 Ga0070662_100497510
994 Ga0070662_100871747
995 Ga0070681_10080063
996 Ga0070681_10284714
997 Ga0070681_10296169
998 Ga0068867_100002035
999 Ga0068867_100020963
1000 Ga0070685_10278927
1001 Ga0070685_10697814
1002 Ga0070706_100254739
1003 Ga0070679_100077172
1004 Ga0070679_100088147
1005 Ga0070679_100144448
1006 Ga0070679_100362113
1007 Ga0070679_100370709
1008 Ga0070679_100433735
1009 Ga0070679_100829557
1010 Ga0070684_100101991
1011 Ga0070684_100152215
1012 Ga0070684_100210151
1013 Ga0068853_100010905
1014 Ga0068853_100079727
1015 Ga0068853_100099466
1016 Ga0068853_100144427
1017 Ga0068853_100147081
1018 Ga0068853_100175357
1019 Ga0068853_101495863
1020 Ga0070672_100016213
1021 Ga0070672_100099437
1022 Ga0070672_100448923
1023 Ga0070686_100036653
1024 Ga0070696_100017065
1025 Ga0070693_100040100
1026 Ga0070693_100073186
1027 Ga0070693_100521509
1028 Ga0070665_100006320
1029 Ga0070665_100053630
1030 Ga0070665_100064471
1031 Ga0068855_100048667
1032 Ga0068855_100050120
1033 Ga0068855_100111070
1034 Ga0068855_100207682
1035 Ga0068855_100208992
1036 Ga0068855_100243286
1037 Ga0068855_100267980
1038 Ga0068855_101095760
1039 Ga0070664_100021210
1040 Ga0070664_100105909
1041 Ga0070664_100114810
1042 Ga0070664_100203269
1043 Ga0070664_100441537
1044 Ga0070664_101170914
1045 Ga0070664_101786668
1046 Ga0068857_100019007
1047 Ga0068857_100023828
1048 Ga0068857_100062570
1049 Ga0068857_100482680
1050 Ga0068857_101037990
1051 Ga0068854_100031274
1052 Ga0068854_100092871
1053 Ga0068854_100154935
1054 Ga0068854_100187654
1055 Ga0068854_100212190
1056 Ga0068854_100508400
1057 Ga0068854_101438166
1058 Ga0068854_101662933
1059 Ga0068856_100051981
1060 Ga0068856_100098357
1061 Ga0068856_100144207
1062 Ga0068856_100172945
1063 Ga0068856_100629053
1064 Ga0068856_100796554
1065 Ga0068856_100848773
1066 Ga0068856_101075420
1067 Ga0068856_101339043
1068 Ga0068856_101346078
1069 Ga0068856_101928691
1070 Ga0070702_100975996
1071 Ga0068852_100001069
1072 Ga0068852_100016289
1073 Ga0068852_100021969
1074 Ga0068852_100076960
1075 Ga0068852_100098987
1076 Ga0068852_100172565
1077 Ga0068852_100187189
1078 Ga0068852_100189039
1079 Ga0068852_100403049
1080 Ga0068852_100571183
1081 Ga0068852_100909462
1082 Ga0068859_100028161
1083 Ga0068859_100048003
1084 Ga0068859_100573868
1085 Ga0068864_100155118
1086 Ga0068864_100197960
1087 Ga0068864_100486578
1088 Ga0068866_10048109
1089 Ga0068866_10050117
1090 Ga0068861_100211480
1091 Ga0068861_100370429
1092 Ga0068861_100815273
1093 Ga0068851_10008929
1094 Ga0068851_10030743
1095 Ga0068851_10039813
1096 Ga0068851_10197961
1097 Ga0068870_10068941
1098 Ga0068870_10283983
1099 Ga0068870_10346497
1100 Ga0068863_100005224
1101 Ga0068863_100005699
1102 Ga0068863_100037268
1103 Ga0068863_100365270
1104 Ga0068863_100916996
1105 Ga0068858_100164300
1106 Ga0068858_100232956
1107 Ga0068858_101050915
1108 Ga0068860_100028404
1109 Ga0068860_100192759
1110 Ga0068860_100295886
1111 Ga0068860_100554667
1112 Ga0068862_100012521
1113 Ga0068862_100034938
1114 Ga0068862_100344161
1115 Ga0068862_100880869
1116 Ga0070717_10320000
1117 Ga0070715_10790453
1118 Ga0070716_100114965
1119 Ga0070712_100055548
1120 Ga0075366_10136992
1121 Ga0097621_100013004
1122 Ga0097621_100362425
1123 Ga0068871_100013255
1124 Ga0068871_100023199
1125 Ga0075429_100952659
1126 Ga0068865_100364330
1127 Ga0097620_100028158
1128 Ga0097620_100048003
1129 Ga0097620_100573783
1130 Ga0105240_10056083
1131 Ga0105240_10211090
1132 Ga0105240_10224311
1133 Ga0111539_13473188
1134 Ga0105245_10037973
1135 Ga0105245_10065426
1136 Ga0114129_10672017
1137 Ga0105243_10012496
1138 Ga0105243_10064552
1139 Ga0105243_10210720
1140 Ga0105241_10154098
1141 Ga0105241_10349370
1142 Ga0105241_11204122
1143 Ga0105242_10054494
1144 Ga0105242_10324709
1145 Ga0105242_11410618
1146 Ga0105248_10085838
1147 Ga0105248_10149205
1148 Ga0105248_10589610
1149 Ga0105248_11494295
1150 Ga0105237_10029154
1151 Ga0105238_10016800
1152 Ga0105238_10070567
1153 Ga0105238_10324055
1154 Ga0105238_10457204
1155 Ga0105238_10556030
1156 Ga0105238_10658903
1157 Ga0105238_11398598
1158 Ga0105249_10651164
1159 Ga0105249_12503674
1160 Ga0105239_10081790
1161 Ga0105239_10083657
1162 Ga0105239_11762993
1163 Ga0105246_10053188
1164 Ga0105246_10542597
1165 Ga0157373_10012135
1166 Ga0157373_10012753
1167 Ga0157373_10068364
1168 Ga0157373_10083663
1169 Ga0157373_10137199
1170 Ga0157373_10158947
1171 Ga0157373_10256689
1172 Ga0157373_10471548
1173 Ga0157373_11240516
1174 Ga0157373_11515958
1175 Ga0157371_10015031
1176 Ga0157371_10020854
1177 Ga0157371_10038044
1178 Ga0157371_10060879
1179 Ga0157371_10065257
1180 Ga0157371_10073976
1181 Ga0157371_10094710
1182 Ga0157371_10119389
1183 Ga0157371_10163424
1184 Ga0157371_10279714
1185 Ga0157371_10368839
1186 Ga0157371_11335813
1187 Ga0157370_10048284
1188 Ga0157370_10048564
1189 Ga0157370_10065056
1190 Ga0157370_10086927
1191 Ga0157370_10089261
1192 Ga0157370_10139727
1193 Ga0157370_10577613
1194 Ga0157369_10007383
1195 Ga0157369_10031051
1196 Ga0157369_10067972
1197 Ga0157369_10125164
1198 Ga0157369_10132459
1199 Ga0157369_10135588
1200 Ga0157369_10208604
1201 Ga0157369_10213157
1202 Ga0157369_10472729
1203 Ga0157369_10610836
1204 Ga0157369_10649490
1205 Ga0157369_12073942
1206 Ga0157369_12556255
1207 Ga0157374_10050975
1208 Ga0157374_10079406
1209 Ga0157374_10107964
1210 Ga0157374_10464772
1211 Ga0157374_10564921
1212 Ga0157374_10987084
1213 Ga0157374_11503172
1214 Ga0157378_10021644
1215 Ga0157378_10033817
1216 Ga0163162_10056100
1217 Ga0163162_10161503
1218 Ga0157372_10008752
1219 Ga0157372_10065325
1220 Ga0157372_10185390
1221 Ga0157372_10988526
1222 Ga0157372_11740037
1223 Ga0157375_10016314
1224 Ga0157375_10027659
1225 Ga0157375_10312787
1226 Ga0157375_11810632
1227 Ga0163163_10237948
1228 Ga0163163_10405083
1229 Ga0157380_10527351
1230 Ga0157377_10056992
1231 Ga0157377_10201160
1232 Ga0157379_11281722
1233 Ga0157376_10185201
1234 Ga0157376_10492334
1235 Ga0157376_10717075
1236 Ga0163161_10571810
1237 Ga0206354_11586023
1238 Ga0206353_10738842
1239 Ga0207697_10011008
1240 Ga0207697_10034325
1241 Ga0207697_10066762
1242 Ga0207697_10155131
1243 Ga0207656_10025165
1244 Ga0207656_10275334
1245 Ga0207656_10331235
1246 Ga0207656_10540296
1247 Ga0207682_10001342
1248 Ga0207642_10086534
1249 Ga0207710_10057212
1250 Ga0207688_10009382
1251 Ga0207688_10265839
1252 Ga0207688_10337600
1253 Ga0207688_10734798
1254 Ga0207680_10003327
1255 Ga0207680_10007066
1256 Ga0207680_10630441
1257 Ga0207647_10019866
1258 Ga0207647_10038542
1259 Ga0207647_10073031
1260 Ga0207647_10219558
1261 Ga0207685_10519340
1262 Ga0207699_10008885
1263 Ga0207645_10002319
1264 Ga0207645_10015407
1265 Ga0207645_10106104
1266 Ga0207645_10265082
1267 Ga0207643_10072411
1268 Ga0207643_10150036
1269 Ga0207705_10021914
1270 Ga0207705_10033619
1271 Ga0207705_10080315
1272 Ga0207705_10103966
1273 Ga0207705_10111793
1274 Ga0207705_10138049
1275 Ga0207705_10166359
1276 Ga0207705_10482361
1277 Ga0207684_10159692
1278 Ga0207654_10598661
1279 Ga0207654_10848306
1280 Ga0207707_10051960
1281 Ga0207707_10129047
1282 Ga0207707_10172177
1283 Ga0207707_10287192
1284 Ga0207707_10419268
1285 Ga0207707_10423305
1286 Ga0207695_10039931
1287 Ga0207695_10115246
1288 Ga0207695_10543926
1289 Ga0207671_10489321
1290 Ga0207660_10000059
1291 Ga0207660_10001202
1292 Ga0207660_10009838
1293 Ga0207660_10078092
1294 Ga0207660_10537099
1295 Ga0207662_10023202
1296 Ga0207657_10012830
1297 Ga0207657_10014934
1298 Ga0207657_10029689
1299 Ga0207657_10031052
1300 Ga0207657_10034236
1301 Ga0207657_10036827
1302 Ga0207657_10093145
1303 Ga0207657_10145426
1304 Ga0207657_10725073
1305 Ga0207657_10736022
1306 Ga0207657_11313120
1307 Ga0207649_10027742
1308 Ga0207649_10044044
1309 Ga0207649_10107540
1310 Ga0207649_10125061
1311 Ga0207649_10343523
1312 Ga0207649_10565012
1313 Ga0207649_10840692
1314 Ga0207649_10857960
1315 Ga0207652_10018990
1316 Ga0207652_10124163
1317 Ga0207652_10276410
1318 Ga0207652_10706897
1319 Ga0207652_11193810
1320 Ga0207681_10008022
1321 Ga0207681_10031395
1322 Ga0207681_10830529
1323 Ga0207694_10000966
1324 Ga0207694_10330707
1325 Ga0207694_10594715
1326 Ga0207694_11594506
1327 Ga0207650_10004781
1328 Ga0207650_10019021
1329 Ga0207650_10075522
1330 Ga0207659_10196454
1331 Ga0207687_10107523
1332 Ga0207687_10160373
1333 Ga0207687_10169601
1334 Ga0207700_10115712
1335 Ga0207700_10258425
1336 Ga0207700_10462894
1337 Ga0207664_10013598
1338 Ga0207664_10016311
1339 Ga0207664_10023570
1340 Ga0207664_10116219
1341 Ga0207664_10125235
1342 Ga0207664_10609540
1343 Ga0207644_10000142
1344 Ga0207644_10554064
1345 Ga0207690_10002953
1346 Ga0207690_10046793
1347 Ga0207690_10088152
1348 Ga0207690_10125542
1349 Ga0207690_10269397
1350 Ga0207690_10299348
1351 Ga0207690_10429579
1352 Ga0207690_10447098
1353 Ga0207690_10472911
1354 Ga0207706_10005721
1355 Ga0207706_10019092
1356 Ga0207706_10037307
1357 Ga0207706_10086882
1358 Ga0207706_10145933
1359 Ga0207706_10451867
1360 Ga0207686_10301444
1361 Ga0207709_10572962
1362 Ga0207709_10705767
1363 Ga0207669_10018773
1364 Ga0207669_10065902
1365 Ga0207704_10016287
1366 Ga0207665_10100078
1367 Ga0207691_10006169
1368 Ga0207691_10024129
1369 Ga0207691_10043385
1370 Ga0207691_10044757
1371 Ga0207691_11592727
1372 Ga0207711_10029289
1373 Ga0207711_10171135
1374 Ga0207711_10350779
1375 Ga0207711_10386494
1376 Ga0207711_10798801
1377 Ga0207689_10012587
1378 Ga0207689_10047729
1379 Ga0207661_10071102
1380 Ga0207661_10085121
1381 Ga0207661_10231631
1382 Ga0207679_10016598
1383 Ga0207679_10107503
1384 Ga0207679_10314524
1385 Ga0207679_10318756
1386 Ga0207679_11253184
1387 Ga0207667_10005262
1388 Ga0207667_10029624
1389 Ga0207667_10039670
1390 Ga0207667_10040206
1391 Ga0207667_10098120
1392 Ga0207667_10338450
1393 Ga0207667_11101816
1394 Ga0207651_10005732
1395 Ga0207651_10010290
1396 Ga0207651_10426995
1397 Ga0207651_10973357
1398 Ga0207712_10510139
1399 Ga0207668_10018267
1400 Ga0207668_10261158
1401 Ga0207668_10368207
1402 Ga0207640_10062397
1403 Ga0207640_10067242
1404 Ga0207640_10100206
1405 Ga0207640_10244932
1406 Ga0207640_10264000
1407 Ga0207640_10339783
1408 Ga0207640_10471741
1409 Ga0207640_11193247
1410 Ga0207658_10027405
1411 Ga0207658_10920118
1412 Ga0207677_10005002
1413 Ga0207677_10077416
1414 Ga0207677_10298819
1415 Ga0207677_10955081
1416 Ga0207677_10982498
1417 Ga0207703_10241762
1418 Ga0207639_10000744
1419 Ga0207639_10154043
1420 Ga0207639_10276366
1421 Ga0207639_10836987
1422 Ga0207639_11020424
1423 Ga0207678_10008634
1424 Ga0207678_10010248
1425 Ga0207678_10032194
1426 Ga0207678_10058363
1427 Ga0207678_10067799
1428 Ga0207702_10043057
1429 Ga0207702_10150028
1430 Ga0207702_10153445
1431 Ga0207702_10176712
1432 Ga0207702_10204038
1433 Ga0207702_10271492
1434 Ga0207702_10501619
1435 Ga0207702_10698785
1436 Ga0207702_11014447
1437 Ga0207702_11247363
1438 Ga0207641_10006875
1439 Ga0207641_10025415
1440 Ga0207641_10067548
1441 Ga0207641_10170134
1442 Ga0207641_10856120
1443 Ga0207648_10002458
1444 Ga0207648_10011602
1445 Ga0207648_10019695
1446 Ga0207676_10097044
1447 Ga0207676_10348835
1448 Ga0207676_10674280
1449 Ga0207674_10000065
1450 Ga0207674_10002824
1451 Ga0207674_10003445
1452 Ga0207674_10014766
1453 Ga0207674_10235128
1454 Ga0207674_10434534
1455 Ga0207674_11208187
1456 Ga0207675_100036554
1457 Ga0207675_100147162
1458 Ga0207675_100340165
1459 Ga0207683_10002271
1460 Ga0207683_10013861
1461 Ga0207683_10025083
1462 Ga0207683_10026610
1463 Ga0207698_10003907
1464 Ga0207698_10011411
1465 Ga0207698_10011695
1466 Ga0207698_10036738
1467 Ga0207698_10079985
1468 Ga0207698_10093067
1469 Ga0207698_10223892
1470 Ga0207698_10545829
1471 Ga0207698_10606264
1472 Ga0207698_10683636
1473 Ga0207698_11053160
1474 Ga0268266_10045835
1475 Ga0268266_10057167
1476 Ga0268265_10077818
1477 Ga0268265_10092192
1478 Ga0268265_10169604
1479 Ga0268264_10020803
1480 Ga0268264_10106161
1481 Ga0307413_10638425
1482 Ga0307407_10149918
1483 Ga0307409_100115233
1484 Ga0307409_102729320
1485 Ga0307414_10438030
1486 Ga0307411_10037200
1487 Ga0373948_0152515
1488 Ga0373938_0199973
1489 Ga0373952_0160837
1490 Ga0373952_0290951
1491 Ga0373960_0069579
1492 Ga0373943_0011671
1493 Ga0373946_0011556
1494 Ga0373942_0099976
1495 Ga0373931_0051628
1496 Ga0373931_0784072
1497 Ga0373935_0006536
1498 Ga0373935_0020199
1499 Ga0373927_0022086
1500 Ga0373947_0006264
1501 Ga0373937_1473378
1502 Ga0373937_1474027
1503 Ga0373925_0249024
1504 Ga0395899_0000113
1505 Ga0395899_0006469
1506 Ga0395899_0013449
1507 Ga0395899_0019176
1508 Ga0395899_0020590
1509 Ga0395899_0060907
1510 Ga0395899_0063573
1511 Ga0395899_0066680
1512 Ga0395899_0100246
1513 Ga0395899_0106552
1514 Ga0395899_0109688
1515 Ga0395899_0284882
1516 Ga0395899_0959713
1517 Ga0395900_0000365
1518 Ga0395900_0000964
1519 Ga0395900_0008087
1520 Ga0395900_0011278
1521 Ga0395900_0013562
1522 Ga0395900_0023762
1523 Ga0395900_0024613
1524 Ga0395900_0056333
1525 Ga0395900_0069852
1526 Ga0395900_0086813
1527 Ga0395900_0091354
1528 Ga0395900_0093890
1529 Ga0395900_0158283
1530 Ga0395900_0167586
1531 Ga0395900_0198808
1532 Ga0395900_0252090
1533 Ga0395900_0353100
1534 Ga0395900_0513194
1535 Ga0395900_0692766
1536 Ga0395900_1335932
1537 Ga0395900_1458714
1538 Ga0395898_0000306
1539 Ga0395898_0008363
1540 Ga0395898_0022122
1541 Ga0395898_0038340
1542 Ga0395898_0049745
1543 Ga0395898_0088936
1544 Ga0395898_0247782
1545 Ga0395898_0256801
1546 Ga0395898_0281130
1547 Ga0395898_0329735
1548 Ga0395898_0476492
1549 Ga0395898_0746893
1550 Ga0395898_0919109
1551 Ga0395898_1290038
1552 Ga0395898_1292840
1553 Ga0395905_0000005
1554 Ga0395905_0002956
1555 Ga0395905_0009966
1556 Ga0395905_0011079
1557 Ga0395905_0016924
1558 Ga0395905_0019166
1559 Ga0395905_0021922
1560 Ga0395905_0026212
1561 Ga0395905_0026426
1562 Ga0395905_0032743
1563 Ga0395905_0039456
1564 Ga0395905_0058925
1565 Ga0395905_0059475
1566 Ga0395905_0088779
1567 Ga0395905_0131320
1568 Ga0395905_0153323
1569 Ga0395905_0200174
1570 Ga0395905_0231601
1571 Ga0395905_0399924
1572 Ga0395905_0968691
1573 Ga0395905_0997386
1574 Ga0395905_1230778
1575 Ga0395905_1618297
1576 Ga0395905_1786056
1577 Ga0395901_0000248
1578 Ga0395901_0001201
1579 Ga0395901_0005488
1580 Ga0395901_0012068
1581 Ga0395901_0020064
1582 Ga0395901_0033619
1583 Ga0395901_0036467
1584 Ga0395901_0037974
1585 Ga0395901_0053500
1586 Ga0395901_0071571
1587 Ga0395901_0112322
1588 Ga0395901_0188653
1589 Ga0395901_0221755
1590 Ga0395901_0230144
1591 Ga0395901_0232464
1592 Ga0395901_0264959
1593 Ga0395901_0266208
1594 Ga0395901_0320938
1595 Ga0395901_0368635
1596 Ga0395901_0963436
1597 Ga0395901_1348648
1598 Ga0395901_1584638
1599 Ga0395901_1585893
1600 Ga0395901_1695383
1601 Ga0450905_000308
1602 Ga0450889_000193
1603 Ga0439464_0000878
1604 Ga0450916_011021
1605 Ga0466969_0053432
1606 Ga0466969_0236065
1607 Ga0466972_0013931
1608 Ga0466972_0333981
1609 Ga0466965_0146056
1610 Ga0466966_0014830
1611 Ga0466966_0115883
1612 Ga0466966_0206842
1613 Ga0466966_0379329
1614 Ga0466966_0535935
1615 Ga0466961_0019333
1616 Ga0466961_0067398
1617 Ga0466961_0071576
1618 Ga0466963_0011010
1619 Ga0466963_0026975
1620 Ga0466963_0073469
1621 Ga0466963_0106910
1622 Ga0466963_0109725
1623 Ga0466963_0200529
1624 Ga0466963_0312157
1625 Ga0466963_1223523
1626 Ga0466964_0012076
1627 Ga0466971_0008654
1628 Ga0466968_0014457
1629 Ga0466970_0042966
1630 Ga0466957_0010249
1631 Ga0466957_0010341
1632 Ga0466957_0086722
1633 Ga0466957_0147311
1634 Ga0466957_0388337
1635 Ga0466960_0024453
1636 Ga0466959_0015101
1637 Ga0466959_0129688
1638 Ga0466959_0992697
1639 Ga0466958_0004622
1640 Ga0466958_0032876
1641 Ga0466958_0094076
1642 Ga0466958_0160209
1643 Ga0466967_0031731
1644 Ga0466967_0048036
1645 Ga0466967_0059029
1646 Ga0466967_0077920
1647 Ga0466967_0092983
1648 Ga0466967_0107463
1649 Ga0466967_0115004
1650 Ga0466967_0142167
1651 Ga0466967_0142274
1652 Ga0466967_0160602
1653 Ga0466967_0182596
1654 Ga0466967_0418201
1655 Ga0466967_0476505
1656 Ga0466967_0570544
1657 Ga0466967_0824391
1658 Ga0466967_0857472
1659 Ga0495643_0148301
1660 Ga0495663_0259036
1661 Ga0495586_0575452
1662 Ga0495587_0666300
1663 Ga0495621_0000060
1664 Ga0495633_0027524
1665 Ga0495659_0023971
1666 Ga0495669_0027423
1667 Ga0495669_0162582
1668 Ga0495670_0000649
1669 Ga0496100_0001630
1670 Ga0496101_0002764
1671 Ga0496101_0113492
1672 Ga0496102_0029658
1673 Ga0496103_0059996
1674 Ga0496104_0025877
1675 Ga0496105_0116908
1676 Ga0496106_0019173
1677 Ga0496107_0000863
1678 Ga0496107_0221134
1679 Ga0496107_0633147
1680 Ga0496108_0000954
1681 Ga0496109_0008004
1682 Ga0496109_0349477
1683 Ga0496109_1069929
1684 Ga0496110_0000754
1685 Ga0496110_0058166
1686 Ga0496111_0000069
1687 Ga0496111_0183123
1688 Ga0496112_0004068
1689 Ga0496112_0005549
1690 Ga0496112_0112500
1691 Ga0496112_0395488
1692 Ga0496112_0475481
1693 Ga0496112_1179228
1694 Ga0496113_0007460
1695 Ga0496113_0007666
1696 Ga0501047_0775060
1697 Ga0501068_0022903
1698 Ga0501068_0091248
1699 Ga0501079_0600648
1700 Ga0501080_0041798
1701 Ga0501044_0805947
1702 nmdc:mga0k408_110604_c1
1703 nmdc:mga05p37_867572_c1
1704 nmdc:mga09592_133478_c1
1705 Ga0466962_0007173
1706 Ga0466962_0048447
1707 Ga0466962_0424683
1708 Ga0530510_0235793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

37

129

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r4i-assembly1.cif.gz_B crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution 0.8834 7 123
3fsd-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution 0.8788 9 124
3ksp-assembly1.cif.gz_A-2 crystal structure of a putative ca/calmodulin-dependent kinase ii association domain (exig_1688) from exiguobacterium sibiricum 255-15 at 2.59 a resolution 0.8693 9 125
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.8683 9 124
2r4i-assembly1.cif.gz_B crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution 0.8493 7 123
ID Description Score Start End Superfamily
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.888 7 123 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8665 9 124 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8603 7 123 3.10.450.50
3fkaD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8376 9 120 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8331 9 124 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7G9SJQ5-F1-model_v4 Nuclear transport factor 2 family protein 0.9826 1 126
AF-A0A7G9SJQ5-F1-model_v4 Nuclear transport factor 2 family protein 0.9384 1 126
AF-A0A6G7ZIC2-F1-model_v4 Nuclear transport factor 2 family protein 0.9308 9 126
AF-A0A3B9LGS6-F1-model_v4 DUF4440 domain-containing protein 0.9126 7 125
AF-A0A2V9YTV2-F1-model_v4 DUF4440 domain-containing protein 0.9107 5 127

Map