F483576
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 854 | 358 | 1708 | 81 |
Family's Representative Sequence
| Representative Sequence | 3300005546|Ga0070696_101037434|Ga0070696_1010374342 |
| Length | 90 |
| Sequence | MAQRPDDTESMEGIFIDIEVSAAIADDAEMAAKLEEVCPVDIFDVREGDGSVAINRENLDECVLCNLCVEAAPPGGVVVKKLYDGTELRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 108 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 208 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 209 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 210 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 211 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 212 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 213 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 214 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 335 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 347 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 352 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 355 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 356 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.11 |
| Nodule | 0 |
| Rhizoplane | 8.31 |
| Rhizosphere | 83.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070696_101037434 | 3300005546 | Bacteria | 687 |
| 2 | JGI24746J21847_1000100 | 3300001977 | Bacteria | 9779 |
| 3 | JGI24740J21852_10026088 | 3300001979 | Bacteria | 1961 |
| 4 | JGI25407J50210_10026922 | 3300003373 | Bacteria | 1491 |
| 5 | Ga0058860_11913064 | 3300004801 | Bacteria | 1180 |
| 6 | Ga0070658_10096516 | 3300005327 | Bacteria | 2440 |
| 7 | Ga0070683_100013452 | 3300005329 | Bacteria | 7136 |
| 8 | Ga0070683_100018313 | 3300005329 | Bacteria | 6200 |
| 9 | Ga0070683_100097877 | 3300005329 | Bacteria | 2760 |
| 10 | Ga0070683_100529723 | 3300005329 | Bacteria | 1126 |
| 11 | Ga0070683_101194638 | 3300005329 | Bacteria | 731 |
| 12 | Ga0070683_101290749 | 3300005329 | Bacteria | 702 |
| 13 | Ga0070670_100071744 | 3300005331 | Bacteria | 2974 |
| 14 | Ga0070677_10000620 | 3300005333 | Bacteria | 11947 |
| 15 | Ga0070666_10021476 | 3300005335 | Bacteria | 4185 |
| 16 | Ga0070666_10024284 | 3300005335 | Bacteria | 3947 |
| 17 | Ga0070666_10182897 | 3300005335 | Bacteria | 1471 |
| 18 | Ga0070682_100000013 | 3300005337 | Bacteria | 254641 |
| 19 | Ga0070682_100000117 | 3300005337 | Bacteria | 69662 |
| 20 | Ga0070682_100230344 | 3300005337 | Bacteria | 1324 |
| 21 | Ga0070660_100856029 | 3300005339 | Bacteria | 766 |
| 22 | Ga0070689_100225577 | 3300005340 | Bacteria | 1538 |
| 23 | Ga0070691_10000344 | 3300005341 | Bacteria | 16531 |
| 24 | Ga0070661_100001375 | 3300005344 | Bacteria | 16996 |
| 25 | Ga0070692_10076888 | 3300005345 | Bacteria | 1790 |
| 26 | Ga0070668_100046204 | 3300005347 | Bacteria | 3342 |
| 27 | Ga0070668_100384052 | 3300005347 | Bacteria | 1196 |
| 28 | Ga0070669_100847803 | 3300005353 | Bacteria | 779 |
| 29 | Ga0070675_100000111 | 3300005354 | Bacteria | 47699 |
| 30 | Ga0070674_100436769 | 3300005356 | Bacteria | 1077 |
| 31 | Ga0070688_100003353 | 3300005365 | Bacteria | 8214 |
| 32 | Ga0070688_100031251 | 3300005365 | Bacteria | 3202 |
| 33 | Ga0070659_100064556 | 3300005366 | Bacteria | 2898 |
| 34 | Ga0070659_100081482 | 3300005366 | Bacteria | 2585 |
| 35 | Ga0070667_100019394 | 3300005367 | Bacteria | 5642 |
| 36 | Ga0070667_100420744 | 3300005367 | Bacteria | 1218 |
| 37 | Ga0070667_100473010 | 3300005367 | Bacteria | 1147 |
| 38 | Ga0070667_100717556 | 3300005367 | Bacteria | 926 |
| 39 | Ga0070667_101056363 | 3300005367 | Bacteria | 758 |
| 40 | Ga0070714_100369857 | 3300005435 | Bacteria | 1349 |
| 41 | Ga0070714_101403465 | 3300005435 | Unclassified | 682 |
| 42 | Ga0070713_100000390 | 3300005436 | Bacteria | 28149 |
| 43 | Ga0070713_100076960 | 3300005436 | Bacteria | 2835 |
| 44 | Ga0070701_10798054 | 3300005438 | Bacteria | 644 |
| 45 | Ga0070711_100002341 | 3300005439 | Bacteria | 10769 |
| 46 | Ga0070711_100079580 | 3300005439 | Bacteria | 2331 |
| 47 | Ga0070711_100342071 | 3300005439 | Unclassified | 1200 |
| 48 | Ga0070711_101991869 | 3300005439 | Bacteria | 511 |
| 49 | Ga0070700_101004836 | 3300005441 | Unclassified | 686 |
| 50 | Ga0070700_101296323 | 3300005441 | Bacteria | 612 |
| 51 | Ga0070694_101211204 | 3300005444 | Bacteria | 633 |
| 52 | Ga0070708_101006087 | 3300005445 | Bacteria | 782 |
| 53 | Ga0070663_100000728 | 3300005455 | Bacteria | 17736 |
| 54 | Ga0070663_100450556 | 3300005455 | Bacteria | 1061 |
| 55 | Ga0070663_100559632 | 3300005455 | Bacteria | 957 |
| 56 | Ga0070663_101181470 | 3300005455 | Bacteria | 672 |
| 57 | Ga0070678_100230631 | 3300005456 | Bacteria | 1543 |
| 58 | Ga0070678_100675274 | 3300005456 | Bacteria | 929 |
| 59 | Ga0070681_10010667 | 3300005458 | Bacteria | 9081 |
| 60 | Ga0070681_10195528 | 3300005458 | Bacteria | 1941 |
| 61 | Ga0070685_10004176 | 3300005466 | Bacteria | 7284 |
| 62 | Ga0070685_10014878 | 3300005466 | Bacteria | 4127 |
| 63 | Ga0070706_101024855 | 3300005467 | Bacteria | 761 |
| 64 | Ga0070707_100721365 | 3300005468 | Bacteria | 960 |
| 65 | Ga0070679_100000068 | 3300005530 | Bacteria | 77184 |
| 66 | Ga0070679_100007698 | 3300005530 | Bacteria | 10085 |
| 67 | Ga0070684_100003702 | 3300005535 | Bacteria | 11535 |
| 68 | Ga0070684_100053567 | 3300005535 | Bacteria | 3513 |
| 69 | Ga0070684_100082890 | 3300005535 | Bacteria | 2841 |
| 70 | Ga0070684_100564524 | 3300005535 | Bacteria | 1057 |
| 71 | Ga0070684_100862732 | 3300005535 | Bacteria | 847 |
| 72 | Ga0070684_102205542 | 3300005535 | Bacteria | 520 |
| 73 | Ga0070697_100811940 | 3300005536 | Bacteria | 828 |
| 74 | Ga0068853_100044951 | 3300005539 | Bacteria | 3782 |
| 75 | Ga0068853_100082050 | 3300005539 | Bacteria | 2824 |
| 76 | Ga0070672_100000015 | 3300005543 | Bacteria | 72591 |
| 77 | Ga0070672_101251265 | 3300005543 | Bacteria | 662 |
| 78 | Ga0070696_101221178 | 3300005546 | Bacteria | 636 |
| 79 | Ga0070696_101693585 | 3300005546 | Bacteria | 545 |
| 80 | Ga0070693_100898613 | 3300005547 | Bacteria | 663 |
| 81 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 82 | Ga0070665_100040036 | 3300005548 | Bacteria | 4711 |
| 83 | Ga0070665_100047803 | 3300005548 | Bacteria | 4294 |
| 84 | Ga0070665_100460600 | 3300005548 | Bacteria | 1282 |
| 85 | Ga0070704_100094245 | 3300005549 | Bacteria | 2240 |
| 86 | Ga0070704_100663332 | 3300005549 | Bacteria | 922 |
| 87 | Ga0070704_100791172 | 3300005549 | Bacteria | 847 |
| 88 | Ga0070704_101943735 | 3300005549 | Bacteria | 545 |
| 89 | Ga0068855_100124857 | 3300005563 | Bacteria | 2944 |
| 90 | Ga0068855_100656674 | 3300005563 | Bacteria | 1126 |
| 91 | Ga0068855_101740796 | 3300005563 | Bacteria | 635 |
| 92 | Ga0070664_100183538 | 3300005564 | Bacteria | 1861 |
| 93 | Ga0070664_101095459 | 3300005564 | Bacteria | 750 |
| 94 | Ga0068857_100156475 | 3300005577 | Bacteria | 2067 |
| 95 | Ga0068854_100000183 | 3300005578 | Bacteria | 42525 |
| 96 | Ga0068854_100042340 | 3300005578 | Bacteria | 3223 |
| 97 | Ga0068854_101593829 | 3300005578 | Bacteria | 595 |
| 98 | Ga0068856_100022587 | 3300005614 | Bacteria | 6116 |
| 99 | Ga0068856_100030339 | 3300005614 | Bacteria | 5285 |
| 100 | Ga0070702_100187618 | 3300005615 | Bacteria | 1358 |
| 101 | Ga0070702_101671809 | 3300005615 | Bacteria | 528 |
| 102 | Ga0068852_100000093 | 3300005616 | Bacteria | 60834 |
| 103 | Ga0068852_100963039 | 3300005616 | Bacteria | 872 |
| 104 | Ga0068852_102670860 | 3300005616 | Bacteria | 519 |
| 105 | Ga0068866_10171194 | 3300005718 | Bacteria | 1275 |
| 106 | Ga0068861_100032704 | 3300005719 | Bacteria | 3832 |
| 107 | Ga0068851_10028087 | 3300005834 | Bacteria | 2777 |
| 108 | Ga0068863_100006700 | 3300005841 | Bacteria | 11301 |
| 109 | Ga0068863_100019353 | 3300005841 | Bacteria | 6512 |
| 110 | Ga0068858_100000009 | 3300005842 | Bacteria | 237748 |
| 111 | Ga0081455_10045239 | 3300005937 | Bacteria | 3831 |
| 112 | Ga0081455_10121379 | 3300005937 | Bacteria | 2059 |
| 113 | Ga0081455_10136300 | 3300005937 | Bacteria | 1912 |
| 114 | Ga0081455_10215081 | 3300005937 | Bacteria | 1429 |
| 115 | Ga0081538_10000097 | 3300005981 | Bacteria | 85125 |
| 116 | Ga0081538_10246795 | 3300005981 | Bacteria | 684 |
| 117 | Ga0081540_1014499 | 3300005983 | Bacteria | 5043 |
| 118 | Ga0081540_1091337 | 3300005983 | Bacteria | 1339 |
| 119 | Ga0081539_10143125 | 3300005985 | Bacteria | 1159 |
| 120 | Ga0075365_10155050 | 3300006038 | Bacteria | 1594 |
| 121 | Ga0075365_11043423 | 3300006038 | Bacteria | 576 |
| 122 | Ga0075368_10140279 | 3300006042 | Bacteria | 1007 |
| 123 | Ga0075368_10286339 | 3300006042 | Bacteria | 709 |
| 124 | Ga0075364_10277745 | 3300006051 | Bacteria | 1140 |
| 125 | Ga0075364_10559197 | 3300006051 | Bacteria | 782 |
| 126 | Ga0070716_100624117 | 3300006173 | Bacteria | 814 |
| 127 | Ga0070716_100676090 | 3300006173 | Bacteria | 786 |
| 128 | Ga0070712_100230412 | 3300006175 | Unclassified | 1471 |
| 129 | Ga0070712_100983131 | 3300006175 | Bacteria | 730 |
| 130 | Ga0097621_100695002 | 3300006237 | Unclassified | 936 |
| 131 | Ga0068871_100050353 | 3300006358 | Bacteria | 3369 |
| 132 | Ga0068871_101323746 | 3300006358 | Bacteria | 678 |
| 133 | Ga0068871_102383090 | 3300006358 | Bacteria | 505 |
| 134 | Ga0075428_100089317 | 3300006844 | Bacteria | 3361 |
| 135 | Ga0075428_100225192 | 3300006844 | Bacteria | 2024 |
| 136 | Ga0075428_102585298 | 3300006844 | Bacteria | 519 |
| 137 | Ga0075430_100025554 | 3300006846 | Bacteria | 5026 |
| 138 | Ga0075431_100002597 | 3300006847 | Bacteria | 17458 |
| 139 | Ga0075431_100011637 | 3300006847 | Bacteria | 8874 |
| 140 | Ga0075431_100132397 | 3300006847 | Bacteria | 2571 |
| 141 | Ga0075431_100463537 | 3300006847 | Bacteria | 1261 |
| 142 | Ga0075433_11517781 | 3300006852 | Bacteria | 579 |
| 143 | Ga0075434_100024708 | 3300006871 | Bacteria | 5876 |
| 144 | Ga0075434_102007283 | 3300006871 | Bacteria | 584 |
| 145 | Ga0075429_100233609 | 3300006880 | Bacteria | 1611 |
| 146 | Ga0068865_100001085 | 3300006881 | Bacteria | 15698 |
| 147 | Ga0068865_100634882 | 3300006881 | Bacteria | 906 |
| 148 | Ga0068865_100756905 | 3300006881 | Bacteria | 835 |
| 149 | Ga0075436_100999997 | 3300006914 | Bacteria | 628 |
| 150 | Ga0075435_100241696 | 3300007076 | Bacteria | 1536 |
| 151 | Ga0099794_10446346 | 3300007265 | Bacteria | 678 |
| 152 | Ga0105240_10556503 | 3300009093 | Bacteria | 1268 |
| 153 | Ga0105240_11899925 | 3300009093 | Bacteria | 619 |
| 154 | Ga0111539_10255438 | 3300009094 | Bacteria | 2041 |
| 155 | Ga0111539_10660301 | 3300009094 | Bacteria | 1217 |
| 156 | Ga0111539_11996364 | 3300009094 | Bacteria | 673 |
| 157 | Ga0111539_12210871 | 3300009094 | Bacteria | 638 |
| 158 | Ga0105245_10001150 | 3300009098 | Bacteria | 23924 |
| 159 | Ga0105245_10001895 | 3300009098 | Bacteria | 18997 |
| 160 | Ga0105245_10006500 | 3300009098 | Bacteria | 10270 |
| 161 | Ga0105245_10137771 | 3300009098 | Bacteria | 2295 |
| 162 | Ga0105245_10141124 | 3300009098 | Bacteria | 2269 |
| 163 | Ga0105245_12791580 | 3300009098 | Bacteria | 541 |
| 164 | Ga0105247_10000628 | 3300009101 | Bacteria | 28197 |
| 165 | Ga0105247_10209538 | 3300009101 | Bacteria | 1314 |
| 166 | Ga0105247_10286177 | 3300009101 | Unclassified | 1138 |
| 167 | Ga0105247_11619562 | 3300009101 | Unclassified | 532 |
| 168 | Ga0105247_11738989 | 3300009101 | Unclassified | 517 |
| 169 | Ga0114129_10082951 | 3300009147 | Bacteria | 4454 |
| 170 | Ga0114129_10231345 | 3300009147 | Bacteria | 2489 |
| 171 | Ga0114129_10743987 | 3300009147 | Bacteria | 1256 |
| 172 | Ga0114129_11648002 | 3300009147 | Bacteria | 784 |
| 173 | Ga0114129_12048868 | 3300009147 | Bacteria | 691 |
| 174 | Ga0114129_12586336 | 3300009147 | Bacteria | 606 |
| 175 | Ga0105243_10222191 | 3300009148 | Bacteria | 1670 |
| 176 | Ga0105241_11890639 | 3300009174 | Bacteria | 585 |
| 177 | Ga0105242_10002291 | 3300009176 | Bacteria | 15125 |
| 178 | Ga0105242_10002368 | 3300009176 | Bacteria | 14878 |
| 179 | Ga0105242_11327429 | 3300009176 | Bacteria | 744 |
| 180 | Ga0105242_11532152 | 3300009176 | Bacteria | 698 |
| 181 | Ga0105242_12419626 | 3300009176 | Bacteria | 573 |
| 182 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 183 | Ga0105248_12912780 | 3300009177 | Unclassified | 545 |
| 184 | Ga0105237_12569542 | 3300009545 | Unclassified | 520 |
| 185 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 186 | Ga0105238_11002085 | 3300009551 | Bacteria | 856 |
| 187 | Ga0105249_10000203 | 3300009553 | Bacteria | 67783 |
| 188 | Ga0105249_10146424 | 3300009553 | Bacteria | 2270 |
| 189 | Ga0105249_10429558 | 3300009553 | Bacteria | 1356 |
| 190 | Ga0105249_10580978 | 3300009553 | Bacteria | 1174 |
| 191 | Ga0105249_11780049 | 3300009553 | Bacteria | 689 |
| 192 | Ga0105239_10082846 | 3300010375 | Bacteria | 3532 |
| 193 | Ga0105239_10282146 | 3300010375 | Bacteria | 1870 |
| 194 | Ga0105239_10948264 | 3300010375 | Bacteria | 988 |
| 195 | Ga0105239_11079529 | 3300010375 | Bacteria | 924 |
| 196 | Ga0105239_12490731 | 3300010375 | Bacteria | 603 |
| 197 | Ga0105246_10424481 | 3300011119 | Bacteria | 1111 |
| 198 | Ga0157373_10695412 | 3300013100 | Bacteria | 745 |
| 199 | Ga0157371_10035878 | 3300013102 | Bacteria | 3552 |
| 200 | Ga0157371_10753955 | 3300013102 | Bacteria | 731 |
| 201 | Ga0157371_11336492 | 3300013102 | Bacteria | 555 |
| 202 | Ga0157370_10042255 | 3300013104 | Bacteria | 4394 |
| 203 | Ga0157370_10170974 | 3300013104 | Bacteria | 2020 |
| 204 | Ga0157370_10734257 | 3300013104 | Bacteria | 900 |
| 205 | Ga0157370_10756295 | 3300013104 | Bacteria | 885 |
| 206 | Ga0157369_10780165 | 3300013105 | Bacteria | 982 |
| 207 | Ga0157369_11451761 | 3300013105 | Bacteria | 698 |
| 208 | Ga0157374_10022748 | 3300013296 | Bacteria | 5596 |
| 209 | Ga0157374_10797340 | 3300013296 | Bacteria | 960 |
| 210 | Ga0157374_12381030 | 3300013296 | Bacteria | 557 |
| 211 | Ga0157378_10023161 | 3300013297 | Bacteria | 5466 |
| 212 | Ga0157378_10024233 | 3300013297 | Bacteria | 5337 |
| 213 | Ga0157378_10044147 | 3300013297 | Bacteria | 3957 |
| 214 | Ga0157378_10124098 | 3300013297 | Bacteria | 2384 |
| 215 | Ga0157378_11245106 | 3300013297 | Bacteria | 784 |
| 216 | Ga0157372_10001384 | 3300013307 | Bacteria | 26176 |
| 217 | Ga0157372_12502700 | 3300013307 | Bacteria | 593 |
| 218 | Ga0157375_10416509 | 3300013308 | Bacteria | 1510 |
| 219 | Ga0157375_11413114 | 3300013308 | Bacteria | 820 |
| 220 | Ga0157375_11760536 | 3300013308 | Bacteria | 734 |
| 221 | Ga0157375_11946718 | 3300013308 | Bacteria | 698 |
| 222 | Ga0157375_12650677 | 3300013308 | Unclassified | 599 |
| 223 | Ga0163163_10388792 | 3300014325 | Bacteria | 1453 |
| 224 | Ga0163163_10513059 | 3300014325 | Bacteria | 1261 |
| 225 | Ga0157380_10000253 | 3300014326 | Bacteria | 32008 |
| 226 | Ga0157380_10012178 | 3300014326 | Bacteria | 6231 |
| 227 | Ga0157380_12516360 | 3300014326 | Bacteria | 580 |
| 228 | Ga0157377_10861657 | 3300014745 | Bacteria | 674 |
| 229 | Ga0157379_10072565 | 3300014968 | Bacteria | 3080 |
| 230 | Ga0157379_10660883 | 3300014968 | Bacteria | 979 |
| 231 | Ga0157379_11168556 | 3300014968 | Bacteria | 739 |
| 232 | Ga0157376_10015687 | 3300014969 | Bacteria | 5730 |
| 233 | Ga0157376_10141147 | 3300014969 | Bacteria | 2161 |
| 234 | Ga0157376_11987518 | 3300014969 | Bacteria | 619 |
| 235 | Ga0163161_10000035 | 3300017792 | Bacteria | 155979 |
| 236 | Ga0163161_10239993 | 3300017792 | Bacteria | 1409 |
| 237 | Ga0154015_1268440 | 3300020610 | Bacteria | 693 |
| 238 | Ga0213873_10095258 | 3300021358 | Bacteria | 850 |
| 239 | Ga0213874_10021508 | 3300021377 | Bacteria | 1780 |
| 240 | Ga0213874_10060808 | 3300021377 | Bacteria | 1183 |
| 241 | Ga0213874_10097858 | 3300021377 | Bacteria | 972 |
| 242 | Ga0213876_10028058 | 3300021384 | Bacteria | 2968 |
| 243 | Ga0213876_10043186 | 3300021384 | Bacteria | 2383 |
| 244 | Ga0213876_10127026 | 3300021384 | Bacteria | 1354 |
| 245 | Ga0213875_10113524 | 3300021388 | Bacteria | 1266 |
| 246 | Ga0213875_10448132 | 3300021388 | Bacteria | 618 |
| 247 | Ga0207656_10014349 | 3300025321 | Bacteria | 3050 |
| 248 | Ga0207653_10023647 | 3300025885 | Bacteria | 1958 |
| 249 | Ga0207682_10001227 | 3300025893 | Bacteria | 11851 |
| 250 | Ga0207692_10218943 | 3300025898 | Bacteria | 1127 |
| 251 | Ga0207692_10231248 | 3300025898 | Bacteria | 1100 |
| 252 | Ga0207642_10082984 | 3300025899 | Bacteria | 1561 |
| 253 | Ga0207710_10000239 | 3300025900 | Bacteria | 46663 |
| 254 | Ga0207710_10077022 | 3300025900 | Bacteria | 1540 |
| 255 | Ga0207710_10201150 | 3300025900 | Bacteria | 984 |
| 256 | Ga0207710_10599375 | 3300025900 | Bacteria | 575 |
| 257 | Ga0207680_10015856 | 3300025903 | Bacteria | 3943 |
| 258 | Ga0207680_10016106 | 3300025903 | Bacteria | 3917 |
| 259 | Ga0207647_10320248 | 3300025904 | Bacteria | 881 |
| 260 | Ga0207699_10806234 | 3300025906 | Bacteria | 690 |
| 261 | Ga0207699_10816862 | 3300025906 | Unclassified | 686 |
| 262 | Ga0207643_10099817 | 3300025908 | Bacteria | 1701 |
| 263 | Ga0207705_10398904 | 3300025909 | Bacteria | 1064 |
| 264 | Ga0207654_10137478 | 3300025911 | Bacteria | 1554 |
| 265 | Ga0207707_10016440 | 3300025912 | Bacteria | 6453 |
| 266 | Ga0207707_11361582 | 3300025912 | Bacteria | 568 |
| 267 | Ga0207693_10038183 | 3300025915 | Bacteria | 3782 |
| 268 | Ga0207693_10176374 | 3300025915 | Bacteria | 1682 |
| 269 | Ga0207693_10740153 | 3300025915 | Bacteria | 760 |
| 270 | Ga0207663_10001197 | 3300025916 | Bacteria | 11982 |
| 271 | Ga0207663_10126645 | 3300025916 | Bacteria | 1758 |
| 272 | Ga0207663_10414441 | 3300025916 | Bacteria | 1033 |
| 273 | Ga0207663_10466144 | 3300025916 | Unclassified | 976 |
| 274 | Ga0207660_10091942 | 3300025917 | Bacteria | 2251 |
| 275 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 276 | Ga0207652_10000044 | 3300025921 | Bacteria | 127779 |
| 277 | Ga0207652_10000378 | 3300025921 | Bacteria | 46237 |
| 278 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 279 | Ga0207694_10740424 | 3300025924 | Bacteria | 830 |
| 280 | Ga0207650_10085403 | 3300025925 | Bacteria | 2401 |
| 281 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 282 | Ga0207687_10000013 | 3300025927 | Bacteria | 299826 |
| 283 | Ga0207687_10001023 | 3300025927 | Bacteria | 18981 |
| 284 | Ga0207687_10010273 | 3300025927 | Bacteria | 6116 |
| 285 | Ga0207687_10130977 | 3300025927 | Bacteria | 1890 |
| 286 | Ga0207700_10000027 | 3300025928 | Bacteria | 137708 |
| 287 | Ga0207700_10996931 | 3300025928 | Bacteria | 750 |
| 288 | Ga0207664_10528248 | 3300025929 | Bacteria | 1058 |
| 289 | Ga0207690_10046888 | 3300025932 | Bacteria | 2865 |
| 290 | Ga0207690_10081792 | 3300025932 | Bacteria | 2258 |
| 291 | Ga0207706_11663729 | 3300025933 | Unclassified | 515 |
| 292 | Ga0207686_10000048 | 3300025934 | Bacteria | 115595 |
| 293 | Ga0207686_10001182 | 3300025934 | Bacteria | 15101 |
| 294 | Ga0207686_10833005 | 3300025934 | Bacteria | 741 |
| 295 | Ga0207709_10007242 | 3300025935 | Bacteria | 6188 |
| 296 | Ga0207670_10126582 | 3300025936 | Bacteria | 1865 |
| 297 | Ga0207704_10000157 | 3300025938 | Bacteria | 36439 |
| 298 | Ga0207704_10265530 | 3300025938 | Bacteria | 1296 |
| 299 | Ga0207704_10463152 | 3300025938 | Bacteria | 1014 |
| 300 | Ga0207704_11711323 | 3300025938 | Bacteria | 541 |
| 301 | Ga0207665_10062535 | 3300025939 | Bacteria | 2526 |
| 302 | Ga0207665_10095576 | 3300025939 | Bacteria | 2065 |
| 303 | Ga0207665_10992819 | 3300025939 | Bacteria | 668 |
| 304 | Ga0207691_10000044 | 3300025940 | Bacteria | 100027 |
| 305 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 306 | Ga0207711_10822340 | 3300025941 | Bacteria | 865 |
| 307 | Ga0207711_11238715 | 3300025941 | Bacteria | 688 |
| 308 | Ga0207661_10003433 | 3300025944 | Bacteria | 10996 |
| 309 | Ga0207661_10065562 | 3300025944 | Bacteria | 2948 |
| 310 | Ga0207661_10073128 | 3300025944 | Bacteria | 2806 |
| 311 | Ga0207661_10113250 | 3300025944 | Bacteria | 2298 |
| 312 | Ga0207661_10139465 | 3300025944 | Bacteria | 2085 |
| 313 | Ga0207661_10911878 | 3300025944 | Bacteria | 809 |
| 314 | Ga0207679_10100465 | 3300025945 | Bacteria | 2261 |
| 315 | Ga0207679_10209709 | 3300025945 | Bacteria | 1633 |
| 316 | Ga0207667_10233850 | 3300025949 | Bacteria | 1881 |
| 317 | Ga0207667_10234816 | 3300025949 | Bacteria | 1877 |
| 318 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 319 | Ga0207712_10324630 | 3300025961 | Bacteria | 1271 |
| 320 | Ga0207712_10774708 | 3300025961 | Bacteria | 842 |
| 321 | Ga0207712_10956409 | 3300025961 | Bacteria | 759 |
| 322 | Ga0207668_10139436 | 3300025972 | Bacteria | 1862 |
| 323 | Ga0207668_10554347 | 3300025972 | Bacteria | 996 |
| 324 | Ga0207668_11142055 | 3300025972 | Bacteria | 699 |
| 325 | Ga0207640_10000200 | 3300025981 | Bacteria | 42738 |
| 326 | Ga0207640_10029132 | 3300025981 | Bacteria | 3384 |
| 327 | Ga0207658_10018315 | 3300025986 | Bacteria | 4835 |
| 328 | Ga0207658_10334450 | 3300025986 | Bacteria | 1315 |
| 329 | Ga0207658_10341840 | 3300025986 | Bacteria | 1301 |
| 330 | Ga0207658_10739420 | 3300025986 | Bacteria | 890 |
| 331 | Ga0207677_10157951 | 3300026023 | Bacteria | 1758 |
| 332 | Ga0207703_10000023 | 3300026035 | Bacteria | 222018 |
| 333 | Ga0207703_11813576 | 3300026035 | Bacteria | 586 |
| 334 | Ga0207639_10023285 | 3300026041 | Bacteria | 4471 |
| 335 | Ga0207639_10098967 | 3300026041 | Bacteria | 2352 |
| 336 | Ga0207639_10242103 | 3300026041 | Bacteria | 1569 |
| 337 | Ga0207639_10303282 | 3300026041 | Bacteria | 1413 |
| 338 | Ga0207678_10017647 | 3300026067 | Bacteria | 6265 |
| 339 | Ga0207678_10140820 | 3300026067 | Bacteria | 2058 |
| 340 | Ga0207678_11983391 | 3300026067 | Unclassified | 507 |
| 341 | Ga0207678_12032590 | 3300026067 | Bacteria | 500 |
| 342 | Ga0207702_10000060 | 3300026078 | Bacteria | 125473 |
| 343 | Ga0207702_10009975 | 3300026078 | Bacteria | 7963 |
| 344 | Ga0207702_10156205 | 3300026078 | Bacteria | 2079 |
| 345 | Ga0207702_11468283 | 3300026078 | Bacteria | 675 |
| 346 | Ga0207702_12443152 | 3300026078 | Bacteria | 509 |
| 347 | Ga0207641_10000405 | 3300026088 | Bacteria | 50517 |
| 348 | Ga0207641_10013802 | 3300026088 | Bacteria | 6623 |
| 349 | Ga0207641_11570488 | 3300026088 | Bacteria | 660 |
| 350 | Ga0207674_10144261 | 3300026116 | Bacteria | 2340 |
| 351 | Ga0207675_100036712 | 3300026118 | Bacteria | 4570 |
| 352 | Ga0207675_100443897 | 3300026118 | Bacteria | 1285 |
| 353 | Ga0207675_101238418 | 3300026118 | Bacteria | 767 |
| 354 | Ga0207683_10010970 | 3300026121 | Bacteria | 7727 |
| 355 | Ga0207683_10396512 | 3300026121 | Bacteria | 1269 |
| 356 | Ga0207683_10467340 | 3300026121 | Bacteria | 1164 |
| 357 | Ga0207698_10000440 | 3300026142 | Bacteria | 23916 |
| 358 | Ga0207698_11523386 | 3300026142 | Bacteria | 684 |
| 359 | Ga0209813_10452878 | 3300027866 | Bacteria | 525 |
| 360 | Ga0207428_10368037 | 3300027907 | Bacteria | 1056 |
| 361 | Ga0207428_10395457 | 3300027907 | Bacteria | 1012 |
| 362 | Ga0207428_10871828 | 3300027907 | Bacteria | 637 |
| 363 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 364 | Ga0268266_10000527 | 3300028379 | Bacteria | 53367 |
| 365 | Ga0268266_10039181 | 3300028379 | Bacteria | 4035 |
| 366 | Ga0268266_10132888 | 3300028379 | Bacteria | 2227 |
| 367 | Ga0268266_10322959 | 3300028379 | Bacteria | 1445 |
| 368 | Ga0268266_11918541 | 3300028379 | Bacteria | 566 |
| 369 | Ga0265337_1000584 | 3300028556 | Bacteria | 19168 |
| 370 | Ga0265326_10000749 | 3300028558 | Bacteria | 12020 |
| 371 | Ga0265319_1000122 | 3300028563 | Bacteria | 58869 |
| 372 | Ga0265318_10100417 | 3300028577 | Bacteria | 1065 |
| 373 | Ga0265323_10039981 | 3300028653 | Bacteria | 1708 |
| 374 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 375 | Ga0265322_10050574 | 3300028654 | Bacteria | 1180 |
| 376 | Ga0265336_10011583 | 3300028666 | Bacteria | 2991 |
| 377 | Ga0265338_10000706 | 3300028800 | Bacteria | 56988 |
| 378 | Ga0265338_10449124 | 3300028800 | Bacteria | 913 |
| 379 | Ga0265324_10000498 | 3300029957 | Bacteria | 27248 |
| 380 | Ga0265332_10015191 | 3300031238 | Bacteria | 3401 |
| 381 | Ga0265328_10000580 | 3300031239 | Bacteria | 16947 |
| 382 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 383 | Ga0265329_10004058 | 3300031242 | Bacteria | 6221 |
| 384 | Ga0265331_10001492 | 3300031250 | Bacteria | 17280 |
| 385 | Ga0265331_10067495 | 3300031250 | Bacteria | 1678 |
| 386 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 387 | Ga0265316_10005389 | 3300031344 | Bacteria | 12443 |
| 388 | Ga0265314_10000062 | 3300031711 | Bacteria | 159496 |
| 389 | Ga0265342_10148722 | 3300031712 | Bacteria | 1302 |
| 390 | Ga0316576_10310576 | 3300031727 | Bacteria | 1177 |
| 391 | Ga0307414_11727596 | 3300032004 | Bacteria | 584 |
| 392 | Ga0373945_0197675 | 3300035116 | Bacteria | 834 |
| 393 | Ga0373953_0216770 | 3300035117 | Bacteria | 829 |
| 394 | Ga0373956_0605558 | 3300035119 | Bacteria | 523 |
| 395 | Ga0373955_0336992 | 3300035172 | Bacteria | 912 |
| 396 | Ga0316574_0119436 | 3300035398 | Bacteria | 1692 |
| 397 | Ga0373933_0366099 | 3300035724 | Bacteria | 938 |
| 398 | Ga0373937_0016501 | 3300036401 | Bacteria | 6561 |
| 399 | Ga0373937_0020559 | 3300036401 | Bacteria | 5918 |
| 400 | Ga0373937_0061433 | 3300036401 | Bacteria | 3454 |
| 401 | Ga0373937_0393160 | 3300036401 | Bacteria | 1315 |
| 402 | Ga0373937_0496949 | 3300036401 | Bacteria | 1159 |
| 403 | Ga0373937_0579182 | 3300036401 | Bacteria | 1066 |
| 404 | Ga0316584_0003480 | 3300036712 | Bacteria | 10244 |
| 405 | Ga0395899_0031761 | 3300037312 | Bacteria | 3968 |
| 406 | Ga0395899_0292053 | 3300037312 | Bacteria | 1106 |
| 407 | Ga0395899_0608752 | 3300037312 | Bacteria | 695 |
| 408 | Ga0395900_0121469 | 3300037418 | Bacteria | 2680 |
| 409 | Ga0395900_0238247 | 3300037418 | Bacteria | 1826 |
| 410 | Ga0395898_0022321 | 3300037466 | Bacteria | 6409 |
| 411 | Ga0395898_0440057 | 3300037466 | Bacteria | 1242 |
| 412 | Ga0395898_0629917 | 3300037466 | Bacteria | 1015 |
| 413 | Ga0395898_1257819 | 3300037466 | Bacteria | 670 |
| 414 | Ga0395905_0011529 | 3300037471 | Bacteria | 8541 |
| 415 | Ga0395905_1215943 | 3300037471 | Bacteria | 657 |
| 416 | Ga0395905_1609114 | 3300037471 | Bacteria | 554 |
| 417 | Ga0436364_1456585 | 3300037853 | Bacteria | 2557 |
| 418 | Ga0436364_1543506 | 3300037853 | Bacteria | 10359 |
| 419 | Ga0395901_0042100 | 3300038443 | Bacteria | 4734 |
| 420 | Ga0395901_0189842 | 3300038443 | Unclassified | 2155 |
| 421 | Ga0395901_0607361 | 3300038443 | Bacteria | 1102 |
| 422 | Ga0395901_0891884 | 3300038443 | Bacteria | 872 |
| 423 | Ga0395901_1384925 | 3300038443 | Unclassified | 662 |
| 424 | Ga0395901_1822611 | 3300038443 | Bacteria | 557 |
| 425 | Ga0436365_0701598 | 3300039437 | Bacteria | 4776 |
| 426 | Ga0436365_0851257 | 3300039437 | Bacteria | 18616 |
| 427 | Ga0436365_0861691 | 3300039437 | Bacteria | 19086 |
| 428 | Ga0436365_1024354 | 3300039437 | Bacteria | 7729 |
| 429 | Ga0436360_0920718 | 3300039438 | Bacteria | 1201 |
| 430 | Ga0436363_0385095 | 3300039450 | Bacteria | 3103 |
| 431 | Ga0436363_0624775 | 3300039450 | Bacteria | 22345 |
| 432 | Ga0436363_1444359 | 3300039450 | Bacteria | 4849 |
| 433 | Ga0436363_1499909 | 3300039450 | Bacteria | 915 |
| 434 | Ga0436363_1521243 | 3300039450 | Bacteria | 1545 |
| 435 | Ga0436363_1525923 | 3300039450 | Bacteria | 1567 |
| 436 | Ga0436362_0773470 | 3300039453 | Bacteria | 2827 |
| 437 | Ga0451798_0005205 | 3300041458 | Bacteria | 589 |
| 438 | Ga0451800_1222739 | 3300041459 | Bacteria | 729 |
| 439 | Ga0451802_1560443 | 3300041460 | Bacteria | 582 |
| 440 | Ga0451804_0693844 | 3300041463 | Bacteria | 783 |
| 441 | Ga0451807_2044318 | 3300041486 | Bacteria | 678 |
| 442 | Ga0451833_0427862 | 3300041491 | Bacteria | 894 |
| 443 | Ga0451835_0618987 | 3300041492 | Bacteria | 620 |
| 444 | Ga0451837_1034507 | 3300041494 | Bacteria | 734 |
| 445 | Ga0451845_0953814 | 3300041501 | Bacteria | 572 |
| 446 | Ga0451847_0350639 | 3300041503 | Unclassified | 603 |
| 447 | Ga0451849_0155720 | 3300041505 | Bacteria | 836 |
| 448 | Ga0451853_1624115 | 3300041512 | Bacteria | 1984 |
| 449 | Ga0451853_2416189 | 3300041512 | Bacteria | 871 |
| 450 | Ga0451853_2712544 | 3300041512 | Bacteria | 587 |
| 451 | Ga0451853_3909198 | 3300041512 | Unclassified | 537 |
| 452 | Ga0466969_0146416 | 3300044656 | Bacteria | 1090 |
| 453 | Ga0466961_0314314 | 3300044693 | Bacteria | 956 |
| 454 | Ga0466963_0000001 | 3300044694 | Bacteria | 110556 |
| 455 | Ga0466963_0190332 | 3300044694 | Bacteria | 1433 |
| 456 | Ga0466963_0253323 | 3300044694 | Bacteria | 1235 |
| 457 | Ga0466964_0567514 | 3300044706 | Bacteria | 618 |
| 458 | Ga0466964_0677211 | 3300044706 | Bacteria | 573 |
| 459 | Ga0466964_0752571 | 3300044706 | Bacteria | 547 |
| 460 | Ga0466957_0082258 | 3300044842 | Unclassified | 2007 |
| 461 | Ga0466957_0167907 | 3300044842 | Bacteria | 1428 |
| 462 | Ga0466957_0779349 | 3300044842 | Unclassified | 678 |
| 463 | Ga0466959_0087897 | 3300045049 | Bacteria | 2235 |
| 464 | Ga0466959_0716297 | 3300045049 | Bacteria | 670 |
| 465 | Ga0466958_0016555 | 3300045836 | Bacteria | 4247 |
| 466 | Ga0466958_0027332 | 3300045836 | Bacteria | 3378 |
| 467 | Ga0466958_0894251 | 3300045836 | Bacteria | 579 |
| 468 | Ga0466967_0000009 | 3300045976 | Bacteria | 122610 |
| 469 | Ga0466967_0004934 | 3300045976 | Bacteria | 9123 |
| 470 | Ga0466967_0111803 | 3300045976 | Bacteria | 2511 |
| 471 | Ga0466967_0444218 | 3300045976 | Bacteria | 1267 |
| 472 | Ga0466967_1452615 | 3300045976 | Bacteria | 683 |
| 473 | Ga0466967_1660012 | 3300045976 | Bacteria | 636 |
| 474 | Ga0466967_2314802 | 3300045976 | Bacteria | 533 |
| 475 | Ga0495592_0000141 | 3300046454 | Bacteria | 63776 |
| 476 | Ga0495592_0065649 | 3300046454 | Bacteria | 2656 |
| 477 | Ga0495592_0094617 | 3300046454 | Bacteria | 2138 |
| 478 | Ga0495592_0558042 | 3300046454 | Bacteria | 703 |
| 479 | Ga0495603_0000016 | 3300046455 | Bacteria | 67399 |
| 480 | Ga0495603_0002427 | 3300046455 | Bacteria | 10956 |
| 481 | Ga0495629_0002683 | 3300046459 | Bacteria | 13624 |
| 482 | Ga0495629_0005201 | 3300046459 | Bacteria | 9743 |
| 483 | Ga0495629_0037535 | 3300046459 | Bacteria | 3415 |
| 484 | Ga0495629_0050385 | 3300046459 | Bacteria | 2916 |
| 485 | Ga0495629_0376733 | 3300046459 | Bacteria | 966 |
| 486 | Ga0495638_0056479 | 3300046460 | Bacteria | 2436 |
| 487 | Ga0495641_0000874 | 3300046461 | Bacteria | 25824 |
| 488 | Ga0495641_0091358 | 3300046461 | Bacteria | 1360 |
| 489 | Ga0495641_0229880 | 3300046461 | Unclassified | 832 |
| 490 | Ga0495641_0274649 | 3300046461 | Bacteria | 758 |
| 491 | Ga0495641_0415929 | 3300046461 | Bacteria | 610 |
| 492 | Ga0495651_0080298 | 3300046462 | Bacteria | 2464 |
| 493 | Ga0495651_0127135 | 3300046462 | Bacteria | 1865 |
| 494 | Ga0495653_0029967 | 3300046463 | Bacteria | 4337 |
| 495 | Ga0495653_0258187 | 3300046463 | Bacteria | 1153 |
| 496 | Ga0495653_0386684 | 3300046463 | Bacteria | 892 |
| 497 | Ga0495653_0678988 | 3300046463 | Bacteria | 627 |
| 498 | Ga0495582_0011642 | 3300046473 | Bacteria | 4848 |
| 499 | Ga0495605_0490074 | 3300046474 | Unclassified | 503 |
| 500 | Ga0495639_0112717 | 3300046475 | Bacteria | 1292 |
| 501 | Ga0495662_0002209 | 3300046476 | Bacteria | 9808 |
| 502 | Ga0495662_0012662 | 3300046476 | Bacteria | 4113 |
| 503 | Ga0495664_0111071 | 3300046477 | Bacteria | 1655 |
| 504 | Ga0495664_0533901 | 3300046477 | Bacteria | 700 |
| 505 | Ga0495594_0302721 | 3300046499 | Bacteria | 911 |
| 506 | Ga0495606_0000565 | 3300046507 | Bacteria | 58752 |
| 507 | Ga0495608_0008716 | 3300046511 | Bacteria | 7095 |
| 508 | Ga0495608_0404885 | 3300046511 | Bacteria | 834 |
| 509 | Ga0495610_0154651 | 3300046512 | Bacteria | 975 |
| 510 | Ga0495618_0000129 | 3300046514 | Bacteria | 54912 |
| 511 | Ga0495618_0159651 | 3300046514 | Bacteria | 1438 |
| 512 | Ga0495620_0000436 | 3300046515 | Bacteria | 27894 |
| 513 | Ga0495628_0000190 | 3300046516 | Bacteria | 53586 |
| 514 | Ga0495628_0002436 | 3300046516 | Bacteria | 16776 |
| 515 | Ga0495628_0036680 | 3300046516 | Bacteria | 3933 |
| 516 | Ga0495628_0102784 | 3300046516 | Bacteria | 2204 |
| 517 | Ga0495628_0156773 | 3300046516 | Bacteria | 1731 |
| 518 | Ga0495628_0163316 | 3300046516 | Bacteria | 1692 |
| 519 | Ga0495630_0000056 | 3300046517 | Bacteria | 91477 |
| 520 | Ga0495630_0012401 | 3300046517 | Bacteria | 6189 |
| 521 | Ga0495630_0101275 | 3300046517 | Bacteria | 2179 |
| 522 | Ga0495630_0204112 | 3300046517 | Bacteria | 1508 |
| 523 | Ga0495644_0009477 | 3300046523 | Bacteria | 3753 |
| 524 | Ga0495652_0000546 | 3300046529 | Bacteria | 44003 |
| 525 | Ga0495652_0004685 | 3300046529 | Bacteria | 13047 |
| 526 | Ga0495652_0386447 | 3300046529 | Bacteria | 994 |
| 527 | Ga0495652_0386738 | 3300046529 | Bacteria | 994 |
| 528 | Ga0495640_0015403 | 3300046533 | Bacteria | 5755 |
| 529 | Ga0495640_0195063 | 3300046533 | Bacteria | 1286 |
| 530 | Ga0495640_0345321 | 3300046533 | Unclassified | 919 |
| 531 | Ga0495640_0851158 | 3300046533 | Bacteria | 542 |
| 532 | Ga0495586_0008925 | 3300046535 | Bacteria | 5337 |
| 533 | Ga0495587_0003427 | 3300046536 | Bacteria | 10576 |
| 534 | Ga0495587_0120489 | 3300046536 | Bacteria | 1503 |
| 535 | Ga0495587_0444064 | 3300046536 | Bacteria | 719 |
| 536 | Ga0495598_0004686 | 3300046537 | Bacteria | 2979 |
| 537 | Ga0495609_0263778 | 3300046538 | Bacteria | 707 |
| 538 | Ga0495621_0015075 | 3300046539 | Bacteria | 2459 |
| 539 | Ga0495645_0019514 | 3300046543 | Bacteria | 4880 |
| 540 | Ga0495645_0126912 | 3300046543 | Bacteria | 1792 |
| 541 | Ga0495645_0228847 | 3300046543 | Bacteria | 1246 |
| 542 | Ga0495645_0232945 | 3300046543 | Bacteria | 1233 |
| 543 | Ga0495667_0000018 | 3300046559 | Bacteria | 188610 |
| 544 | Ga0495667_0351376 | 3300046559 | Bacteria | 931 |
| 545 | Ga0495634_0006771 | 3300046642 | Bacteria | 8681 |
| 546 | Ga0495634_0007615 | 3300046642 | Bacteria | 8114 |
| 547 | Ga0495634_0072099 | 3300046642 | Bacteria | 2272 |
| 548 | Ga0495634_0143753 | 3300046642 | Bacteria | 1513 |
| 549 | Ga0495634_0348299 | 3300046642 | Bacteria | 887 |
| 550 | Ga0495625_0734157 | 3300046660 | Bacteria | 580 |
| 551 | Ga0495635_0000044 | 3300046663 | Bacteria | 83945 |
| 552 | Ga0495635_0069299 | 3300046663 | Bacteria | 2418 |
| 553 | Ga0495588_0000165 | 3300046674 | Bacteria | 85841 |
| 554 | Ga0495588_0354864 | 3300046674 | Bacteria | 770 |
| 555 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 556 | Ga0495657_0140482 | 3300046675 | Bacteria | 1505 |
| 557 | Ga0495599_0113154 | 3300046678 | Bacteria | 1689 |
| 558 | Ga0495623_0073854 | 3300046679 | Bacteria | 2120 |
| 559 | Ga0495647_0000018 | 3300046681 | Bacteria | 81701 |
| 560 | Ga0495647_0000904 | 3300046681 | Bacteria | 8893 |
| 561 | Ga0495647_0015755 | 3300046681 | Bacteria | 2652 |
| 562 | Ga0495647_0114642 | 3300046681 | Bacteria | 1128 |
| 563 | Ga0495658_0001635 | 3300046683 | Bacteria | 11651 |
| 564 | Ga0495669_0000033 | 3300046684 | Bacteria | 98629 |
| 565 | Ga0495613_0000179 | 3300046689 | Bacteria | 62109 |
| 566 | Ga0495613_0000200 | 3300046689 | Bacteria | 58821 |
| 567 | Ga0495613_0432972 | 3300046689 | Bacteria | 893 |
| 568 | Ga0495624_0000073 | 3300046690 | Bacteria | 65582 |
| 569 | Ga0495624_0000097 | 3300046690 | Bacteria | 58715 |
| 570 | Ga0495624_0004587 | 3300046690 | Bacteria | 10086 |
| 571 | Ga0495624_0110992 | 3300046690 | Bacteria | 1686 |
| 572 | Ga0495649_0000751 | 3300046694 | Bacteria | 26125 |
| 573 | Ga0495649_0361792 | 3300046694 | Unclassified | 732 |
| 574 | Ga0495589_0578970 | 3300046794 | Bacteria | 511 |
| 575 | Ga0495600_0001315 | 3300046809 | Bacteria | 13711 |
| 576 | Ga0495600_0026988 | 3300046809 | Bacteria | 3710 |
| 577 | Ga0495600_0116660 | 3300046809 | Bacteria | 1738 |
| 578 | Ga0495600_0515267 | 3300046809 | Bacteria | 734 |
| 579 | Ga0495600_0900957 | 3300046809 | Bacteria | 522 |
| 580 | Ga0495604_0000055 | 3300047317 | Bacteria | 100430 |
| 581 | Ga0495604_0000357 | 3300047317 | Bacteria | 40931 |
| 582 | Ga0495604_0030874 | 3300047317 | Bacteria | 4252 |
| 583 | Ga0495674_0065539 | 3300047319 | Bacteria | 3155 |
| 584 | Ga0495672_0480684 | 3300047320 | Bacteria | 555 |
| 585 | Ga0495676_0025439 | 3300047321 | Bacteria | 5110 |
| 586 | Ga0495676_0063988 | 3300047321 | Bacteria | 2864 |
| 587 | Ga0495676_0097203 | 3300047321 | Bacteria | 2187 |
| 588 | Ga0495676_0301607 | 3300047321 | Bacteria | 1080 |
| 589 | Ga0495676_0438834 | 3300047321 | Bacteria | 862 |
| 590 | Ga0495680_0000496 | 3300047322 | Bacteria | 44440 |
| 591 | Ga0495680_0001969 | 3300047322 | Bacteria | 21587 |
| 592 | Ga0495680_0015856 | 3300047322 | Bacteria | 6486 |
| 593 | Ga0495680_0019801 | 3300047322 | Bacteria | 5673 |
| 594 | Ga0495680_0020281 | 3300047322 | Bacteria | 5596 |
| 595 | Ga0495675_0000175 | 3300047444 | Bacteria | 46609 |
| 596 | Ga0495675_0223734 | 3300047444 | Bacteria | 1138 |
| 597 | Ga0495685_135880 | 3300047447 | Bacteria | 802 |
| 598 | Ga0495673_0169152 | 3300047469 | Bacteria | 834 |
| 599 | Ga0495684_0584487 | 3300047471 | Bacteria | 756 |
| 600 | Ga0495684_0758649 | 3300047471 | Bacteria | 638 |
| 601 | Ga0495686_0331133 | 3300047472 | Bacteria | 832 |
| 602 | Ga0495593_0150512 | 3300047673 | Bacteria | 1177 |
| 603 | Ga0495593_0188696 | 3300047673 | Bacteria | 1037 |
| 604 | Ga0495602_0000041 | 3300048088 | Bacteria | 126954 |
| 605 | Ga0495602_0005883 | 3300048088 | Bacteria | 12880 |
| 606 | Ga0495602_0208584 | 3300048088 | Bacteria | 1485 |
| 607 | Ga0495602_0295952 | 3300048088 | Bacteria | 1186 |
| 608 | Ga0495602_0953008 | 3300048088 | Bacteria | 568 |
| 609 | Ga0495614_0200947 | 3300048089 | Bacteria | 902 |
| 610 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 611 | Ga0496100_0000018 | 3300048903 | Bacteria | 162451 |
| 612 | Ga0496100_0030273 | 3300048903 | Bacteria | 3356 |
| 613 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 614 | Ga0496101_0000062 | 3300048904 | Bacteria | 126595 |
| 615 | Ga0496101_0013193 | 3300048904 | Bacteria | 5532 |
| 616 | Ga0496101_0037762 | 3300048904 | Bacteria | 3428 |
| 617 | Ga0496102_0000039 | 3300048905 | Bacteria | 198306 |
| 618 | Ga0496102_0210291 | 3300048905 | Bacteria | 1834 |
| 619 | Ga0496102_0652607 | 3300048905 | Bacteria | 975 |
| 620 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 621 | Ga0496103_0008690 | 3300048906 | Bacteria | 6029 |
| 622 | Ga0496103_0118686 | 3300048906 | Bacteria | 1684 |
| 623 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 624 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 625 | Ga0496104_0000650 | 3300048907 | Bacteria | 29817 |
| 626 | Ga0496104_0002254 | 3300048907 | Bacteria | 16633 |
| 627 | Ga0496104_0143943 | 3300048907 | Bacteria | 2289 |
| 628 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 629 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 630 | Ga0496105_0000347 | 3300048908 | Bacteria | 30490 |
| 631 | Ga0496105_0006887 | 3300048908 | Bacteria | 8749 |
| 632 | Ga0496105_0377651 | 3300048908 | Bacteria | 1128 |
| 633 | Ga0496105_0717106 | 3300048908 | Bacteria | 766 |
| 634 | Ga0496106_0000061 | 3300048909 | Bacteria | 86524 |
| 635 | Ga0496106_0000122 | 3300048909 | Bacteria | 59816 |
| 636 | Ga0496106_0000312 | 3300048909 | Bacteria | 34208 |
| 637 | Ga0496106_0003774 | 3300048909 | Bacteria | 11293 |
| 638 | Ga0496106_0260212 | 3300048909 | Unclassified | 1388 |
| 639 | Ga0496106_1127764 | 3300048909 | Bacteria | 614 |
| 640 | Ga0496107_0000006 | 3300048910 | Bacteria | 258746 |
| 641 | Ga0496107_0000013 | 3300048910 | Bacteria | 178284 |
| 642 | Ga0496107_0015373 | 3300048910 | Bacteria | 5363 |
| 643 | Ga0496107_0067988 | 3300048910 | Bacteria | 2585 |
| 644 | Ga0496107_0884196 | 3300048910 | Bacteria | 652 |
| 645 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 646 | Ga0496108_0000062 | 3300048911 | Bacteria | 122391 |
| 647 | Ga0496108_0033537 | 3300048911 | Bacteria | 4265 |
| 648 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 649 | Ga0496109_0000121 | 3300048912 | Bacteria | 81487 |
| 650 | Ga0496109_0000129 | 3300048912 | Bacteria | 77469 |
| 651 | Ga0496109_0235820 | 3300048912 | Bacteria | 1721 |
| 652 | Ga0496109_0257313 | 3300048912 | Bacteria | 1644 |
| 653 | Ga0496109_0717293 | 3300048912 | Bacteria | 938 |
| 654 | Ga0496109_0931933 | 3300048912 | Bacteria | 806 |
| 655 | Ga0496109_1010661 | 3300048912 | Bacteria | 769 |
| 656 | Ga0496110_0000089 | 3300048913 | Bacteria | 48723 |
| 657 | Ga0496110_0040973 | 3300048913 | Bacteria | 4038 |
| 658 | Ga0496110_0138590 | 3300048913 | Bacteria | 2199 |
| 659 | Ga0496110_0392136 | 3300048913 | Bacteria | 1266 |
| 660 | Ga0496110_0623855 | 3300048913 | Bacteria | 977 |
| 661 | Ga0496111_0003847 | 3300048914 | Bacteria | 9377 |
| 662 | Ga0496111_0411166 | 3300048914 | Bacteria | 999 |
| 663 | Ga0496112_0001770 | 3300048915 | Bacteria | 16950 |
| 664 | Ga0496112_0012374 | 3300048915 | Bacteria | 7840 |
| 665 | Ga0496113_0000628 | 3300048916 | Bacteria | 17756 |
| 666 | Ga0496113_0158832 | 3300048916 | Bacteria | 1786 |
| 667 | Ga0496113_0297946 | 3300048916 | Bacteria | 1291 |
| 668 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 669 | Ga0496114_0006959 | 3300048917 | Bacteria | 8910 |
| 670 | Ga0496114_0011449 | 3300048917 | Bacteria | 7087 |
| 671 | Ga0496114_0338929 | 3300048917 | Bacteria | 1329 |
| 672 | Ga0496114_1632719 | 3300048917 | Unclassified | 533 |
| 673 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 674 | Ga0496115_0004217 | 3300048918 | Bacteria | 10391 |
| 675 | Ga0496115_0021854 | 3300048918 | Bacteria | 4947 |
| 676 | Ga0496116_0001565 | 3300048919 | Bacteria | 25265 |
| 677 | Ga0496118_0000818 | 3300048921 | Bacteria | 49518 |
| 678 | Ga0496118_0065926 | 3300048921 | Bacteria | 2646 |
| 679 | Ga0496119_0005786 | 3300048922 | Bacteria | 11703 |
| 680 | Ga0496119_0013028 | 3300048922 | Bacteria | 6674 |
| 681 | Ga0496119_0023319 | 3300048922 | Bacteria | 4396 |
| 682 | Ga0496120_0005134 | 3300048923 | Bacteria | 10578 |
| 683 | Ga0496120_0163355 | 3300048923 | Bacteria | 1108 |
| 684 | Ga0496121_0006714 | 3300048924 | Bacteria | 14134 |
| 685 | Ga0496121_0064471 | 3300048924 | Bacteria | 2987 |
| 686 | Ga0496121_0605527 | 3300048924 | Bacteria | 675 |
| 687 | Ga0496124_0054064 | 3300048927 | Bacteria | 3400 |
| 688 | Ga0496124_0121825 | 3300048927 | Bacteria | 2083 |
| 689 | Ga0496124_0354749 | 3300048927 | Bacteria | 1036 |
| 690 | Ga0496125_0082480 | 3300048928 | Bacteria | 2451 |
| 691 | Ga0496125_0132735 | 3300048928 | Bacteria | 1749 |
| 692 | Ga0496126_0125448 | 3300048929 | Bacteria | 2222 |
| 693 | Ga0496126_0139139 | 3300048929 | Bacteria | 2091 |
| 694 | Ga0496126_0249606 | 3300048929 | Bacteria | 1479 |
| 695 | Ga0496126_0559172 | 3300048929 | Bacteria | 907 |
| 696 | Ga0501031_0006434 | 3300049568 | Bacteria | 7657 |
| 697 | Ga0501031_0032539 | 3300049568 | Bacteria | 3400 |
| 698 | Ga0501031_0229071 | 3300049568 | Bacteria | 1209 |
| 699 | Ga0501031_1025853 | 3300049568 | Bacteria | 527 |
| 700 | Ga0501032_0001678 | 3300049569 | Bacteria | 17583 |
| 701 | Ga0501032_0556594 | 3300049569 | Bacteria | 731 |
| 702 | Ga0501033_0003865 | 3300049570 | Bacteria | 12176 |
| 703 | Ga0501036_0003053 | 3300049572 | Bacteria | 13344 |
| 704 | Ga0501036_0270235 | 3300049572 | Bacteria | 1423 |
| 705 | Ga0501036_0450681 | 3300049572 | Bacteria | 1072 |
| 706 | Ga0501037_0006405 | 3300049573 | Bacteria | 8616 |
| 707 | Ga0501037_0162734 | 3300049573 | Bacteria | 1590 |
| 708 | Ga0501037_0213765 | 3300049573 | Bacteria | 1359 |
| 709 | Ga0501037_1068089 | 3300049573 | Bacteria | 524 |
| 710 | Ga0501038_0006019 | 3300049574 | Bacteria | 11225 |
| 711 | Ga0501039_0060637 | 3300049575 | Bacteria | 2930 |
| 712 | Ga0501039_0853631 | 3300049575 | Bacteria | 709 |
| 713 | Ga0501039_0968021 | 3300049575 | Bacteria | 662 |
| 714 | Ga0501040_0136864 | 3300049576 | Bacteria | 1725 |
| 715 | Ga0501040_0140045 | 3300049576 | Bacteria | 1704 |
| 716 | Ga0501040_0181450 | 3300049576 | Bacteria | 1492 |
| 717 | Ga0501041_0029844 | 3300049577 | Bacteria | 3291 |
| 718 | Ga0501042_0020168 | 3300049578 | Bacteria | 4637 |
| 719 | Ga0501042_0101007 | 3300049578 | Bacteria | 2074 |
| 720 | Ga0501042_0233327 | 3300049578 | Bacteria | 1327 |
| 721 | Ga0501042_0670526 | 3300049578 | Bacteria | 754 |
| 722 | Ga0501043_0005761 | 3300049579 | Bacteria | 9981 |
| 723 | Ga0501043_0324280 | 3300049579 | Bacteria | 1174 |
| 724 | Ga0501046_0004837 | 3300049580 | Bacteria | 12135 |
| 725 | Ga0501047_0003503 | 3300049581 | Bacteria | 14828 |
| 726 | Ga0501047_0075325 | 3300049581 | Bacteria | 3247 |
| 727 | Ga0501047_0190208 | 3300049581 | Bacteria | 1916 |
| 728 | Ga0501047_0205408 | 3300049581 | Bacteria | 1829 |
| 729 | Ga0501047_0308141 | 3300049581 | Bacteria | 1424 |
| 730 | Ga0501047_0753796 | 3300049581 | Bacteria | 789 |
| 731 | Ga0501048_0002374 | 3300049582 | Bacteria | 14372 |
| 732 | Ga0501048_0189752 | 3300049582 | Bacteria | 1456 |
| 733 | Ga0501048_0749800 | 3300049582 | Bacteria | 701 |
| 734 | Ga0501048_0836383 | 3300049582 | Bacteria | 662 |
| 735 | Ga0501068_0026058 | 3300049584 | Bacteria | 3442 |
| 736 | Ga0501068_0095507 | 3300049584 | Bacteria | 1838 |
| 737 | Ga0501068_0366614 | 3300049584 | Bacteria | 927 |
| 738 | Ga0501069_0047323 | 3300049585 | Unclassified | 2387 |
| 739 | Ga0501069_0055315 | 3300049585 | Bacteria | 2210 |
| 740 | Ga0501070_0000494 | 3300049586 | Bacteria | 35842 |
| 741 | Ga0501070_0026871 | 3300049586 | Bacteria | 4828 |
| 742 | Ga0501070_0082400 | 3300049586 | Bacteria | 2662 |
| 743 | Ga0501070_0370807 | 3300049586 | Bacteria | 1160 |
| 744 | Ga0501070_1529547 | 3300049586 | Unclassified | 504 |
| 745 | Ga0501071_0024056 | 3300049587 | Bacteria | 4258 |
| 746 | Ga0501071_0039228 | 3300049587 | Bacteria | 3388 |
| 747 | Ga0501071_0049503 | 3300049587 | Bacteria | 3025 |
| 748 | Ga0501072_0067529 | 3300049588 | Bacteria | 2821 |
| 749 | Ga0501072_0401493 | 3300049588 | Bacteria | 1087 |
| 750 | Ga0501072_0419551 | 3300049588 | Bacteria | 1061 |
| 751 | Ga0501072_1324803 | 3300049588 | Bacteria | 558 |
| 752 | Ga0501072_1418510 | 3300049588 | Bacteria | 537 |
| 753 | Ga0501073_0006754 | 3300049589 | Bacteria | 8541 |
| 754 | Ga0501074_0015390 | 3300049590 | Bacteria | 5560 |
| 755 | Ga0501074_0045664 | 3300049590 | Bacteria | 3168 |
| 756 | Ga0501074_0165069 | 3300049590 | Bacteria | 1581 |
| 757 | Ga0501074_0457771 | 3300049590 | Bacteria | 904 |
| 758 | Ga0501075_0000990 | 3300049591 | Bacteria | 18117 |
| 759 | Ga0501075_0054065 | 3300049591 | Bacteria | 3020 |
| 760 | Ga0501075_0155053 | 3300049591 | Bacteria | 1746 |
| 761 | Ga0501075_0435521 | 3300049591 | Bacteria | 1000 |
| 762 | Ga0501075_1020268 | 3300049591 | Bacteria | 629 |
| 763 | Ga0501075_1206083 | 3300049591 | Bacteria | 574 |
| 764 | Ga0501077_0125313 | 3300049593 | Bacteria | 1628 |
| 765 | Ga0501077_0527056 | 3300049593 | Bacteria | 758 |
| 766 | Ga0501079_0016140 | 3300049741 | Bacteria | 5707 |
| 767 | Ga0501079_0043241 | 3300049741 | Bacteria | 3477 |
| 768 | Ga0501079_0059289 | 3300049741 | Bacteria | 2952 |
| 769 | Ga0501079_0434555 | 3300049741 | Bacteria | 1031 |
| 770 | Ga0501079_1287747 | 3300049741 | Bacteria | 576 |
| 771 | Ga0501079_1652202 | 3300049741 | Bacteria | 504 |
| 772 | Ga0501080_0101268 | 3300049742 | Bacteria | 2672 |
| 773 | Ga0501080_0122471 | 3300049742 | Bacteria | 2409 |
| 774 | Ga0501081_0120289 | 3300049743 | Bacteria | 1870 |
| 775 | Ga0501081_0305789 | 3300049743 | Bacteria | 1167 |
| 776 | Ga0501081_0627125 | 3300049743 | Bacteria | 805 |
| 777 | Ga0501081_0969419 | 3300049743 | Unclassified | 642 |
| 778 | Ga0501083_0025710 | 3300049744 | Bacteria | 4075 |
| 779 | Ga0501083_0047096 | 3300049744 | Bacteria | 2914 |
| 780 | Ga0501083_0146811 | 3300049744 | Bacteria | 1544 |
| 781 | Ga0501083_0308285 | 3300049744 | Bacteria | 1030 |
| 782 | Ga0501035_0000718 | 3300049822 | Bacteria | 35799 |
| 783 | Ga0501035_0612319 | 3300049822 | Unclassified | 886 |
| 784 | Ga0501035_0942078 | 3300049822 | Bacteria | 682 |
| 785 | Ga0501044_0012374 | 3300049823 | Bacteria | 9236 |
| 786 | Ga0501044_0082888 | 3300049823 | Bacteria | 3243 |
| 787 | Ga0501044_0177281 | 3300049823 | Bacteria | 2100 |
| 788 | Ga0501045_0080388 | 3300049824 | Bacteria | 2403 |
| 789 | Ga0501045_0417652 | 3300049824 | Bacteria | 998 |
| 790 | Ga0501045_0622456 | 3300049824 | Bacteria | 799 |
| 791 | Ga0501045_0719910 | 3300049824 | Bacteria | 736 |
| 792 | Ga0501045_1362587 | 3300049824 | Bacteria | 516 |
| 793 | nmdc:mga03n38_210351_c1 | 3300050490 | Bacteria | 1011 |
| 794 | nmdc:mga04h51_166687_c1 | 3300050495 | Bacteria | 850 |
| 795 | nmdc:mga04h51_432516_c1 | 3300050495 | Bacteria | 555 |
| 796 | nmdc:mga05p37_1135471_c1 | 3300050507 | Bacteria | 814 |
| 797 | nmdc:mga05p37_303733_c1 | 3300050507 | Bacteria | 1895 |
| 798 | nmdc:mga05p37_616143_c1 | 3300050507 | Bacteria | 1222 |
| 799 | nmdc:mga09592_228396_c1 | 3300050508 | Bacteria | 1612 |
| 800 | nmdc:mga0qj67_277829_c1 | 3300050509 | Bacteria | 1358 |
| 801 | nmdc:mga06r32_1218100_c1 | 3300050510 | Bacteria | 699 |
| 802 | nmdc:mga06r32_18690_c1 | 3300050510 | Bacteria | 6350 |
| 803 | nmdc:mga06r32_522948_c1 | 3300050510 | Bacteria | 1162 |
| 804 | nmdc:mga06r32_663143_c1 | 3300050510 | Bacteria | 1011 |
| 805 | nmdc:mga08y16_120556_c1 | 3300050511 | Bacteria | 2729 |
| 806 | nmdc:mga08y16_652238_c1 | 3300050511 | Bacteria | 1057 |
| 807 | nmdc:mga0n895_15112_c1 | 3300050512 | Bacteria | 7034 |
| 808 | nmdc:mga0n895_1625532_c1 | 3300050512 | Bacteria | 610 |
| 809 | nmdc:mga0rr50_232321_c1 | 3300050513 | Bacteria | 1526 |
| 810 | nmdc:mga0a205_24_c2 | 3300050515 | Bacteria | 81894 |
| 811 | nmdc:mga0a205_923984_c1 | 3300050515 | Bacteria | 719 |
| 812 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 813 | Ga0495601_0000264 | 3300053077 | Bacteria | 28275 |
| 814 | Ga0495601_0030912 | 3300053077 | Bacteria | 3327 |
| 815 | Ga0495601_0055497 | 3300053077 | Bacteria | 2508 |
| 816 | Ga0495601_0057341 | 3300053077 | Bacteria | 2468 |
| 817 | Ga0495601_0632326 | 3300053077 | Bacteria | 685 |
| 818 | Ga0495601_0791215 | 3300053077 | Bacteria | 602 |
| 819 | Ga0495601_1016644 | 3300053077 | Bacteria | 521 |
| 820 | Ga0495612_0000060 | 3300053078 | Bacteria | 49047 |
| 821 | Ga0495612_0001051 | 3300053078 | Bacteria | 11297 |
| 822 | Ga0495612_0027520 | 3300053078 | Bacteria | 2287 |
| 823 | Ga0495612_0032800 | 3300053078 | Bacteria | 2099 |
| 824 | Ga0500635_0153442 | 3300053080 | Bacteria | 880 |
| 825 | Ga0495655_0003139 | 3300053083 | Bacteria | 2695 |
| 826 | Ga0495655_0199928 | 3300053083 | Bacteria | 653 |
| 827 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 828 | Ga0495595_0000053 | 3300053084 | Bacteria | 59851 |
| 829 | Ga0495595_0222926 | 3300053084 | Bacteria | 941 |
| 830 | Ga0495595_0421500 | 3300053084 | Bacteria | 677 |
| 831 | Ga0495619_0000031 | 3300053085 | Bacteria | 145508 |
| 832 | Ga0495619_0000257 | 3300053085 | Bacteria | 38653 |
| 833 | Ga0495619_0001230 | 3300053085 | Bacteria | 16755 |
| 834 | Ga0495619_0003227 | 3300053085 | Bacteria | 10557 |
| 835 | Ga0495619_0022451 | 3300053085 | Bacteria | 4039 |
| 836 | Ga0500566_0194541 | 3300053094 | Bacteria | 1029 |
| 837 | Ga0500554_191526 | 3300053102 | Bacteria | 686 |
| 838 | Ga0500572_072649 | 3300053111 | Bacteria | 1066 |
| 839 | Ga0500595_011934 | 3300053119 | Bacteria | 3379 |
| 840 | Ga0500595_052522 | 3300053119 | Unclassified | 1258 |
| 841 | Ga0500614_001576 | 3300053123 | Bacteria | 5389 |
| 842 | Ga0500658_0191770 | 3300053134 | Bacteria | 933 |
| 843 | Ga0501084_0036933 | 3300054114 | Bacteria | 4082 |
| 844 | Ga0501084_0151099 | 3300054114 | Bacteria | 1957 |
| 845 | Ga0501084_1020121 | 3300054114 | Bacteria | 695 |
| 846 | Ga0501084_1196071 | 3300054114 | Bacteria | 638 |
| 847 | Ga0501082_0020789 | 3300060353 | Bacteria | 5660 |
| 848 | Ga0501082_0853851 | 3300060353 | Bacteria | 796 |
| 849 | Ga0501082_0864393 | 3300060353 | Bacteria | 791 |
| 850 | Ga0501082_1693646 | 3300060353 | Bacteria | 552 |
| 851 | Ga0530510_0004432 | 3300061734 | Bacteria | 9722 |
| 852 | Ga0530510_0024130 | 3300061734 | Bacteria | 4338 |
| 853 | Ga0530510_0446045 | 3300061734 | Bacteria | 978 |
| 854 | Ga0530510_1455564 | 3300061734 | Unclassified | 526 |
| 855 | Ga0070696_101037434 | |||
| 856 | JGI24746J21847_1000100 | |||
| 857 | JGI24740J21852_10026088 | |||
| 858 | JGI25407J50210_10026922 | |||
| 859 | Ga0058860_11913064 | |||
| 860 | Ga0070658_10096516 | |||
| 861 | Ga0070683_100013452 | |||
| 862 | Ga0070683_100018313 | |||
| 863 | Ga0070683_100097877 | |||
| 864 | Ga0070683_100529723 | |||
| 865 | Ga0070683_101194638 | |||
| 866 | Ga0070683_101290749 | |||
| 867 | Ga0070670_100071744 | |||
| 868 | Ga0070677_10000620 | |||
| 869 | Ga0070666_10021476 | |||
| 870 | Ga0070666_10024284 | |||
| 871 | Ga0070666_10182897 | |||
| 872 | Ga0070682_100000013 | |||
| 873 | Ga0070682_100000117 | |||
| 874 | Ga0070682_100230344 | |||
| 875 | Ga0070660_100856029 | |||
| 876 | Ga0070689_100225577 | |||
| 877 | Ga0070691_10000344 | |||
| 878 | Ga0070661_100001375 | |||
| 879 | Ga0070692_10076888 | |||
| 880 | Ga0070668_100046204 | |||
| 881 | Ga0070668_100384052 | |||
| 882 | Ga0070669_100847803 | |||
| 883 | Ga0070675_100000111 | |||
| 884 | Ga0070674_100436769 | |||
| 885 | Ga0070688_100003353 | |||
| 886 | Ga0070688_100031251 | |||
| 887 | Ga0070659_100064556 | |||
| 888 | Ga0070659_100081482 | |||
| 889 | Ga0070667_100019394 | |||
| 890 | Ga0070667_100420744 | |||
| 891 | Ga0070667_100473010 | |||
| 892 | Ga0070667_100717556 | |||
| 893 | Ga0070667_101056363 | |||
| 894 | Ga0070714_100369857 | |||
| 895 | Ga0070714_101403465 | |||
| 896 | Ga0070713_100000390 | |||
| 897 | Ga0070713_100076960 | |||
| 898 | Ga0070701_10798054 | |||
| 899 | Ga0070711_100002341 | |||
| 900 | Ga0070711_100079580 | |||
| 901 | Ga0070711_100342071 | |||
| 902 | Ga0070711_101991869 | |||
| 903 | Ga0070700_101004836 | |||
| 904 | Ga0070700_101296323 | |||
| 905 | Ga0070694_101211204 | |||
| 906 | Ga0070708_101006087 | |||
| 907 | Ga0070663_100000728 | |||
| 908 | Ga0070663_100450556 | |||
| 909 | Ga0070663_100559632 | |||
| 910 | Ga0070663_101181470 | |||
| 911 | Ga0070678_100230631 | |||
| 912 | Ga0070678_100675274 | |||
| 913 | Ga0070681_10010667 | |||
| 914 | Ga0070681_10195528 | |||
| 915 | Ga0070685_10004176 | |||
| 916 | Ga0070685_10014878 | |||
| 917 | Ga0070706_101024855 | |||
| 918 | Ga0070707_100721365 | |||
| 919 | Ga0070679_100000068 | |||
| 920 | Ga0070679_100007698 | |||
| 921 | Ga0070684_100003702 | |||
| 922 | Ga0070684_100053567 | |||
| 923 | Ga0070684_100082890 | |||
| 924 | Ga0070684_100564524 | |||
| 925 | Ga0070684_100862732 | |||
| 926 | Ga0070684_102205542 | |||
| 927 | Ga0070697_100811940 | |||
| 928 | Ga0068853_100044951 | |||
| 929 | Ga0068853_100082050 | |||
| 930 | Ga0070672_100000015 | |||
| 931 | Ga0070672_101251265 | |||
| 932 | Ga0070696_101221178 | |||
| 933 | Ga0070696_101693585 | |||
| 934 | Ga0070693_100898613 | |||
| 935 | Ga0070665_100000106 | |||
| 936 | Ga0070665_100040036 | |||
| 937 | Ga0070665_100047803 | |||
| 938 | Ga0070665_100460600 | |||
| 939 | Ga0070704_100094245 | |||
| 940 | Ga0070704_100663332 | |||
| 941 | Ga0070704_100791172 | |||
| 942 | Ga0070704_101943735 | |||
| 943 | Ga0068855_100124857 | |||
| 944 | Ga0068855_100656674 | |||
| 945 | Ga0068855_101740796 | |||
| 946 | Ga0070664_100183538 | |||
| 947 | Ga0070664_101095459 | |||
| 948 | Ga0068857_100156475 | |||
| 949 | Ga0068854_100000183 | |||
| 950 | Ga0068854_100042340 | |||
| 951 | Ga0068854_101593829 | |||
| 952 | Ga0068856_100022587 | |||
| 953 | Ga0068856_100030339 | |||
| 954 | Ga0070702_100187618 | |||
| 955 | Ga0070702_101671809 | |||
| 956 | Ga0068852_100000093 | |||
| 957 | Ga0068852_100963039 | |||
| 958 | Ga0068852_102670860 | |||
| 959 | Ga0068866_10171194 | |||
| 960 | Ga0068861_100032704 | |||
| 961 | Ga0068851_10028087 | |||
| 962 | Ga0068863_100006700 | |||
| 963 | Ga0068863_100019353 | |||
| 964 | Ga0068858_100000009 | |||
| 965 | Ga0081455_10045239 | |||
| 966 | Ga0081455_10121379 | |||
| 967 | Ga0081455_10136300 | |||
| 968 | Ga0081455_10215081 | |||
| 969 | Ga0081538_10000097 | |||
| 970 | Ga0081538_10246795 | |||
| 971 | Ga0081540_1014499 | |||
| 972 | Ga0081540_1091337 | |||
| 973 | Ga0081539_10143125 | |||
| 974 | Ga0075365_10155050 | |||
| 975 | Ga0075365_11043423 | |||
| 976 | Ga0075368_10140279 | |||
| 977 | Ga0075368_10286339 | |||
| 978 | Ga0075364_10277745 | |||
| 979 | Ga0075364_10559197 | |||
| 980 | Ga0070716_100624117 | |||
| 981 | Ga0070716_100676090 | |||
| 982 | Ga0070712_100230412 | |||
| 983 | Ga0070712_100983131 | |||
| 984 | Ga0097621_100695002 | |||
| 985 | Ga0068871_100050353 | |||
| 986 | Ga0068871_101323746 | |||
| 987 | Ga0068871_102383090 | |||
| 988 | Ga0075428_100089317 | |||
| 989 | Ga0075428_100225192 | |||
| 990 | Ga0075428_102585298 | |||
| 991 | Ga0075430_100025554 | |||
| 992 | Ga0075431_100002597 | |||
| 993 | Ga0075431_100011637 | |||
| 994 | Ga0075431_100132397 | |||
| 995 | Ga0075431_100463537 | |||
| 996 | Ga0075433_11517781 | |||
| 997 | Ga0075434_100024708 | |||
| 998 | Ga0075434_102007283 | |||
| 999 | Ga0075429_100233609 | |||
| 1000 | Ga0068865_100001085 | |||
| 1001 | Ga0068865_100634882 | |||
| 1002 | Ga0068865_100756905 | |||
| 1003 | Ga0075436_100999997 | |||
| 1004 | Ga0075435_100241696 | |||
| 1005 | Ga0099794_10446346 | |||
| 1006 | Ga0105240_10556503 | |||
| 1007 | Ga0105240_11899925 | |||
| 1008 | Ga0111539_10255438 | |||
| 1009 | Ga0111539_10660301 | |||
| 1010 | Ga0111539_11996364 | |||
| 1011 | Ga0111539_12210871 | |||
| 1012 | Ga0105245_10001150 | |||
| 1013 | Ga0105245_10001895 | |||
| 1014 | Ga0105245_10006500 | |||
| 1015 | Ga0105245_10137771 | |||
| 1016 | Ga0105245_10141124 | |||
| 1017 | Ga0105245_12791580 | |||
| 1018 | Ga0105247_10000628 | |||
| 1019 | Ga0105247_10209538 | |||
| 1020 | Ga0105247_10286177 | |||
| 1021 | Ga0105247_11619562 | |||
| 1022 | Ga0105247_11738989 | |||
| 1023 | Ga0114129_10082951 | |||
| 1024 | Ga0114129_10231345 | |||
| 1025 | Ga0114129_10743987 | |||
| 1026 | Ga0114129_11648002 | |||
| 1027 | Ga0114129_12048868 | |||
| 1028 | Ga0114129_12586336 | |||
| 1029 | Ga0105243_10222191 | |||
| 1030 | Ga0105241_11890639 | |||
| 1031 | Ga0105242_10002291 | |||
| 1032 | Ga0105242_10002368 | |||
| 1033 | Ga0105242_11327429 | |||
| 1034 | Ga0105242_11532152 | |||
| 1035 | Ga0105242_12419626 | |||
| 1036 | Ga0105248_10000008 | |||
| 1037 | Ga0105248_12912780 | |||
| 1038 | Ga0105237_12569542 | |||
| 1039 | Ga0105238_10000011 | |||
| 1040 | Ga0105238_11002085 | |||
| 1041 | Ga0105249_10000203 | |||
| 1042 | Ga0105249_10146424 | |||
| 1043 | Ga0105249_10429558 | |||
| 1044 | Ga0105249_10580978 | |||
| 1045 | Ga0105249_11780049 | |||
| 1046 | Ga0105239_10082846 | |||
| 1047 | Ga0105239_10282146 | |||
| 1048 | Ga0105239_10948264 | |||
| 1049 | Ga0105239_11079529 | |||
| 1050 | Ga0105239_12490731 | |||
| 1051 | Ga0105246_10424481 | |||
| 1052 | Ga0157373_10695412 | |||
| 1053 | Ga0157371_10035878 | |||
| 1054 | Ga0157371_10753955 | |||
| 1055 | Ga0157371_11336492 | |||
| 1056 | Ga0157370_10042255 | |||
| 1057 | Ga0157370_10170974 | |||
| 1058 | Ga0157370_10734257 | |||
| 1059 | Ga0157370_10756295 | |||
| 1060 | Ga0157369_10780165 | |||
| 1061 | Ga0157369_11451761 | |||
| 1062 | Ga0157374_10022748 | |||
| 1063 | Ga0157374_10797340 | |||
| 1064 | Ga0157374_12381030 | |||
| 1065 | Ga0157378_10023161 | |||
| 1066 | Ga0157378_10024233 | |||
| 1067 | Ga0157378_10044147 | |||
| 1068 | Ga0157378_10124098 | |||
| 1069 | Ga0157378_11245106 | |||
| 1070 | Ga0157372_10001384 | |||
| 1071 | Ga0157372_12502700 | |||
| 1072 | Ga0157375_10416509 | |||
| 1073 | Ga0157375_11413114 | |||
| 1074 | Ga0157375_11760536 | |||
| 1075 | Ga0157375_11946718 | |||
| 1076 | Ga0157375_12650677 | |||
| 1077 | Ga0163163_10388792 | |||
| 1078 | Ga0163163_10513059 | |||
| 1079 | Ga0157380_10000253 | |||
| 1080 | Ga0157380_10012178 | |||
| 1081 | Ga0157380_12516360 | |||
| 1082 | Ga0157377_10861657 | |||
| 1083 | Ga0157379_10072565 | |||
| 1084 | Ga0157379_10660883 | |||
| 1085 | Ga0157379_11168556 | |||
| 1086 | Ga0157376_10015687 | |||
| 1087 | Ga0157376_10141147 | |||
| 1088 | Ga0157376_11987518 | |||
| 1089 | Ga0163161_10000035 | |||
| 1090 | Ga0163161_10239993 | |||
| 1091 | Ga0154015_1268440 | |||
| 1092 | Ga0213873_10095258 | |||
| 1093 | Ga0213874_10021508 | |||
| 1094 | Ga0213874_10060808 | |||
| 1095 | Ga0213874_10097858 | |||
| 1096 | Ga0213876_10028058 | |||
| 1097 | Ga0213876_10043186 | |||
| 1098 | Ga0213876_10127026 | |||
| 1099 | Ga0213875_10113524 | |||
| 1100 | Ga0213875_10448132 | |||
| 1101 | Ga0207656_10014349 | |||
| 1102 | Ga0207653_10023647 | |||
| 1103 | Ga0207682_10001227 | |||
| 1104 | Ga0207692_10218943 | |||
| 1105 | Ga0207692_10231248 | |||
| 1106 | Ga0207642_10082984 | |||
| 1107 | Ga0207710_10000239 | |||
| 1108 | Ga0207710_10077022 | |||
| 1109 | Ga0207710_10201150 | |||
| 1110 | Ga0207710_10599375 | |||
| 1111 | Ga0207680_10015856 | |||
| 1112 | Ga0207680_10016106 | |||
| 1113 | Ga0207647_10320248 | |||
| 1114 | Ga0207699_10806234 | |||
| 1115 | Ga0207699_10816862 | |||
| 1116 | Ga0207643_10099817 | |||
| 1117 | Ga0207705_10398904 | |||
| 1118 | Ga0207654_10137478 | |||
| 1119 | Ga0207707_10016440 | |||
| 1120 | Ga0207707_11361582 | |||
| 1121 | Ga0207693_10038183 | |||
| 1122 | Ga0207693_10176374 | |||
| 1123 | Ga0207693_10740153 | |||
| 1124 | Ga0207663_10001197 | |||
| 1125 | Ga0207663_10126645 | |||
| 1126 | Ga0207663_10414441 | |||
| 1127 | Ga0207663_10466144 | |||
| 1128 | Ga0207660_10091942 | |||
| 1129 | Ga0207649_10000009 | |||
| 1130 | Ga0207652_10000044 | |||
| 1131 | Ga0207652_10000378 | |||
| 1132 | Ga0207694_10000004 | |||
| 1133 | Ga0207694_10740424 | |||
| 1134 | Ga0207650_10085403 | |||
| 1135 | Ga0207659_10000010 | |||
| 1136 | Ga0207687_10000013 | |||
| 1137 | Ga0207687_10001023 | |||
| 1138 | Ga0207687_10010273 | |||
| 1139 | Ga0207687_10130977 | |||
| 1140 | Ga0207700_10000027 | |||
| 1141 | Ga0207700_10996931 | |||
| 1142 | Ga0207664_10528248 | |||
| 1143 | Ga0207690_10046888 | |||
| 1144 | Ga0207690_10081792 | |||
| 1145 | Ga0207706_11663729 | |||
| 1146 | Ga0207686_10000048 | |||
| 1147 | Ga0207686_10001182 | |||
| 1148 | Ga0207686_10833005 | |||
| 1149 | Ga0207709_10007242 | |||
| 1150 | Ga0207670_10126582 | |||
| 1151 | Ga0207704_10000157 | |||
| 1152 | Ga0207704_10265530 | |||
| 1153 | Ga0207704_10463152 | |||
| 1154 | Ga0207704_11711323 | |||
| 1155 | Ga0207665_10062535 | |||
| 1156 | Ga0207665_10095576 | |||
| 1157 | Ga0207665_10992819 | |||
| 1158 | Ga0207691_10000044 | |||
| 1159 | Ga0207711_10000006 | |||
| 1160 | Ga0207711_10822340 | |||
| 1161 | Ga0207711_11238715 | |||
| 1162 | Ga0207661_10003433 | |||
| 1163 | Ga0207661_10065562 | |||
| 1164 | Ga0207661_10073128 | |||
| 1165 | Ga0207661_10113250 | |||
| 1166 | Ga0207661_10139465 | |||
| 1167 | Ga0207661_10911878 | |||
| 1168 | Ga0207679_10100465 | |||
| 1169 | Ga0207679_10209709 | |||
| 1170 | Ga0207667_10233850 | |||
| 1171 | Ga0207667_10234816 | |||
| 1172 | Ga0207712_10000007 | |||
| 1173 | Ga0207712_10324630 | |||
| 1174 | Ga0207712_10774708 | |||
| 1175 | Ga0207712_10956409 | |||
| 1176 | Ga0207668_10139436 | |||
| 1177 | Ga0207668_10554347 | |||
| 1178 | Ga0207668_11142055 | |||
| 1179 | Ga0207640_10000200 | |||
| 1180 | Ga0207640_10029132 | |||
| 1181 | Ga0207658_10018315 | |||
| 1182 | Ga0207658_10334450 | |||
| 1183 | Ga0207658_10341840 | |||
| 1184 | Ga0207658_10739420 | |||
| 1185 | Ga0207677_10157951 | |||
| 1186 | Ga0207703_10000023 | |||
| 1187 | Ga0207703_11813576 | |||
| 1188 | Ga0207639_10023285 | |||
| 1189 | Ga0207639_10098967 | |||
| 1190 | Ga0207639_10242103 | |||
| 1191 | Ga0207639_10303282 | |||
| 1192 | Ga0207678_10017647 | |||
| 1193 | Ga0207678_10140820 | |||
| 1194 | Ga0207678_11983391 | |||
| 1195 | Ga0207678_12032590 | |||
| 1196 | Ga0207702_10000060 | |||
| 1197 | Ga0207702_10009975 | |||
| 1198 | Ga0207702_10156205 | |||
| 1199 | Ga0207702_11468283 | |||
| 1200 | Ga0207702_12443152 | |||
| 1201 | Ga0207641_10000405 | |||
| 1202 | Ga0207641_10013802 | |||
| 1203 | Ga0207641_11570488 | |||
| 1204 | Ga0207674_10144261 | |||
| 1205 | Ga0207675_100036712 | |||
| 1206 | Ga0207675_100443897 | |||
| 1207 | Ga0207675_101238418 | |||
| 1208 | Ga0207683_10010970 | |||
| 1209 | Ga0207683_10396512 | |||
| 1210 | Ga0207683_10467340 | |||
| 1211 | Ga0207698_10000440 | |||
| 1212 | Ga0207698_11523386 | |||
| 1213 | Ga0209813_10452878 | |||
| 1214 | Ga0207428_10368037 | |||
| 1215 | Ga0207428_10395457 | |||
| 1216 | Ga0207428_10871828 | |||
| 1217 | Ga0268266_10000047 | |||
| 1218 | Ga0268266_10000527 | |||
| 1219 | Ga0268266_10039181 | |||
| 1220 | Ga0268266_10132888 | |||
| 1221 | Ga0268266_10322959 | |||
| 1222 | Ga0268266_11918541 | |||
| 1223 | Ga0265337_1000584 | |||
| 1224 | Ga0265326_10000749 | |||
| 1225 | Ga0265319_1000122 | |||
| 1226 | Ga0265318_10100417 | |||
| 1227 | Ga0265323_10039981 | |||
| 1228 | Ga0265322_10000001 | |||
| 1229 | Ga0265322_10050574 | |||
| 1230 | Ga0265336_10011583 | |||
| 1231 | Ga0265338_10000706 | |||
| 1232 | Ga0265338_10449124 | |||
| 1233 | Ga0265324_10000498 | |||
| 1234 | Ga0265332_10015191 | |||
| 1235 | Ga0265328_10000580 | |||
| 1236 | Ga0265320_10000002 | |||
| 1237 | Ga0265329_10004058 | |||
| 1238 | Ga0265331_10001492 | |||
| 1239 | Ga0265331_10067495 | |||
| 1240 | Ga0265327_10000011 | |||
| 1241 | Ga0265316_10005389 | |||
| 1242 | Ga0265314_10000062 | |||
| 1243 | Ga0265342_10148722 | |||
| 1244 | Ga0316576_10310576 | |||
| 1245 | Ga0307414_11727596 | |||
| 1246 | Ga0373945_0197675 | |||
| 1247 | Ga0373953_0216770 | |||
| 1248 | Ga0373956_0605558 | |||
| 1249 | Ga0373955_0336992 | |||
| 1250 | Ga0316574_0119436 | |||
| 1251 | Ga0373933_0366099 | |||
| 1252 | Ga0373937_0016501 | |||
| 1253 | Ga0373937_0020559 | |||
| 1254 | Ga0373937_0061433 | |||
| 1255 | Ga0373937_0393160 | |||
| 1256 | Ga0373937_0496949 | |||
| 1257 | Ga0373937_0579182 | |||
| 1258 | Ga0316584_0003480 | |||
| 1259 | Ga0395899_0031761 | |||
| 1260 | Ga0395899_0292053 | |||
| 1261 | Ga0395899_0608752 | |||
| 1262 | Ga0395900_0121469 | |||
| 1263 | Ga0395900_0238247 | |||
| 1264 | Ga0395898_0022321 | |||
| 1265 | Ga0395898_0440057 | |||
| 1266 | Ga0395898_0629917 | |||
| 1267 | Ga0395898_1257819 | |||
| 1268 | Ga0395905_0011529 | |||
| 1269 | Ga0395905_1215943 | |||
| 1270 | Ga0395905_1609114 | |||
| 1271 | Ga0436364_1456585 | |||
| 1272 | Ga0436364_1543506 | |||
| 1273 | Ga0395901_0042100 | |||
| 1274 | Ga0395901_0189842 | |||
| 1275 | Ga0395901_0607361 | |||
| 1276 | Ga0395901_0891884 | |||
| 1277 | Ga0395901_1384925 | |||
| 1278 | Ga0395901_1822611 | |||
| 1279 | Ga0436365_0701598 | |||
| 1280 | Ga0436365_0851257 | |||
| 1281 | Ga0436365_0861691 | |||
| 1282 | Ga0436365_1024354 | |||
| 1283 | Ga0436360_0920718 | |||
| 1284 | Ga0436363_0385095 | |||
| 1285 | Ga0436363_0624775 | |||
| 1286 | Ga0436363_1444359 | |||
| 1287 | Ga0436363_1499909 | |||
| 1288 | Ga0436363_1521243 | |||
| 1289 | Ga0436363_1525923 | |||
| 1290 | Ga0436362_0773470 | |||
| 1291 | Ga0451798_0005205 | |||
| 1292 | Ga0451800_1222739 | |||
| 1293 | Ga0451802_1560443 | |||
| 1294 | Ga0451804_0693844 | |||
| 1295 | Ga0451807_2044318 | |||
| 1296 | Ga0451833_0427862 | |||
| 1297 | Ga0451835_0618987 | |||
| 1298 | Ga0451837_1034507 | |||
| 1299 | Ga0451845_0953814 | |||
| 1300 | Ga0451847_0350639 | |||
| 1301 | Ga0451849_0155720 | |||
| 1302 | Ga0451853_1624115 | |||
| 1303 | Ga0451853_2416189 | |||
| 1304 | Ga0451853_2712544 | |||
| 1305 | Ga0451853_3909198 | |||
| 1306 | Ga0466969_0146416 | |||
| 1307 | Ga0466961_0314314 | |||
| 1308 | Ga0466963_0000001 | |||
| 1309 | Ga0466963_0190332 | |||
| 1310 | Ga0466963_0253323 | |||
| 1311 | Ga0466964_0567514 | |||
| 1312 | Ga0466964_0677211 | |||
| 1313 | Ga0466964_0752571 | |||
| 1314 | Ga0466957_0082258 | |||
| 1315 | Ga0466957_0167907 | |||
| 1316 | Ga0466957_0779349 | |||
| 1317 | Ga0466959_0087897 | |||
| 1318 | Ga0466959_0716297 | |||
| 1319 | Ga0466958_0016555 | |||
| 1320 | Ga0466958_0027332 | |||
| 1321 | Ga0466958_0894251 | |||
| 1322 | Ga0466967_0000009 | |||
| 1323 | Ga0466967_0004934 | |||
| 1324 | Ga0466967_0111803 | |||
| 1325 | Ga0466967_0444218 | |||
| 1326 | Ga0466967_1452615 | |||
| 1327 | Ga0466967_1660012 | |||
| 1328 | Ga0466967_2314802 | |||
| 1329 | Ga0495592_0000141 | |||
| 1330 | Ga0495592_0065649 | |||
| 1331 | Ga0495592_0094617 | |||
| 1332 | Ga0495592_0558042 | |||
| 1333 | Ga0495603_0000016 | |||
| 1334 | Ga0495603_0002427 | |||
| 1335 | Ga0495629_0002683 | |||
| 1336 | Ga0495629_0005201 | |||
| 1337 | Ga0495629_0037535 | |||
| 1338 | Ga0495629_0050385 | |||
| 1339 | Ga0495629_0376733 | |||
| 1340 | Ga0495638_0056479 | |||
| 1341 | Ga0495641_0000874 | |||
| 1342 | Ga0495641_0091358 | |||
| 1343 | Ga0495641_0229880 | |||
| 1344 | Ga0495641_0274649 | |||
| 1345 | Ga0495641_0415929 | |||
| 1346 | Ga0495651_0080298 | |||
| 1347 | Ga0495651_0127135 | |||
| 1348 | Ga0495653_0029967 | |||
| 1349 | Ga0495653_0258187 | |||
| 1350 | Ga0495653_0386684 | |||
| 1351 | Ga0495653_0678988 | |||
| 1352 | Ga0495582_0011642 | |||
| 1353 | Ga0495605_0490074 | |||
| 1354 | Ga0495639_0112717 | |||
| 1355 | Ga0495662_0002209 | |||
| 1356 | Ga0495662_0012662 | |||
| 1357 | Ga0495664_0111071 | |||
| 1358 | Ga0495664_0533901 | |||
| 1359 | Ga0495594_0302721 | |||
| 1360 | Ga0495606_0000565 | |||
| 1361 | Ga0495608_0008716 | |||
| 1362 | Ga0495608_0404885 | |||
| 1363 | Ga0495610_0154651 | |||
| 1364 | Ga0495618_0000129 | |||
| 1365 | Ga0495618_0159651 | |||
| 1366 | Ga0495620_0000436 | |||
| 1367 | Ga0495628_0000190 | |||
| 1368 | Ga0495628_0002436 | |||
| 1369 | Ga0495628_0036680 | |||
| 1370 | Ga0495628_0102784 | |||
| 1371 | Ga0495628_0156773 | |||
| 1372 | Ga0495628_0163316 | |||
| 1373 | Ga0495630_0000056 | |||
| 1374 | Ga0495630_0012401 | |||
| 1375 | Ga0495630_0101275 | |||
| 1376 | Ga0495630_0204112 | |||
| 1377 | Ga0495644_0009477 | |||
| 1378 | Ga0495652_0000546 | |||
| 1379 | Ga0495652_0004685 | |||
| 1380 | Ga0495652_0386447 | |||
| 1381 | Ga0495652_0386738 | |||
| 1382 | Ga0495640_0015403 | |||
| 1383 | Ga0495640_0195063 | |||
| 1384 | Ga0495640_0345321 | |||
| 1385 | Ga0495640_0851158 | |||
| 1386 | Ga0495586_0008925 | |||
| 1387 | Ga0495587_0003427 | |||
| 1388 | Ga0495587_0120489 | |||
| 1389 | Ga0495587_0444064 | |||
| 1390 | Ga0495598_0004686 | |||
| 1391 | Ga0495609_0263778 | |||
| 1392 | Ga0495621_0015075 | |||
| 1393 | Ga0495645_0019514 | |||
| 1394 | Ga0495645_0126912 | |||
| 1395 | Ga0495645_0228847 | |||
| 1396 | Ga0495645_0232945 | |||
| 1397 | Ga0495667_0000018 | |||
| 1398 | Ga0495667_0351376 | |||
| 1399 | Ga0495634_0006771 | |||
| 1400 | Ga0495634_0007615 | |||
| 1401 | Ga0495634_0072099 | |||
| 1402 | Ga0495634_0143753 | |||
| 1403 | Ga0495634_0348299 | |||
| 1404 | Ga0495625_0734157 | |||
| 1405 | Ga0495635_0000044 | |||
| 1406 | Ga0495635_0069299 | |||
| 1407 | Ga0495588_0000165 | |||
| 1408 | Ga0495588_0354864 | |||
| 1409 | Ga0495657_0000004 | |||
| 1410 | Ga0495657_0140482 | |||
| 1411 | Ga0495599_0113154 | |||
| 1412 | Ga0495623_0073854 | |||
| 1413 | Ga0495647_0000018 | |||
| 1414 | Ga0495647_0000904 | |||
| 1415 | Ga0495647_0015755 | |||
| 1416 | Ga0495647_0114642 | |||
| 1417 | Ga0495658_0001635 | |||
| 1418 | Ga0495669_0000033 | |||
| 1419 | Ga0495613_0000179 | |||
| 1420 | Ga0495613_0000200 | |||
| 1421 | Ga0495613_0432972 | |||
| 1422 | Ga0495624_0000073 | |||
| 1423 | Ga0495624_0000097 | |||
| 1424 | Ga0495624_0004587 | |||
| 1425 | Ga0495624_0110992 | |||
| 1426 | Ga0495649_0000751 | |||
| 1427 | Ga0495649_0361792 | |||
| 1428 | Ga0495589_0578970 | |||
| 1429 | Ga0495600_0001315 | |||
| 1430 | Ga0495600_0026988 | |||
| 1431 | Ga0495600_0116660 | |||
| 1432 | Ga0495600_0515267 | |||
| 1433 | Ga0495600_0900957 | |||
| 1434 | Ga0495604_0000055 | |||
| 1435 | Ga0495604_0000357 | |||
| 1436 | Ga0495604_0030874 | |||
| 1437 | Ga0495674_0065539 | |||
| 1438 | Ga0495672_0480684 | |||
| 1439 | Ga0495676_0025439 | |||
| 1440 | Ga0495676_0063988 | |||
| 1441 | Ga0495676_0097203 | |||
| 1442 | Ga0495676_0301607 | |||
| 1443 | Ga0495676_0438834 | |||
| 1444 | Ga0495680_0000496 | |||
| 1445 | Ga0495680_0001969 | |||
| 1446 | Ga0495680_0015856 | |||
| 1447 | Ga0495680_0019801 | |||
| 1448 | Ga0495680_0020281 | |||
| 1449 | Ga0495675_0000175 | |||
| 1450 | Ga0495675_0223734 | |||
| 1451 | Ga0495685_135880 | |||
| 1452 | Ga0495673_0169152 | |||
| 1453 | Ga0495684_0584487 | |||
| 1454 | Ga0495684_0758649 | |||
| 1455 | Ga0495686_0331133 | |||
| 1456 | Ga0495593_0150512 | |||
| 1457 | Ga0495593_0188696 | |||
| 1458 | Ga0495602_0000041 | |||
| 1459 | Ga0495602_0005883 | |||
| 1460 | Ga0495602_0208584 | |||
| 1461 | Ga0495602_0295952 | |||
| 1462 | Ga0495602_0953008 | |||
| 1463 | Ga0495614_0200947 | |||
| 1464 | Ga0496100_0000002 | |||
| 1465 | Ga0496100_0000018 | |||
| 1466 | Ga0496100_0030273 | |||
| 1467 | Ga0496101_0000001 | |||
| 1468 | Ga0496101_0000062 | |||
| 1469 | Ga0496101_0013193 | |||
| 1470 | Ga0496101_0037762 | |||
| 1471 | Ga0496102_0000039 | |||
| 1472 | Ga0496102_0210291 | |||
| 1473 | Ga0496102_0652607 | |||
| 1474 | Ga0496103_0000008 | |||
| 1475 | Ga0496103_0008690 | |||
| 1476 | Ga0496103_0118686 | |||
| 1477 | Ga0496104_0000004 | |||
| 1478 | Ga0496104_0000009 | |||
| 1479 | Ga0496104_0000650 | |||
| 1480 | Ga0496104_0002254 | |||
| 1481 | Ga0496104_0143943 | |||
| 1482 | Ga0496105_0000001 | |||
| 1483 | Ga0496105_0000007 | |||
| 1484 | Ga0496105_0000347 | |||
| 1485 | Ga0496105_0006887 | |||
| 1486 | Ga0496105_0377651 | |||
| 1487 | Ga0496105_0717106 | |||
| 1488 | Ga0496106_0000061 | |||
| 1489 | Ga0496106_0000122 | |||
| 1490 | Ga0496106_0000312 | |||
| 1491 | Ga0496106_0003774 | |||
| 1492 | Ga0496106_0260212 | |||
| 1493 | Ga0496106_1127764 | |||
| 1494 | Ga0496107_0000006 | |||
| 1495 | Ga0496107_0000013 | |||
| 1496 | Ga0496107_0015373 | |||
| 1497 | Ga0496107_0067988 | |||
| 1498 | Ga0496107_0884196 | |||
| 1499 | Ga0496108_0000001 | |||
| 1500 | Ga0496108_0000062 | |||
| 1501 | Ga0496108_0033537 | |||
| 1502 | Ga0496109_0000003 | |||
| 1503 | Ga0496109_0000121 | |||
| 1504 | Ga0496109_0000129 | |||
| 1505 | Ga0496109_0235820 | |||
| 1506 | Ga0496109_0257313 | |||
| 1507 | Ga0496109_0717293 | |||
| 1508 | Ga0496109_0931933 | |||
| 1509 | Ga0496109_1010661 | |||
| 1510 | Ga0496110_0000089 | |||
| 1511 | Ga0496110_0040973 | |||
| 1512 | Ga0496110_0138590 | |||
| 1513 | Ga0496110_0392136 | |||
| 1514 | Ga0496110_0623855 | |||
| 1515 | Ga0496111_0003847 | |||
| 1516 | Ga0496111_0411166 | |||
| 1517 | Ga0496112_0001770 | |||
| 1518 | Ga0496112_0012374 | |||
| 1519 | Ga0496113_0000628 | |||
| 1520 | Ga0496113_0158832 | |||
| 1521 | Ga0496113_0297946 | |||
| 1522 | Ga0496114_0000014 | |||
| 1523 | Ga0496114_0006959 | |||
| 1524 | Ga0496114_0011449 | |||
| 1525 | Ga0496114_0338929 | |||
| 1526 | Ga0496114_1632719 | |||
| 1527 | Ga0496115_0000003 | |||
| 1528 | Ga0496115_0004217 | |||
| 1529 | Ga0496115_0021854 | |||
| 1530 | Ga0496116_0001565 | |||
| 1531 | Ga0496118_0000818 | |||
| 1532 | Ga0496118_0065926 | |||
| 1533 | Ga0496119_0005786 | |||
| 1534 | Ga0496119_0013028 | |||
| 1535 | Ga0496119_0023319 | |||
| 1536 | Ga0496120_0005134 | |||
| 1537 | Ga0496120_0163355 | |||
| 1538 | Ga0496121_0006714 | |||
| 1539 | Ga0496121_0064471 | |||
| 1540 | Ga0496121_0605527 | |||
| 1541 | Ga0496124_0054064 | |||
| 1542 | Ga0496124_0121825 | |||
| 1543 | Ga0496124_0354749 | |||
| 1544 | Ga0496125_0082480 | |||
| 1545 | Ga0496125_0132735 | |||
| 1546 | Ga0496126_0125448 | |||
| 1547 | Ga0496126_0139139 | |||
| 1548 | Ga0496126_0249606 | |||
| 1549 | Ga0496126_0559172 | |||
| 1550 | Ga0501031_0006434 | |||
| 1551 | Ga0501031_0032539 | |||
| 1552 | Ga0501031_0229071 | |||
| 1553 | Ga0501031_1025853 | |||
| 1554 | Ga0501032_0001678 | |||
| 1555 | Ga0501032_0556594 | |||
| 1556 | Ga0501033_0003865 | |||
| 1557 | Ga0501036_0003053 | |||
| 1558 | Ga0501036_0270235 | |||
| 1559 | Ga0501036_0450681 | |||
| 1560 | Ga0501037_0006405 | |||
| 1561 | Ga0501037_0162734 | |||
| 1562 | Ga0501037_0213765 | |||
| 1563 | Ga0501037_1068089 | |||
| 1564 | Ga0501038_0006019 | |||
| 1565 | Ga0501039_0060637 | |||
| 1566 | Ga0501039_0853631 | |||
| 1567 | Ga0501039_0968021 | |||
| 1568 | Ga0501040_0136864 | |||
| 1569 | Ga0501040_0140045 | |||
| 1570 | Ga0501040_0181450 | |||
| 1571 | Ga0501041_0029844 | |||
| 1572 | Ga0501042_0020168 | |||
| 1573 | Ga0501042_0101007 | |||
| 1574 | Ga0501042_0233327 | |||
| 1575 | Ga0501042_0670526 | |||
| 1576 | Ga0501043_0005761 | |||
| 1577 | Ga0501043_0324280 | |||
| 1578 | Ga0501046_0004837 | |||
| 1579 | Ga0501047_0003503 | |||
| 1580 | Ga0501047_0075325 | |||
| 1581 | Ga0501047_0190208 | |||
| 1582 | Ga0501047_0205408 | |||
| 1583 | Ga0501047_0308141 | |||
| 1584 | Ga0501047_0753796 | |||
| 1585 | Ga0501048_0002374 | |||
| 1586 | Ga0501048_0189752 | |||
| 1587 | Ga0501048_0749800 | |||
| 1588 | Ga0501048_0836383 | |||
| 1589 | Ga0501068_0026058 | |||
| 1590 | Ga0501068_0095507 | |||
| 1591 | Ga0501068_0366614 | |||
| 1592 | Ga0501069_0047323 | |||
| 1593 | Ga0501069_0055315 | |||
| 1594 | Ga0501070_0000494 | |||
| 1595 | Ga0501070_0026871 | |||
| 1596 | Ga0501070_0082400 | |||
| 1597 | Ga0501070_0370807 | |||
| 1598 | Ga0501070_1529547 | |||
| 1599 | Ga0501071_0024056 | |||
| 1600 | Ga0501071_0039228 | |||
| 1601 | Ga0501071_0049503 | |||
| 1602 | Ga0501072_0067529 | |||
| 1603 | Ga0501072_0401493 | |||
| 1604 | Ga0501072_0419551 | |||
| 1605 | Ga0501072_1324803 | |||
| 1606 | Ga0501072_1418510 | |||
| 1607 | Ga0501073_0006754 | |||
| 1608 | Ga0501074_0015390 | |||
| 1609 | Ga0501074_0045664 | |||
| 1610 | Ga0501074_0165069 | |||
| 1611 | Ga0501074_0457771 | |||
| 1612 | Ga0501075_0000990 | |||
| 1613 | Ga0501075_0054065 | |||
| 1614 | Ga0501075_0155053 | |||
| 1615 | Ga0501075_0435521 | |||
| 1616 | Ga0501075_1020268 | |||
| 1617 | Ga0501075_1206083 | |||
| 1618 | Ga0501077_0125313 | |||
| 1619 | Ga0501077_0527056 | |||
| 1620 | Ga0501079_0016140 | |||
| 1621 | Ga0501079_0043241 | |||
| 1622 | Ga0501079_0059289 | |||
| 1623 | Ga0501079_0434555 | |||
| 1624 | Ga0501079_1287747 | |||
| 1625 | Ga0501079_1652202 | |||
| 1626 | Ga0501080_0101268 | |||
| 1627 | Ga0501080_0122471 | |||
| 1628 | Ga0501081_0120289 | |||
| 1629 | Ga0501081_0305789 | |||
| 1630 | Ga0501081_0627125 | |||
| 1631 | Ga0501081_0969419 | |||
| 1632 | Ga0501083_0025710 | |||
| 1633 | Ga0501083_0047096 | |||
| 1634 | Ga0501083_0146811 | |||
| 1635 | Ga0501083_0308285 | |||
| 1636 | Ga0501035_0000718 | |||
| 1637 | Ga0501035_0612319 | |||
| 1638 | Ga0501035_0942078 | |||
| 1639 | Ga0501044_0012374 | |||
| 1640 | Ga0501044_0082888 | |||
| 1641 | Ga0501044_0177281 | |||
| 1642 | Ga0501045_0080388 | |||
| 1643 | Ga0501045_0417652 | |||
| 1644 | Ga0501045_0622456 | |||
| 1645 | Ga0501045_0719910 | |||
| 1646 | Ga0501045_1362587 | |||
| 1647 | nmdc:mga03n38_210351_c1 | |||
| 1648 | nmdc:mga04h51_166687_c1 | |||
| 1649 | nmdc:mga04h51_432516_c1 | |||
| 1650 | nmdc:mga05p37_1135471_c1 | |||
| 1651 | nmdc:mga05p37_303733_c1 | |||
| 1652 | nmdc:mga05p37_616143_c1 | |||
| 1653 | nmdc:mga09592_228396_c1 | |||
| 1654 | nmdc:mga0qj67_277829_c1 | |||
| 1655 | nmdc:mga06r32_1218100_c1 | |||
| 1656 | nmdc:mga06r32_18690_c1 | |||
| 1657 | nmdc:mga06r32_522948_c1 | |||
| 1658 | nmdc:mga06r32_663143_c1 | |||
| 1659 | nmdc:mga08y16_120556_c1 | |||
| 1660 | nmdc:mga08y16_652238_c1 | |||
| 1661 | nmdc:mga0n895_15112_c1 | |||
| 1662 | nmdc:mga0n895_1625532_c1 | |||
| 1663 | nmdc:mga0rr50_232321_c1 | |||
| 1664 | nmdc:mga0a205_24_c2 | |||
| 1665 | nmdc:mga0a205_923984_c1 | |||
| 1666 | Ga0495601_0000013 | |||
| 1667 | Ga0495601_0000264 | |||
| 1668 | Ga0495601_0030912 | |||
| 1669 | Ga0495601_0055497 | |||
| 1670 | Ga0495601_0057341 | |||
| 1671 | Ga0495601_0632326 | |||
| 1672 | Ga0495601_0791215 | |||
| 1673 | Ga0495601_1016644 | |||
| 1674 | Ga0495612_0000060 | |||
| 1675 | Ga0495612_0001051 | |||
| 1676 | Ga0495612_0027520 | |||
| 1677 | Ga0495612_0032800 | |||
| 1678 | Ga0500635_0153442 | |||
| 1679 | Ga0495655_0003139 | |||
| 1680 | Ga0495655_0199928 | |||
| 1681 | Ga0495595_0000003 | |||
| 1682 | Ga0495595_0000053 | |||
| 1683 | Ga0495595_0222926 | |||
| 1684 | Ga0495595_0421500 | |||
| 1685 | Ga0495619_0000031 | |||
| 1686 | Ga0495619_0000257 | |||
| 1687 | Ga0495619_0001230 | |||
| 1688 | Ga0495619_0003227 | |||
| 1689 | Ga0495619_0022451 | |||
| 1690 | Ga0500566_0194541 | |||
| 1691 | Ga0500554_191526 | |||
| 1692 | Ga0500572_072649 | |||
| 1693 | Ga0500595_011934 | |||
| 1694 | Ga0500595_052522 | |||
| 1695 | Ga0500614_001576 | |||
| 1696 | Ga0500658_0191770 | |||
| 1697 | Ga0501084_0036933 | |||
| 1698 | Ga0501084_0151099 | |||
| 1699 | Ga0501084_1020121 | |||
| 1700 | Ga0501084_1196071 | |||
| 1701 | Ga0501082_0020789 | |||
| 1702 | Ga0501082_0853851 | |||
| 1703 | Ga0501082_0864393 | |||
| 1704 | Ga0501082_1693646 | |||
| 1705 | Ga0530510_0004432 | |||
| 1706 | Ga0530510_0024130 | |||
| 1707 | Ga0530510_0446045 | |||
| 1708 | Ga0530510_1455564 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7oq4-assembly1.cif.gz_D | cryo-em structure of the atv rnap inhibitory protein (rip) bound to the dna-binding channel of the host's rna polymerase | 0.828 | 8 | 73 |
| 2y0s-assembly2.cif.gz_D | crystal structure of sulfolobus shibatae rna polymerase in p21 space group | 0.8247 | 8 | 73 |
| 8him-assembly1.cif.gz_C | a cryo-em structure of b. oleracea rna polymerase v elongation complex at 2.73 angstrom | 0.8188 | 9 | 72 |
| 7ok0-assembly1.cif.gz_D | cryo-em structure of the sulfolobus acidocaldarius rna polymerase at 2.88 a | 0.8105 | 8 | 73 |
| 8hil-assembly1.cif.gz_C | a cryo-em structure of b. oleracea rna polymerase v at 3.57 angstrom | 0.8089 | 8 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1M1X0_1554_1671_2.60.60.20 | Mainly Beta;Sandwich;Lipoxygenase-1;PLAT/LH2 domain | 0.8857 | 68 | 79 | 2.60.60.20 |
| 2y0sD03 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8397 | 8 | 71 | 3.30.70.20 |
| af_F1QC84_516_627_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8145 | 68 | 79 | 2.60.40.10 |
| 2y0sD03 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7889 | 8 | 71 | 3.30.70.20 |
| af_Q8IHT3_226_284_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7803 | 24 | 64 | 3.30.70.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4S654-F1-model_v4 | 4Fe-4S ferredoxin-type domain-containing protein | 1.006 | 7 | 79 |
|
| AF-A0A6J4SB94-F1-model_v4 | 4Fe-4S ferredoxin-type domain-containing protein | 1.002 | 7 | 80 |
|
| AF-A0A7V8WAV0-F1-model_v4 | 4Fe-4S ferredoxin-type domain-containing protein | 0.9971 | 7 | 79 |
|
| AF-A0A7V9EBU3-F1-model_v4 | 4Fe-4S ferredoxin-type domain-containing protein | 0.9963 | 7 | 79 |
|
| AF-A0A537Z830-F1-model_v4 | 4Fe-4S ferredoxin-type domain-containing protein | 0.9938 | 7 | 79 |
|