F483591
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 854 | 394 | 1708 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300046452|Ga0495617_031435|Ga0495617_031435_723_1745 |
| Length | 340 |
| Sequence | MRPAKSIQYLAPAYRPKSETFVTADLACRAKLLIMARPSVCKELLMRRLLTGCFVTLLLLLNTLILIGPLLVFALLKLVAPGRWRDYASGAVMWIAETWAEIDKLIFRLCIPTQWDIRGGEDLRGDTSYLVVSNHQSWVDIPALIQTLNRRTPFFKFFLKKELIWVPFLGLAWWALDYPFMKRYTKAFLAKHPELAGKDLEITKQACELFKRQPVTVVNYLEGTRYTAAKSAQQQSPFKHLLKPKAGGVAFVLAAMGEQLDAILDVTVVYPQAKIPGFWDLISGNVPRVIIDIKTRELDPALWQGDYENDPAFRQKVQSWVNQLWNEKDQRIAELRSERG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 10 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 38 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 39 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 56 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 92 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 93 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 99 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 100 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 104 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 105 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 107 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 108 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 109 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 110 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 114 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 115 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 116 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 117 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 118 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 119 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 120 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 121 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 122 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 123 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 124 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 125 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 126 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 127 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 128 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 129 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 130 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 131 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 132 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 133 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 134 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 135 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 136 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 137 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 138 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 211 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 212 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 213 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 214 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 215 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 216 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 217 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 218 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 230 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 231 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 232 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 233 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 234 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 235 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 236 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 237 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 238 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 239 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 240 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 241 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 242 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 243 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 244 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 245 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 246 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 247 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 248 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 249 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 250 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 251 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 252 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 253 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 254 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 255 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 256 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 257 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 258 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 259 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 260 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 261 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 262 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 263 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 264 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 265 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 266 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 267 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 268 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 269 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 270 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 271 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 272 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 273 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 274 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 275 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 276 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 277 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 278 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 279 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 280 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 281 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 282 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 283 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 284 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 285 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 286 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 287 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 288 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 289 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 290 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 291 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 292 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 293 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 294 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 295 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 296 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 297 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 298 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 299 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 300 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 301 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 302 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 303 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 304 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 305 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 306 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 307 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 308 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 309 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 310 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 311 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 312 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 313 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 314 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 315 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 316 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 317 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 318 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 319 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 320 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 321 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 322 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 323 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 324 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 325 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 326 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 327 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 328 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 329 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 330 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 331 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 332 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 333 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 334 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 335 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 336 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 337 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 338 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 339 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 340 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 341 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 342 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 343 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 344 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 345 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 346 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 347 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 348 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 349 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 350 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 351 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 352 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 353 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 354 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 355 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 356 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 357 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 358 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 359 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 360 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 361 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 362 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 363 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 364 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 365 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 366 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 367 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 368 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 369 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 370 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 371 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 372 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 373 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 374 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 375 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 376 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 377 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 378 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 379 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 380 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 381 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 382 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 383 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 384 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 385 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 386 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 387 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 388 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 389 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 390 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 391 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 392 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 393 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 394 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.91 |
| Metatranscriptomes | 0.23 |
| Isolates | 18.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 7.03 |
| Nodule | 2.22 |
| Rhizoplane | 1.99 |
| Rhizosphere | 74.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495617_031435 | 3300046452 | Bacteria | 1782 |
| 2 | MRS2a_Contig_1749 | 2124908027 | Bacteria | 2302 |
| 3 | JGI24741J21665_1002957 | 3300001915 | Bacteria | 4235 |
| 4 | JGI25162J39368_1000076 | 3300002737 | Bacteria | 120246 |
| 5 | JGI25162J39368_1000104 | 3300002737 | Bacteria | 93706 |
| 6 | JGI25154J39366_1005394 | 3300002738 | Bacteria | 2050 |
| 7 | JGI25163J39215_1000198 | 3300002771 | Bacteria | 23415 |
| 8 | JGI25164J39214_1000083 | 3300002772 | Bacteria | 93706 |
| 9 | JGI25164J39214_1000084 | 3300002772 | Bacteria | 93684 |
| 10 | JGI25165J46597_1000140 | 3300003214 | Bacteria | 120246 |
| 11 | JGI25165J46597_1000186 | 3300003214 | Bacteria | 93706 |
| 12 | Ga0006562J51391_1056221 | 3300003578 | Bacteria | 5370 |
| 13 | Ga0006562J51391_1056222 | 3300003578 | Bacteria | 8660 |
| 14 | Ga0055538_1000074 | 3300003751 | Bacteria | 90292 |
| 15 | Ga0055539_1000112 | 3300003752 | Bacteria | 90292 |
| 16 | Ga0055533_1000118 | 3300003756 | Bacteria | 90292 |
| 17 | Ga0055532_1000106 | 3300003758 | Bacteria | 90264 |
| 18 | Ga0055525_1000157 | 3300003759 | Bacteria | 90292 |
| 19 | Ga0055535_1002953 | 3300003761 | Bacteria | 5254 |
| 20 | Ga0055536_1000289 | 3300003781 | Bacteria | 38013 |
| 21 | Ga0055536_1000620 | 3300003781 | Bacteria | 24134 |
| 22 | Ga0055536_1000625 | 3300003781 | Bacteria | 24031 |
| 23 | Ga0055530_10000389 | 3300003791 | Bacteria | 39450 |
| 24 | Ga0055530_10000757 | 3300003791 | Bacteria | 26909 |
| 25 | Ga0055530_10001107 | 3300003791 | Bacteria | 21076 |
| 26 | Ga0055540_1000259 | 3300003792 | Bacteria | 47811 |
| 27 | Ga0055540_1000366 | 3300003792 | Bacteria | 38001 |
| 28 | Ga0055540_1001425 | 3300003792 | Bacteria | 14249 |
| 29 | Ga0055531_10000109 | 3300003794 | Bacteria | 89901 |
| 30 | Ga0055541_1000075 | 3300003841 | Bacteria | 90292 |
| 31 | Ga0058692_1010636 | 3300003856 | Bacteria | 2265 |
| 32 | Ga0065714_10000526 | 3300005288 | Bacteria | 4018 |
| 33 | Ga0065714_10006723 | 3300005288 | Bacteria | 3164 |
| 34 | Ga0065714_10079851 | 3300005288 | Bacteria | 2480 |
| 35 | Ga0065714_10095472 | 3300005288 | Bacteria | 1785 |
| 36 | Ga0065704_10001207 | 3300005289 | Bacteria | 8932 |
| 37 | Ga0065704_10079943 | 3300005289 | Bacteria | 4045 |
| 38 | Ga0065712_10017828 | 3300005290 | Bacteria | 1608 |
| 39 | Ga0070670_100000368 | 3300005331 | Bacteria | 37602 |
| 40 | Ga0070670_100056184 | 3300005331 | Bacteria | 3378 |
| 41 | Ga0070661_100000038 | 3300005344 | Bacteria | 104775 |
| 42 | Ga0070669_100000626 | 3300005353 | Bacteria | 26162 |
| 43 | Ga0070669_100003116 | 3300005353 | Bacteria | 11939 |
| 44 | Ga0070662_100000787 | 3300005457 | Bacteria | 19461 |
| 45 | Ga0070662_100032555 | 3300005457 | Bacteria | 3664 |
| 46 | Ga0068853_100000155 | 3300005539 | Bacteria | 46420 |
| 47 | Ga0070665_100011929 | 3300005548 | Bacteria | 8775 |
| 48 | Ga0070665_100080326 | 3300005548 | Bacteria | 3266 |
| 49 | Ga0070664_100001315 | 3300005564 | Bacteria | 19831 |
| 50 | Ga0070664_100038811 | 3300005564 | Bacteria | 4010 |
| 51 | Ga0068854_100003965 | 3300005578 | Bacteria | 9277 |
| 52 | Ga0068851_10000012 | 3300005834 | Bacteria | 175130 |
| 53 | Ga0075364_10093140 | 3300006051 | Bacteria | 2000 |
| 54 | Ga0075364_10286262 | 3300006051 | Bacteria | 1121 |
| 55 | Ga0075432_10002115 | 3300006058 | Bacteria | 6612 |
| 56 | Ga0075432_10009609 | 3300006058 | Bacteria | 3293 |
| 57 | Ga0075362_10001209 | 3300006177 | Bacteria | 8116 |
| 58 | Ga0075362_10023071 | 3300006177 | Bacteria | 2628 |
| 59 | Ga0099823_1001650 | 3300006944 | Bacteria | 18964 |
| 60 | Ga0079104_1000752 | 3300006946 | Bacteria | 28044 |
| 61 | Ga0105251_10000019 | 3300009011 | Bacteria | 141884 |
| 62 | Ga0105251_10001508 | 3300009011 | Bacteria | 20005 |
| 63 | Ga0105251_10001556 | 3300009011 | Bacteria | 19676 |
| 64 | Ga0105251_10001642 | 3300009011 | Bacteria | 18947 |
| 65 | Ga0105251_10002891 | 3300009011 | Bacteria | 12914 |
| 66 | Ga0105251_10014004 | 3300009011 | Bacteria | 4455 |
| 67 | Ga0105244_10000150 | 3300009036 | Bacteria | 73078 |
| 68 | Ga0105244_10000711 | 3300009036 | Bacteria | 28745 |
| 69 | Ga0105244_10001478 | 3300009036 | Bacteria | 18951 |
| 70 | Ga0105244_10006568 | 3300009036 | Bacteria | 7502 |
| 71 | Ga0105244_10007253 | 3300009036 | Bacteria | 7062 |
| 72 | Ga0105244_10037387 | 3300009036 | Bacteria | 2538 |
| 73 | Ga0105244_10061700 | 3300009036 | Bacteria | 1886 |
| 74 | Ga0105244_10065901 | 3300009036 | Bacteria | 1814 |
| 75 | Ga0105244_10069185 | 3300009036 | Bacteria | 1763 |
| 76 | Ga0105244_10082667 | 3300009036 | Bacteria | 1588 |
| 77 | Ga0105250_10000519 | 3300009092 | Bacteria | 26981 |
| 78 | Ga0105250_10000752 | 3300009092 | Bacteria | 19712 |
| 79 | Ga0105250_10023832 | 3300009092 | Bacteria | 2468 |
| 80 | Ga0105250_10053748 | 3300009092 | Bacteria | 1615 |
| 81 | Ga0105243_10119166 | 3300009148 | Bacteria | 2222 |
| 82 | Ga0105242_10000169 | 3300009176 | Bacteria | 49398 |
| 83 | Ga0105242_10030577 | 3300009176 | Bacteria | 4300 |
| 84 | Ga0105248_10232939 | 3300009177 | Bacteria | 2073 |
| 85 | Ga0105237_10005893 | 3300009545 | Bacteria | 13742 |
| 86 | Ga0105246_10000617 | 3300011119 | Bacteria | 19838 |
| 87 | Ga0105246_10001973 | 3300011119 | Bacteria | 12368 |
| 88 | Ga0157345_1000021 | 3300012498 | Bacteria | 41056 |
| 89 | Ga0157373_10001281 | 3300013100 | Bacteria | 19218 |
| 90 | Ga0157373_10004690 | 3300013100 | Bacteria | 10275 |
| 91 | Ga0157373_10023736 | 3300013100 | Bacteria | 4444 |
| 92 | Ga0157373_10043580 | 3300013100 | Bacteria | 3205 |
| 93 | Ga0157373_10106007 | 3300013100 | Bacteria | 1976 |
| 94 | Ga0157373_10138254 | 3300013100 | Bacteria | 1713 |
| 95 | Ga0157373_10204153 | 3300013100 | Bacteria | 1393 |
| 96 | Ga0157371_10001747 | 3300013102 | Bacteria | 22022 |
| 97 | Ga0157371_10002492 | 3300013102 | Bacteria | 17498 |
| 98 | Ga0157371_10006333 | 3300013102 | Bacteria | 9792 |
| 99 | Ga0157370_10016538 | 3300013104 | Bacteria | 7463 |
| 100 | Ga0157370_10067825 | 3300013104 | Bacteria | 3372 |
| 101 | Ga0157370_10133835 | 3300013104 | Bacteria | 2312 |
| 102 | Ga0157369_10006372 | 3300013105 | Bacteria | 13686 |
| 103 | Ga0157369_10007915 | 3300013105 | Bacteria | 12219 |
| 104 | Ga0157369_10028628 | 3300013105 | Bacteria | 6164 |
| 105 | Ga0157369_10057638 | 3300013105 | Bacteria | 4190 |
| 106 | Ga0157369_10073051 | 3300013105 | Bacteria | 3680 |
| 107 | Ga0163162_10001061 | 3300013306 | Bacteria | 25562 |
| 108 | Ga0163162_10240437 | 3300013306 | Bacteria | 1941 |
| 109 | Ga0157372_10012514 | 3300013307 | Bacteria | 9040 |
| 110 | Ga0157372_10022580 | 3300013307 | Bacteria | 6809 |
| 111 | Ga0157372_10059867 | 3300013307 | Bacteria | 4261 |
| 112 | Ga0157375_10005580 | 3300013308 | Bacteria | 10945 |
| 113 | Ga0157375_10069687 | 3300013308 | Bacteria | 3524 |
| 114 | Ga0182008_10006385 | 3300014497 | Bacteria | 6597 |
| 115 | Ga0182008_10014722 | 3300014497 | Bacteria | 4090 |
| 116 | Ga0182008_10018747 | 3300014497 | Bacteria | 3581 |
| 117 | Ga0182008_10021787 | 3300014497 | Bacteria | 3290 |
| 118 | Ga0182008_10023826 | 3300014497 | Bacteria | 3120 |
| 119 | Ga0182008_10030419 | 3300014497 | Bacteria | 2722 |
| 120 | Ga0182008_10034988 | 3300014497 | Bacteria | 2518 |
| 121 | Ga0182006_1001027 | 3300015261 | Bacteria | 18242 |
| 122 | Ga0182006_1001586 | 3300015261 | Bacteria | 13498 |
| 123 | Ga0182006_1001598 | 3300015261 | Bacteria | 13404 |
| 124 | Ga0182006_1023686 | 3300015261 | Bacteria | 2540 |
| 125 | Ga0182006_1033011 | 3300015261 | Bacteria | 2077 |
| 126 | Ga0182006_1035592 | 3300015261 | Bacteria | 1983 |
| 127 | Ga0182007_10000408 | 3300015262 | Bacteria | 26444 |
| 128 | Ga0182007_10001004 | 3300015262 | Bacteria | 15472 |
| 129 | Ga0182005_1002494 | 3300015265 | Bacteria | 6546 |
| 130 | Ga0182005_1003495 | 3300015265 | Bacteria | 5316 |
| 131 | Ga0182005_1003776 | 3300015265 | Bacteria | 5038 |
| 132 | Ga0182005_1017337 | 3300015265 | Bacteria | 1994 |
| 133 | Ga0182005_1023792 | 3300015265 | Bacteria | 1673 |
| 134 | Ga0163161_10001087 | 3300017792 | Bacteria | 20607 |
| 135 | Ga0163161_10044753 | 3300017792 | Bacteria | 3189 |
| 136 | Ga0163161_10107479 | 3300017792 | Bacteria | 2082 |
| 137 | Ga0163161_10339589 | 3300017792 | Bacteria | 1191 |
| 138 | Ga0163161_10425647 | 3300017792 | Bacteria | 1069 |
| 139 | Ga0209760_100098 | 3300025207 | Bacteria | 66801 |
| 140 | Ga0209760_100274 | 3300025207 | Bacteria | 18776 |
| 141 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 142 | Ga0209566_100062 | 3300025225 | Bacteria | 193033 |
| 143 | Ga0209674_100132 | 3300025226 | Bacteria | 117820 |
| 144 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 145 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 146 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 147 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 148 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 149 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 150 | Ga0209258_100330 | 3300025242 | Bacteria | 71644 |
| 151 | Ga0209646_1000185 | 3300025246 | Bacteria | 77981 |
| 152 | Ga0209677_100056 | 3300025253 | Bacteria | 165557 |
| 153 | Ga0209759_1014981 | 3300025256 | Bacteria | 2022 |
| 154 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 155 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 156 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 157 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 158 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 159 | Ga0209676_1000917 | 3300025292 | Bacteria | 36740 |
| 160 | Ga0209050_1000075 | 3300025298 | Bacteria | 286562 |
| 161 | Ga0209050_1000128 | 3300025298 | Bacteria | 187432 |
| 162 | Ga0209050_1001373 | 3300025298 | Bacteria | 26568 |
| 163 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 164 | Ga0209051_1000041 | 3300025303 | Bacteria | 311155 |
| 165 | Ga0209051_1000144 | 3300025303 | Bacteria | 134811 |
| 166 | Ga0209051_1009490 | 3300025303 | Bacteria | 5010 |
| 167 | Ga0209257_1000069 | 3300025304 | Bacteria | 339826 |
| 168 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 169 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 170 | Ga0207696_1000064 | 3300025711 | Bacteria | 238379 |
| 171 | Ga0207696_1000094 | 3300025711 | Bacteria | 184065 |
| 172 | Ga0207696_1000095 | 3300025711 | Bacteria | 179123 |
| 173 | Ga0207696_1000149 | 3300025711 | Bacteria | 120461 |
| 174 | Ga0207696_1002997 | 3300025711 | Bacteria | 7885 |
| 175 | Ga0207696_1008634 | 3300025711 | Bacteria | 3873 |
| 176 | Ga0207696_1017447 | 3300025711 | Bacteria | 2378 |
| 177 | Ga0207696_1037243 | 3300025711 | Bacteria | 1441 |
| 178 | Ga0207655_1000107 | 3300025728 | Bacteria | 178758 |
| 179 | Ga0207655_1000455 | 3300025728 | Bacteria | 53605 |
| 180 | Ga0207655_1000847 | 3300025728 | Bacteria | 32804 |
| 181 | Ga0207655_1000992 | 3300025728 | Bacteria | 28937 |
| 182 | Ga0207655_1001195 | 3300025728 | Bacteria | 25084 |
| 183 | Ga0207655_1001311 | 3300025728 | Bacteria | 23515 |
| 184 | Ga0207655_1002303 | 3300025728 | Bacteria | 15693 |
| 185 | Ga0207655_1012388 | 3300025728 | Bacteria | 4988 |
| 186 | Ga0207655_1012657 | 3300025728 | Bacteria | 4908 |
| 187 | Ga0207655_1013711 | 3300025728 | Bacteria | 4631 |
| 188 | Ga0207655_1017834 | 3300025728 | Bacteria | 3809 |
| 189 | Ga0207655_1031824 | 3300025728 | Bacteria | 2422 |
| 190 | Ga0207655_1032389 | 3300025728 | Bacteria | 2389 |
| 191 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 192 | Ga0207713_1001139 | 3300025735 | Bacteria | 22567 |
| 193 | Ga0207713_1001437 | 3300025735 | Bacteria | 19017 |
| 194 | Ga0207713_1001904 | 3300025735 | Bacteria | 15814 |
| 195 | Ga0207713_1002108 | 3300025735 | Bacteria | 14839 |
| 196 | Ga0207713_1002895 | 3300025735 | Bacteria | 12021 |
| 197 | Ga0207713_1008495 | 3300025735 | Bacteria | 5907 |
| 198 | Ga0207713_1011728 | 3300025735 | Bacteria | 4737 |
| 199 | Ga0207713_1013045 | 3300025735 | Bacteria | 4406 |
| 200 | Ga0207713_1015928 | 3300025735 | Bacteria | 3838 |
| 201 | Ga0207713_1024358 | 3300025735 | Bacteria | 2824 |
| 202 | Ga0207671_10000299 | 3300025914 | Bacteria | 73023 |
| 203 | Ga0207649_10000022 | 3300025920 | Bacteria | 188959 |
| 204 | Ga0207681_10000422 | 3300025923 | Bacteria | 29446 |
| 205 | Ga0207681_10002906 | 3300025923 | Bacteria | 10833 |
| 206 | Ga0207650_10000138 | 3300025925 | Bacteria | 88802 |
| 207 | Ga0207650_10000159 | 3300025925 | Bacteria | 81496 |
| 208 | Ga0207706_10000290 | 3300025933 | Bacteria | 54761 |
| 209 | Ga0207706_10004400 | 3300025933 | Bacteria | 13233 |
| 210 | Ga0207686_10000305 | 3300025934 | Bacteria | 35554 |
| 211 | Ga0207686_10171489 | 3300025934 | Bacteria | 1530 |
| 212 | Ga0207709_10000086 | 3300025935 | Bacteria | 156177 |
| 213 | Ga0207709_10008628 | 3300025935 | Bacteria | 5629 |
| 214 | Ga0207711_10158830 | 3300025941 | Bacteria | 2045 |
| 215 | Ga0207679_10000027 | 3300025945 | Bacteria | 196811 |
| 216 | Ga0207639_10001167 | 3300026041 | Bacteria | 17836 |
| 217 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 218 | Ga0209281_1001719 | 3300027111 | Bacteria | 11302 |
| 219 | Ga0209389_1000095 | 3300027296 | Bacteria | 80518 |
| 220 | Ga0209371_1000066 | 3300027312 | Bacteria | 212660 |
| 221 | Ga0209371_1004519 | 3300027312 | Bacteria | 5991 |
| 222 | Ga0207428_10011576 | 3300027907 | Bacteria | 7789 |
| 223 | Ga0207428_10042461 | 3300027907 | Bacteria | 3678 |
| 224 | Ga0207428_10049641 | 3300027907 | Bacteria | 3361 |
| 225 | Ga0207428_10049870 | 3300027907 | Bacteria | 3352 |
| 226 | Ga0207428_10082591 | 3300027907 | Bacteria | 2507 |
| 227 | Ga0207428_10158677 | 3300027907 | Bacteria | 1719 |
| 228 | Ga0207428_10177269 | 3300027907 | Bacteria | 1612 |
| 229 | Ga0268266_10006578 | 3300028379 | Bacteria | 10616 |
| 230 | Ga0265334_10000011 | 3300028573 | Bacteria | 178287 |
| 231 | Ga0268256_1000063 | 3300030500 | Bacteria | 212660 |
| 232 | Ga0268256_1003588 | 3300030500 | Bacteria | 6917 |
| 233 | Ga0307511_10040857 | 3300030521 | Bacteria | 3929 |
| 234 | Ga0316179_1031537 | 3300030734 | Bacteria | 1169 |
| 235 | Ga0316178_1083275 | 3300030735 | Bacteria | 51744 |
| 236 | Ga0307408_100000019 | 3300031548 | Bacteria | 344502 |
| 237 | Ga0307408_100001812 | 3300031548 | Bacteria | 15561 |
| 238 | Ga0307408_100127531 | 3300031548 | Bacteria | 1981 |
| 239 | Ga0307405_10019766 | 3300031731 | Bacteria | 3749 |
| 240 | Ga0307405_10431161 | 3300031731 | Bacteria | 1040 |
| 241 | Ga0307413_10132296 | 3300031824 | Bacteria | 1710 |
| 242 | Ga0307406_10000970 | 3300031901 | Bacteria | 16033 |
| 243 | Ga0307412_10024028 | 3300031911 | Bacteria | 3758 |
| 244 | Ga0307412_10151144 | 3300031911 | Bacteria | 1713 |
| 245 | Ga0307409_100020735 | 3300031995 | Bacteria | 4488 |
| 246 | Ga0307416_100162343 | 3300032002 | Bacteria | 2067 |
| 247 | Ga0307414_10077621 | 3300032004 | Bacteria | 2418 |
| 248 | Ga0307411_10003310 | 3300032005 | Bacteria | 7452 |
| 249 | Ga0307411_10204196 | 3300032005 | Bacteria | 1520 |
| 250 | Ga0307510_10002877 | 3300033180 | Bacteria | 19810 |
| 251 | Ga0373925_0199427 | 3300037068 | Bacteria | 1591 |
| 252 | Ga0395905_0010256 | 3300037471 | Bacteria | 9125 |
| 253 | Ga0237819_00209 | 3300038705 | Bacteria | 21356 |
| 254 | Ga0400487_09819 | 3300039110 | Bacteria | 1504 |
| 255 | Ga0439436_0003377 | 3300041404 | Bacteria | 4841 |
| 256 | Ga0439438_000779 | 3300041405 | Bacteria | 14188 |
| 257 | Ga0439438_000931 | 3300041405 | Bacteria | 13060 |
| 258 | Ga0439438_012440 | 3300041405 | Bacteria | 2609 |
| 259 | Ga0439447_023349 | 3300041407 | Bacteria | 1612 |
| 260 | Ga0439466_0001641 | 3300041411 | Bacteria | 8763 |
| 261 | Ga0439466_0003559 | 3300041411 | Bacteria | 6018 |
| 262 | Ga0439466_0011358 | 3300041411 | Bacteria | 3295 |
| 263 | Ga0439432_000859 | 3300042006 | Bacteria | 11357 |
| 264 | Ga0439432_003308 | 3300042006 | Bacteria | 5990 |
| 265 | Ga0439432_009057 | 3300042006 | Bacteria | 3479 |
| 266 | Ga0439432_014193 | 3300042006 | Bacteria | 2697 |
| 267 | Ga0439432_035953 | 3300042006 | Bacteria | 1586 |
| 268 | Ga0439451_005341 | 3300042009 | Bacteria | 2617 |
| 269 | Ga0439452_000507 | 3300042010 | Bacteria | 21118 |
| 270 | Ga0439452_000648 | 3300042010 | Bacteria | 17388 |
| 271 | Ga0439452_003067 | 3300042010 | Bacteria | 5934 |
| 272 | Ga0439456_000068 | 3300042013 | Bacteria | 36709 |
| 273 | Ga0439456_002218 | 3300042013 | Bacteria | 3908 |
| 274 | Ga0439456_004119 | 3300042013 | Bacteria | 2949 |
| 275 | Ga0439463_000149 | 3300042016 | Bacteria | 17859 |
| 276 | Ga0439463_000438 | 3300042016 | Bacteria | 11631 |
| 277 | Ga0450911_000003 | 3300042115 | Bacteria | 237055 |
| 278 | Ga0450911_000581 | 3300042115 | Bacteria | 11332 |
| 279 | Ga0450917_001206 | 3300042120 | Bacteria | 1874 |
| 280 | Ga0450922_000034 | 3300042124 | Bacteria | 12012 |
| 281 | Ga0450923_000592 | 3300042125 | Bacteria | 4140 |
| 282 | Ga0450904_000051 | 3300042139 | Bacteria | 26256 |
| 283 | Ga0450904_000479 | 3300042139 | Bacteria | 7830 |
| 284 | Ga0450906_007442 | 3300042145 | Bacteria | 2162 |
| 285 | Ga0450907_000760 | 3300042146 | Bacteria | 8157 |
| 286 | Ga0439446_0002675 | 3300042156 | Bacteria | 4308 |
| 287 | Ga0450908_003667 | 3300042184 | Bacteria | 2984 |
| 288 | Ga0439464_0000142 | 3300042439 | Bacteria | 11665 |
| 289 | Ga0439460_0003661 | 3300042461 | Bacteria | 3726 |
| 290 | Ga0450916_000325 | 3300042530 | Bacteria | 3870 |
| 291 | Ga0439440_0001743 | 3300042993 | Bacteria | 4005 |
| 292 | Ga0453684_0052308 | 3300044712 | Bacteria | 5343 |
| 293 | Ga0495617_000582 | 3300046452 | Bacteria | 18600 |
| 294 | Ga0495617_002152 | 3300046452 | Bacteria | 8090 |
| 295 | Ga0495617_010002 | 3300046452 | Bacteria | 3251 |
| 296 | Ga0495617_027341 | 3300046452 | Bacteria | 1919 |
| 297 | Ga0495627_000023 | 3300046453 | Bacteria | 251113 |
| 298 | Ga0495627_000134 | 3300046453 | Bacteria | 88155 |
| 299 | Ga0495627_001005 | 3300046453 | Bacteria | 18979 |
| 300 | Ga0495627_002276 | 3300046453 | Bacteria | 9478 |
| 301 | Ga0495627_004374 | 3300046453 | Bacteria | 5933 |
| 302 | Ga0495627_014907 | 3300046453 | Bacteria | 2696 |
| 303 | Ga0495603_0063755 | 3300046455 | Bacteria | 2173 |
| 304 | Ga0495590_0000356 | 3300046457 | Bacteria | 23621 |
| 305 | Ga0495590_0001252 | 3300046457 | Bacteria | 11076 |
| 306 | Ga0495590_0056514 | 3300046457 | Bacteria | 1371 |
| 307 | Ga0495591_000025 | 3300046458 | Bacteria | 189897 |
| 308 | Ga0495591_000728 | 3300046458 | Bacteria | 23844 |
| 309 | Ga0495591_000970 | 3300046458 | Bacteria | 19586 |
| 310 | Ga0495591_001914 | 3300046458 | Bacteria | 12218 |
| 311 | Ga0495591_001960 | 3300046458 | Bacteria | 12021 |
| 312 | Ga0495591_003795 | 3300046458 | Bacteria | 7639 |
| 313 | Ga0495591_006789 | 3300046458 | Bacteria | 4982 |
| 314 | Ga0495591_012572 | 3300046458 | Bacteria | 3144 |
| 315 | Ga0495591_017961 | 3300046458 | Bacteria | 2412 |
| 316 | Ga0495591_025601 | 3300046458 | Bacteria | 1847 |
| 317 | Ga0495638_0002423 | 3300046460 | Bacteria | 15246 |
| 318 | Ga0495638_0009363 | 3300046460 | Bacteria | 6885 |
| 319 | Ga0495638_0016132 | 3300046460 | Bacteria | 5006 |
| 320 | Ga0495638_0022024 | 3300046460 | Bacteria | 4188 |
| 321 | Ga0495638_0023288 | 3300046460 | Bacteria | 4052 |
| 322 | Ga0495638_0026660 | 3300046460 | Bacteria | 3744 |
| 323 | Ga0495638_0077315 | 3300046460 | Bacteria | 2026 |
| 324 | Ga0495653_0002339 | 3300046463 | Bacteria | 15047 |
| 325 | Ga0495653_0003298 | 3300046463 | Bacteria | 12949 |
| 326 | Ga0495653_0017970 | 3300046463 | Bacteria | 5748 |
| 327 | Ga0495650_0002155 | 3300046471 | Bacteria | 16715 |
| 328 | Ga0495650_0003462 | 3300046471 | Bacteria | 11501 |
| 329 | Ga0495650_0009445 | 3300046471 | Bacteria | 5543 |
| 330 | Ga0495650_0016777 | 3300046471 | Bacteria | 3693 |
| 331 | Ga0495605_0001169 | 3300046474 | Bacteria | 17426 |
| 332 | Ga0495605_0003351 | 3300046474 | Bacteria | 9576 |
| 333 | Ga0495605_0015636 | 3300046474 | Bacteria | 4123 |
| 334 | Ga0495605_0040265 | 3300046474 | Bacteria | 2335 |
| 335 | Ga0495639_0000577 | 3300046475 | Bacteria | 17080 |
| 336 | Ga0495639_0015405 | 3300046475 | Bacteria | 3316 |
| 337 | Ga0495584_0001354 | 3300046491 | Bacteria | 14821 |
| 338 | Ga0495584_0007191 | 3300046491 | Bacteria | 5812 |
| 339 | Ga0495584_0010611 | 3300046491 | Bacteria | 4731 |
| 340 | Ga0495584_0020423 | 3300046491 | Bacteria | 3365 |
| 341 | Ga0495584_0031642 | 3300046491 | Bacteria | 2677 |
| 342 | Ga0495584_0039065 | 3300046491 | Bacteria | 2398 |
| 343 | Ga0495584_0055637 | 3300046491 | Bacteria | 1990 |
| 344 | Ga0495585_0000705 | 3300046492 | Bacteria | 30104 |
| 345 | Ga0495585_0001233 | 3300046492 | Bacteria | 20629 |
| 346 | Ga0495585_0003913 | 3300046492 | Bacteria | 9868 |
| 347 | Ga0495585_0012245 | 3300046492 | Bacteria | 5053 |
| 348 | Ga0495585_0014493 | 3300046492 | Bacteria | 4592 |
| 349 | Ga0495585_0018776 | 3300046492 | Bacteria | 3987 |
| 350 | Ga0495585_0021613 | 3300046492 | Bacteria | 3694 |
| 351 | Ga0495594_0066064 | 3300046499 | Bacteria | 2006 |
| 352 | Ga0495596_0000478 | 3300046500 | Bacteria | 25350 |
| 353 | Ga0495607_0000069 | 3300046501 | Bacteria | 101754 |
| 354 | Ga0495607_0001688 | 3300046501 | Bacteria | 19008 |
| 355 | Ga0495607_0003172 | 3300046501 | Bacteria | 12738 |
| 356 | Ga0495607_0003303 | 3300046501 | Bacteria | 12386 |
| 357 | Ga0495607_0004123 | 3300046501 | Bacteria | 10840 |
| 358 | Ga0495607_0009558 | 3300046501 | Bacteria | 6552 |
| 359 | Ga0495607_0011736 | 3300046501 | Bacteria | 5811 |
| 360 | Ga0495607_0012648 | 3300046501 | Bacteria | 5560 |
| 361 | Ga0495607_0055511 | 3300046501 | Bacteria | 2278 |
| 362 | Ga0495607_0090195 | 3300046501 | Bacteria | 1662 |
| 363 | Ga0495607_0119073 | 3300046501 | Bacteria | 1389 |
| 364 | Ga0495583_0002951 | 3300046506 | Bacteria | 13670 |
| 365 | Ga0495583_0003018 | 3300046506 | Bacteria | 13422 |
| 366 | Ga0495583_0043336 | 3300046506 | Bacteria | 2095 |
| 367 | Ga0495583_0053729 | 3300046506 | Bacteria | 1827 |
| 368 | Ga0495606_0004110 | 3300046507 | Bacteria | 14781 |
| 369 | Ga0495606_0006032 | 3300046507 | Bacteria | 11343 |
| 370 | Ga0495606_0006404 | 3300046507 | Bacteria | 10867 |
| 371 | Ga0495606_0010755 | 3300046507 | Bacteria | 7544 |
| 372 | Ga0495606_0018269 | 3300046507 | Bacteria | 5265 |
| 373 | Ga0495606_0022823 | 3300046507 | Bacteria | 4547 |
| 374 | Ga0495606_0070275 | 3300046507 | Bacteria | 2208 |
| 375 | Ga0495606_0089323 | 3300046507 | Bacteria | 1898 |
| 376 | Ga0495610_0002777 | 3300046512 | Bacteria | 14352 |
| 377 | Ga0495610_0005863 | 3300046512 | Bacteria | 8621 |
| 378 | Ga0495610_0013003 | 3300046512 | Bacteria | 4972 |
| 379 | Ga0495610_0023436 | 3300046512 | Bacteria | 3355 |
| 380 | Ga0495616_0002193 | 3300046513 | Bacteria | 13053 |
| 381 | Ga0495616_0002782 | 3300046513 | Bacteria | 11424 |
| 382 | Ga0495616_0017155 | 3300046513 | Bacteria | 3994 |
| 383 | Ga0495616_0057430 | 3300046513 | Bacteria | 1918 |
| 384 | Ga0495616_0072336 | 3300046513 | Bacteria | 1665 |
| 385 | Ga0495620_0000879 | 3300046515 | Bacteria | 18536 |
| 386 | Ga0495620_0001236 | 3300046515 | Bacteria | 15611 |
| 387 | Ga0495620_0001871 | 3300046515 | Bacteria | 12386 |
| 388 | Ga0495620_0005263 | 3300046515 | Bacteria | 7238 |
| 389 | Ga0495620_0005831 | 3300046515 | Bacteria | 6839 |
| 390 | Ga0495620_0082316 | 3300046515 | Bacteria | 1300 |
| 391 | Ga0495630_0128933 | 3300046517 | Bacteria | 1920 |
| 392 | Ga0495631_0000557 | 3300046518 | Bacteria | 24982 |
| 393 | Ga0495631_0001273 | 3300046518 | Bacteria | 15530 |
| 394 | Ga0495631_0001898 | 3300046518 | Bacteria | 12311 |
| 395 | Ga0495631_0009216 | 3300046518 | Bacteria | 4942 |
| 396 | Ga0495631_0022766 | 3300046518 | Bacteria | 2912 |
| 397 | Ga0495631_0100615 | 3300046518 | Bacteria | 1244 |
| 398 | Ga0495632_0002203 | 3300046519 | Bacteria | 15039 |
| 399 | Ga0495632_0002244 | 3300046519 | Bacteria | 14886 |
| 400 | Ga0495632_0002355 | 3300046519 | Bacteria | 14484 |
| 401 | Ga0495632_0006993 | 3300046519 | Bacteria | 7160 |
| 402 | Ga0495632_0028208 | 3300046519 | Bacteria | 2930 |
| 403 | Ga0495632_0044728 | 3300046519 | Bacteria | 2208 |
| 404 | Ga0495632_0064361 | 3300046519 | Bacteria | 1773 |
| 405 | Ga0495632_0070666 | 3300046519 | Bacteria | 1678 |
| 406 | Ga0495632_0071073 | 3300046519 | Bacteria | 1672 |
| 407 | Ga0495637_0000982 | 3300046520 | Bacteria | 18091 |
| 408 | Ga0495637_0001013 | 3300046520 | Bacteria | 17686 |
| 409 | Ga0495637_0002185 | 3300046520 | Bacteria | 10935 |
| 410 | Ga0495637_0004272 | 3300046520 | Bacteria | 7419 |
| 411 | Ga0495637_0005147 | 3300046520 | Bacteria | 6704 |
| 412 | Ga0495637_0007429 | 3300046520 | Bacteria | 5425 |
| 413 | Ga0495637_0016381 | 3300046520 | Bacteria | 3465 |
| 414 | Ga0495637_0018073 | 3300046520 | Bacteria | 3274 |
| 415 | Ga0495637_0018784 | 3300046520 | Bacteria | 3202 |
| 416 | Ga0495637_0020252 | 3300046520 | Bacteria | 3062 |
| 417 | Ga0495637_0024037 | 3300046520 | Bacteria | 2758 |
| 418 | Ga0495637_0034885 | 3300046520 | Bacteria | 2200 |
| 419 | Ga0495637_0053008 | 3300046520 | Bacteria | 1690 |
| 420 | Ga0495637_0057048 | 3300046520 | Bacteria | 1614 |
| 421 | Ga0495643_0001214 | 3300046522 | Bacteria | 24940 |
| 422 | Ga0495643_0006720 | 3300046522 | Bacteria | 7527 |
| 423 | Ga0495643_0013302 | 3300046522 | Bacteria | 4929 |
| 424 | Ga0495643_0030237 | 3300046522 | Bacteria | 3026 |
| 425 | Ga0495643_0056107 | 3300046522 | Bacteria | 2103 |
| 426 | Ga0495643_0087371 | 3300046522 | Bacteria | 1613 |
| 427 | Ga0495644_0000474 | 3300046523 | Bacteria | 17385 |
| 428 | Ga0495644_0033998 | 3300046523 | Bacteria | 1924 |
| 429 | Ga0495644_0045073 | 3300046523 | Bacteria | 1658 |
| 430 | Ga0495648_0001169 | 3300046524 | Bacteria | 26511 |
| 431 | Ga0495648_0001874 | 3300046524 | Bacteria | 20108 |
| 432 | Ga0495648_0002169 | 3300046524 | Bacteria | 18476 |
| 433 | Ga0495648_0004794 | 3300046524 | Bacteria | 11432 |
| 434 | Ga0495648_0005415 | 3300046524 | Bacteria | 10611 |
| 435 | Ga0495648_0023508 | 3300046524 | Bacteria | 4219 |
| 436 | Ga0495648_0028304 | 3300046524 | Bacteria | 3735 |
| 437 | Ga0495648_0038394 | 3300046524 | Bacteria | 3063 |
| 438 | Ga0495648_0093759 | 3300046524 | Bacteria | 1673 |
| 439 | Ga0495648_0094826 | 3300046524 | Bacteria | 1661 |
| 440 | Ga0495648_0139352 | 3300046524 | Bacteria | 1278 |
| 441 | Ga0495642_0000253 | 3300046528 | Bacteria | 29942 |
| 442 | Ga0495642_0000574 | 3300046528 | Bacteria | 18445 |
| 443 | Ga0495642_0001251 | 3300046528 | Bacteria | 11606 |
| 444 | Ga0495654_0000947 | 3300046530 | Bacteria | 21495 |
| 445 | Ga0495654_0001612 | 3300046530 | Bacteria | 15295 |
| 446 | Ga0495654_0002089 | 3300046530 | Bacteria | 13074 |
| 447 | Ga0495654_0002168 | 3300046530 | Bacteria | 12784 |
| 448 | Ga0495654_0002476 | 3300046530 | Bacteria | 11870 |
| 449 | Ga0495654_0010516 | 3300046530 | Bacteria | 5033 |
| 450 | Ga0495654_0015217 | 3300046530 | Bacteria | 4088 |
| 451 | Ga0495654_0018982 | 3300046530 | Bacteria | 3598 |
| 452 | Ga0495654_0023761 | 3300046530 | Bacteria | 3172 |
| 453 | Ga0495654_0028857 | 3300046530 | Bacteria | 2833 |
| 454 | Ga0495654_0031052 | 3300046530 | Bacteria | 2713 |
| 455 | Ga0495654_0047218 | 3300046530 | Bacteria | 2117 |
| 456 | Ga0495587_0009814 | 3300046536 | Bacteria | 6117 |
| 457 | Ga0495609_0000057 | 3300046538 | Bacteria | 143793 |
| 458 | Ga0495609_0010555 | 3300046538 | Bacteria | 4427 |
| 459 | Ga0495609_0012057 | 3300046538 | Bacteria | 4103 |
| 460 | Ga0495609_0016335 | 3300046538 | Bacteria | 3458 |
| 461 | Ga0495609_0126374 | 3300046538 | Bacteria | 1097 |
| 462 | Ga0495597_0000229 | 3300046542 | Bacteria | 50600 |
| 463 | Ga0495597_0001472 | 3300046542 | Bacteria | 16864 |
| 464 | Ga0495597_0002031 | 3300046542 | Bacteria | 13545 |
| 465 | Ga0495597_0004119 | 3300046542 | Bacteria | 8093 |
| 466 | Ga0495597_0010651 | 3300046542 | Bacteria | 4483 |
| 467 | Ga0495597_0031005 | 3300046542 | Bacteria | 2434 |
| 468 | Ga0495622_0000871 | 3300046557 | Bacteria | 16536 |
| 469 | Ga0495622_0001113 | 3300046557 | Bacteria | 14064 |
| 470 | Ga0495622_0003393 | 3300046557 | Bacteria | 7514 |
| 471 | Ga0495622_0051148 | 3300046557 | Bacteria | 1916 |
| 472 | Ga0495633_0002371 | 3300046558 | Bacteria | 13349 |
| 473 | Ga0495656_0032589 | 3300046615 | Bacteria | 2121 |
| 474 | Ga0495668_0001637 | 3300046616 | Bacteria | 20908 |
| 475 | Ga0495668_0010876 | 3300046616 | Bacteria | 5480 |
| 476 | Ga0495668_0011902 | 3300046616 | Bacteria | 5182 |
| 477 | Ga0495668_0013844 | 3300046616 | Bacteria | 4743 |
| 478 | Ga0495611_0000398 | 3300046648 | Bacteria | 27372 |
| 479 | Ga0495625_0001611 | 3300046660 | Bacteria | 26632 |
| 480 | Ga0495625_0005979 | 3300046660 | Bacteria | 10939 |
| 481 | Ga0495625_0008586 | 3300046660 | Bacteria | 8695 |
| 482 | Ga0495625_0010435 | 3300046660 | Bacteria | 7686 |
| 483 | Ga0495625_0015095 | 3300046660 | Bacteria | 6131 |
| 484 | Ga0495625_0024032 | 3300046660 | Bacteria | 4645 |
| 485 | Ga0495625_0028783 | 3300046660 | Bacteria | 4161 |
| 486 | Ga0495625_0055556 | 3300046660 | Bacteria | 2823 |
| 487 | Ga0495625_0061846 | 3300046660 | Bacteria | 2648 |
| 488 | Ga0495635_0002400 | 3300046663 | Bacteria | 12762 |
| 489 | Ga0495635_0014787 | 3300046663 | Bacteria | 5459 |
| 490 | Ga0495659_0024028 | 3300046664 | Bacteria | 2074 |
| 491 | Ga0495661_0000027 | 3300046665 | Bacteria | 184297 |
| 492 | Ga0495661_0000571 | 3300046665 | Bacteria | 38251 |
| 493 | Ga0495661_0003441 | 3300046665 | Bacteria | 11683 |
| 494 | Ga0495661_0012541 | 3300046665 | Bacteria | 5723 |
| 495 | Ga0495661_0027461 | 3300046665 | Bacteria | 3652 |
| 496 | Ga0495661_0129785 | 3300046665 | Bacteria | 1382 |
| 497 | Ga0495661_0132934 | 3300046665 | Bacteria | 1361 |
| 498 | Ga0495588_0003618 | 3300046674 | Bacteria | 6757 |
| 499 | Ga0495588_0015925 | 3300046674 | Bacteria | 3626 |
| 500 | Ga0495623_0004003 | 3300046679 | Bacteria | 9702 |
| 501 | Ga0495646_0003143 | 3300046680 | Bacteria | 10249 |
| 502 | Ga0495646_0014400 | 3300046680 | Bacteria | 5030 |
| 503 | Ga0495613_0023434 | 3300046689 | Bacteria | 4598 |
| 504 | Ga0495624_0001016 | 3300046690 | Bacteria | 22226 |
| 505 | Ga0495670_0000898 | 3300046691 | Bacteria | 14390 |
| 506 | Ga0495670_0001148 | 3300046691 | Bacteria | 12867 |
| 507 | Ga0495670_0001629 | 3300046691 | Bacteria | 10988 |
| 508 | Ga0495671_0000860 | 3300046692 | Bacteria | 21697 |
| 509 | Ga0495671_0001062 | 3300046692 | Bacteria | 19031 |
| 510 | Ga0495671_0002728 | 3300046692 | Bacteria | 11058 |
| 511 | Ga0495671_0003121 | 3300046692 | Bacteria | 10298 |
| 512 | Ga0495671_0006460 | 3300046692 | Bacteria | 6772 |
| 513 | Ga0495671_0016960 | 3300046692 | Bacteria | 3880 |
| 514 | Ga0495671_0025098 | 3300046692 | Bacteria | 3099 |
| 515 | Ga0495671_0031230 | 3300046692 | Bacteria | 2723 |
| 516 | Ga0495671_0073639 | 3300046692 | Bacteria | 1676 |
| 517 | Ga0495671_0082388 | 3300046692 | Bacteria | 1576 |
| 518 | Ga0495671_0087314 | 3300046692 | Bacteria | 1527 |
| 519 | Ga0495671_0096697 | 3300046692 | Bacteria | 1444 |
| 520 | Ga0495649_0000950 | 3300046694 | Bacteria | 22854 |
| 521 | Ga0495649_0003030 | 3300046694 | Bacteria | 11526 |
| 522 | Ga0495649_0009177 | 3300046694 | Bacteria | 5896 |
| 523 | Ga0495649_0009407 | 3300046694 | Bacteria | 5813 |
| 524 | Ga0495649_0012447 | 3300046694 | Bacteria | 4946 |
| 525 | Ga0495649_0024115 | 3300046694 | Bacteria | 3395 |
| 526 | Ga0495649_0094265 | 3300046694 | Bacteria | 1593 |
| 527 | Ga0495649_0096994 | 3300046694 | Bacteria | 1568 |
| 528 | Ga0495649_0180428 | 3300046694 | Bacteria | 1101 |
| 529 | Ga0495589_0001444 | 3300046794 | Bacteria | 13702 |
| 530 | Ga0495589_0006684 | 3300046794 | Bacteria | 6074 |
| 531 | Ga0495589_0011088 | 3300046794 | Bacteria | 4676 |
| 532 | Ga0495589_0013075 | 3300046794 | Bacteria | 4286 |
| 533 | Ga0495600_0015051 | 3300046809 | Bacteria | 4885 |
| 534 | Ga0495660_0001871 | 3300046810 | Bacteria | 13814 |
| 535 | Ga0495660_0001949 | 3300046810 | Bacteria | 13431 |
| 536 | Ga0495660_0004554 | 3300046810 | Bacteria | 8372 |
| 537 | Ga0495660_0009310 | 3300046810 | Bacteria | 5727 |
| 538 | Ga0495660_0009972 | 3300046810 | Bacteria | 5526 |
| 539 | Ga0495660_0010711 | 3300046810 | Bacteria | 5328 |
| 540 | Ga0495660_0013744 | 3300046810 | Bacteria | 4692 |
| 541 | Ga0495660_0020234 | 3300046810 | Bacteria | 3814 |
| 542 | Ga0495660_0037445 | 3300046810 | Bacteria | 2701 |
| 543 | Ga0495660_0066718 | 3300046810 | Bacteria | 1918 |
| 544 | Ga0495660_0071553 | 3300046810 | Bacteria | 1838 |
| 545 | Ga0495660_0100319 | 3300046810 | Bacteria | 1491 |
| 546 | Ga0495660_0101481 | 3300046810 | Bacteria | 1480 |
| 547 | Ga0495604_0004835 | 3300047317 | Bacteria | 10676 |
| 548 | Ga0495604_0042857 | 3300047317 | Bacteria | 3544 |
| 549 | Ga0495636_0008286 | 3300047318 | Bacteria | 4103 |
| 550 | Ga0495674_0010280 | 3300047319 | Bacteria | 8862 |
| 551 | Ga0495672_0001187 | 3300047320 | Bacteria | 26409 |
| 552 | Ga0495672_0001861 | 3300047320 | Bacteria | 20089 |
| 553 | Ga0495672_0002241 | 3300047320 | Bacteria | 17992 |
| 554 | Ga0495672_0002630 | 3300047320 | Bacteria | 16221 |
| 555 | Ga0495672_0004619 | 3300047320 | Bacteria | 11174 |
| 556 | Ga0495672_0008985 | 3300047320 | Bacteria | 7292 |
| 557 | Ga0495672_0009137 | 3300047320 | Bacteria | 7224 |
| 558 | Ga0495672_0009191 | 3300047320 | Bacteria | 7197 |
| 559 | Ga0495672_0033904 | 3300047320 | Bacteria | 3160 |
| 560 | Ga0495672_0034522 | 3300047320 | Bacteria | 3124 |
| 561 | Ga0495672_0051836 | 3300047320 | Bacteria | 2414 |
| 562 | Ga0495672_0061802 | 3300047320 | Bacteria | 2157 |
| 563 | Ga0495672_0102697 | 3300047320 | Bacteria | 1547 |
| 564 | Ga0495672_0171934 | 3300047320 | Bacteria | 1104 |
| 565 | Ga0495676_0024333 | 3300047321 | Bacteria | 5244 |
| 566 | Ga0495676_0037406 | 3300047321 | Bacteria | 4039 |
| 567 | Ga0495680_0008892 | 3300047322 | Bacteria | 9079 |
| 568 | Ga0495680_0040858 | 3300047322 | Bacteria | 3691 |
| 569 | Ga0495680_0158885 | 3300047322 | Bacteria | 1642 |
| 570 | Ga0495680_0305255 | 3300047322 | Bacteria | 1116 |
| 571 | Ga0495683_0000032 | 3300047323 | Bacteria | 149612 |
| 572 | Ga0495683_0000584 | 3300047323 | Bacteria | 27512 |
| 573 | Ga0495683_0000905 | 3300047323 | Bacteria | 20921 |
| 574 | Ga0495683_0011935 | 3300047323 | Bacteria | 4567 |
| 575 | Ga0495683_0017678 | 3300047323 | Bacteria | 3693 |
| 576 | Ga0495683_0022727 | 3300047323 | Bacteria | 3224 |
| 577 | Ga0495687_001410 | 3300047443 | Bacteria | 22145 |
| 578 | Ga0495687_001593 | 3300047443 | Bacteria | 20495 |
| 579 | Ga0495687_001720 | 3300047443 | Bacteria | 19389 |
| 580 | Ga0495675_0007362 | 3300047444 | Bacteria | 6780 |
| 581 | Ga0495675_0195133 | 3300047444 | Bacteria | 1234 |
| 582 | Ga0495677_0001304 | 3300047445 | Bacteria | 9965 |
| 583 | Ga0495679_000721 | 3300047446 | Bacteria | 21281 |
| 584 | Ga0495679_005501 | 3300047446 | Bacteria | 5604 |
| 585 | Ga0495679_006071 | 3300047446 | Bacteria | 5271 |
| 586 | Ga0495679_019394 | 3300047446 | Bacteria | 2390 |
| 587 | Ga0495679_024712 | 3300047446 | Bacteria | 2021 |
| 588 | Ga0495685_038423 | 3300047447 | Bacteria | 1640 |
| 589 | Ga0495673_0001703 | 3300047469 | Bacteria | 16856 |
| 590 | Ga0495673_0001708 | 3300047469 | Bacteria | 16794 |
| 591 | Ga0495673_0001879 | 3300047469 | Bacteria | 15762 |
| 592 | Ga0495673_0002166 | 3300047469 | Bacteria | 14269 |
| 593 | Ga0495673_0003787 | 3300047469 | Bacteria | 9785 |
| 594 | Ga0495673_0004038 | 3300047469 | Bacteria | 9351 |
| 595 | Ga0495673_0004292 | 3300047469 | Bacteria | 8987 |
| 596 | Ga0495673_0005096 | 3300047469 | Bacteria | 8029 |
| 597 | Ga0495673_0005300 | 3300047469 | Bacteria | 7825 |
| 598 | Ga0495673_0011643 | 3300047469 | Bacteria | 4718 |
| 599 | Ga0495673_0050441 | 3300047469 | Bacteria | 1826 |
| 600 | Ga0495673_0061429 | 3300047469 | Bacteria | 1608 |
| 601 | Ga0495681_0001535 | 3300047470 | Bacteria | 17232 |
| 602 | Ga0495681_0002339 | 3300047470 | Bacteria | 13621 |
| 603 | Ga0495681_0002940 | 3300047470 | Bacteria | 12036 |
| 604 | Ga0495681_0004215 | 3300047470 | Bacteria | 9862 |
| 605 | Ga0495681_0005581 | 3300047470 | Bacteria | 8396 |
| 606 | Ga0495681_0014801 | 3300047470 | Bacteria | 4451 |
| 607 | Ga0495681_0015012 | 3300047470 | Bacteria | 4403 |
| 608 | Ga0495681_0022720 | 3300047470 | Bacteria | 3350 |
| 609 | Ga0495681_0041300 | 3300047470 | Bacteria | 2239 |
| 610 | Ga0495681_0048687 | 3300047470 | Bacteria | 2007 |
| 611 | Ga0495684_0025758 | 3300047471 | Bacteria | 4519 |
| 612 | Ga0495686_0005103 | 3300047472 | Bacteria | 10496 |
| 613 | Ga0495686_0006282 | 3300047472 | Bacteria | 9139 |
| 614 | Ga0495686_0015694 | 3300047472 | Bacteria | 5161 |
| 615 | Ga0495593_0067458 | 3300047673 | Bacteria | 1862 |
| 616 | Ga0495602_0030875 | 3300048088 | Bacteria | 5074 |
| 617 | Ga0495626_0000831 | 3300048091 | Bacteria | 27665 |
| 618 | Ga0495626_0001108 | 3300048091 | Bacteria | 22736 |
| 619 | Ga0495626_0002541 | 3300048091 | Bacteria | 12532 |
| 620 | Ga0495626_0005222 | 3300048091 | Bacteria | 7688 |
| 621 | Ga0495626_0006203 | 3300048091 | Bacteria | 6831 |
| 622 | Ga0495626_0016707 | 3300048091 | Bacteria | 3721 |
| 623 | Ga0495626_0053489 | 3300048091 | Bacteria | 1857 |
| 624 | Ga0496102_0002311 | 3300048905 | Bacteria | 16292 |
| 625 | Ga0496103_0002862 | 3300048906 | Bacteria | 10730 |
| 626 | Ga0496116_0002775 | 3300048919 | Bacteria | 18000 |
| 627 | Ga0496116_0004594 | 3300048919 | Bacteria | 13090 |
| 628 | Ga0496116_0006605 | 3300048919 | Bacteria | 10494 |
| 629 | Ga0496116_0007417 | 3300048919 | Bacteria | 9732 |
| 630 | Ga0496116_0014607 | 3300048919 | Bacteria | 6260 |
| 631 | Ga0496117_0005359 | 3300048920 | Bacteria | 13510 |
| 632 | Ga0496117_0031812 | 3300048920 | Bacteria | 4023 |
| 633 | Ga0496117_0211872 | 3300048920 | Bacteria | 1085 |
| 634 | Ga0496117_0211885 | 3300048920 | Bacteria | 1085 |
| 635 | Ga0496118_0007335 | 3300048921 | Bacteria | 11728 |
| 636 | Ga0496118_0007906 | 3300048921 | Bacteria | 11136 |
| 637 | Ga0496118_0009100 | 3300048921 | Bacteria | 10111 |
| 638 | Ga0496118_0036847 | 3300048921 | Bacteria | 3947 |
| 639 | Ga0496118_0079709 | 3300048921 | Bacteria | 2309 |
| 640 | Ga0496118_0156456 | 3300048921 | Bacteria | 1417 |
| 641 | Ga0496119_0000071 | 3300048922 | Bacteria | 153652 |
| 642 | Ga0496120_0002726 | 3300048923 | Bacteria | 17252 |
| 643 | Ga0496121_0007900 | 3300048924 | Bacteria | 12731 |
| 644 | Ga0496121_0037516 | 3300048924 | Bacteria | 4303 |
| 645 | Ga0496122_0002157 | 3300048925 | Bacteria | 28836 |
| 646 | Ga0496122_0006460 | 3300048925 | Bacteria | 13445 |
| 647 | Ga0496122_0010517 | 3300048925 | Bacteria | 9515 |
| 648 | Ga0496122_0037573 | 3300048925 | Bacteria | 3894 |
| 649 | Ga0496122_0094946 | 3300048925 | Bacteria | 2017 |
| 650 | Ga0496123_0001464 | 3300048926 | Bacteria | 32764 |
| 651 | Ga0496123_0011812 | 3300048926 | Bacteria | 7519 |
| 652 | Ga0496123_0016348 | 3300048926 | Bacteria | 6033 |
| 653 | Ga0496123_0049495 | 3300048926 | Bacteria | 2817 |
| 654 | Ga0496123_0143414 | 3300048926 | Bacteria | 1301 |
| 655 | Ga0496124_0000407 | 3300048927 | Bacteria | 78013 |
| 656 | Ga0496124_0005384 | 3300048927 | Bacteria | 14446 |
| 657 | Ga0496124_0006059 | 3300048927 | Bacteria | 13308 |
| 658 | Ga0496124_0015951 | 3300048927 | Bacteria | 7171 |
| 659 | Ga0496124_0022335 | 3300048927 | Bacteria | 5801 |
| 660 | Ga0496124_0039119 | 3300048927 | Bacteria | 4113 |
| 661 | Ga0496124_0039847 | 3300048927 | Bacteria | 4068 |
| 662 | Ga0496124_0188712 | 3300048927 | Bacteria | 1579 |
| 663 | Ga0496124_0352512 | 3300048927 | Bacteria | 1040 |
| 664 | Ga0496125_0002636 | 3300048928 | Bacteria | 22968 |
| 665 | Ga0496125_0002716 | 3300048928 | Bacteria | 22480 |
| 666 | Ga0496125_0017906 | 3300048928 | Bacteria | 6736 |
| 667 | Ga0496126_0062641 | 3300048929 | Bacteria | 3336 |
| 668 | Ga0495678_000541 | 3300049459 | Bacteria | 36468 |
| 669 | Ga0495678_001270 | 3300049459 | Bacteria | 20477 |
| 670 | Ga0495678_001393 | 3300049459 | Bacteria | 19214 |
| 671 | Ga0495678_002041 | 3300049459 | Bacteria | 14449 |
| 672 | Ga0495678_003217 | 3300049459 | Bacteria | 10254 |
| 673 | Ga0495678_008652 | 3300049459 | Bacteria | 5116 |
| 674 | Ga0495678_028588 | 3300049459 | Bacteria | 2350 |
| 675 | Ga0495678_036912 | 3300049459 | Bacteria | 1990 |
| 676 | Ga0495678_052112 | 3300049459 | Bacteria | 1577 |
| 677 | Ga0495682_0001635 | 3300049460 | Bacteria | 11536 |
| 678 | Ga0495682_0003896 | 3300049460 | Bacteria | 6520 |
| 679 | Ga0495682_0022278 | 3300049460 | Bacteria | 2369 |
| 680 | Ga0495682_0055634 | 3300049460 | Bacteria | 1434 |
| 681 | Ga0501032_0041522 | 3300049569 | Bacteria | 3123 |
| 682 | Ga0501033_0093077 | 3300049570 | Bacteria | 2204 |
| 683 | Ga0501034_0041130 | 3300049571 | Bacteria | 4676 |
| 684 | Ga0501034_0150183 | 3300049571 | Bacteria | 2306 |
| 685 | Ga0501034_0179197 | 3300049571 | Bacteria | 2084 |
| 686 | Ga0501037_0101041 | 3300049573 | Bacteria | 2082 |
| 687 | Ga0501035_0204272 | 3300049822 | Bacteria | 1693 |
| 688 | Ga0501226_000065 | 3300049853 | Bacteria | 34452 |
| 689 | nmdc:mga03683_579_c1 | 3300050489 | Bacteria | 10505 |
| 690 | Ga0500572_003770 | 3300053111 | Bacteria | 3439 |
| 691 | Ga0500659_0005178 | 3300053135 | Bacteria | 7339 |
| 692 | Ga0500573_0036557 | 3300053140 | Bacteria | 2836 |
| 693 | Ga0500634_0013813 | 3300053161 | Bacteria | 4244 |
| 694 | 2510285356 | 2510065053 | Bacteria | 5005518 |
| 695 | 2510294772 | 2510065055 | Bacteria | 5037935 |
| 696 | 2510311368 | 2510065058 | Bacteria | 5005894 |
| 697 | 2511265662 | 2511231006 | Bacteria | 6794709 |
| 698 | 2511270896 | 2511231007 | Bacteria | 6306603 |
| 699 | 2511279504 | 2511231008 | Bacteria | 6624100 |
| 700 | 2511294543 | 2511231011 | Bacteria | 6149768 |
| 701 | 2511304699 | 2511231012 | Bacteria | 6738011 |
| 702 | 2511311273 | 2511231014 | Bacteria | 6462302 |
| 703 | 2511318009 | 2511231015 | Bacteria | 6598026 |
| 704 | 2511333215 | 2511231017 | Bacteria | 6503007 |
| 705 | 2511349274 | 2511231020 | Bacteria | 6115223 |
| 706 | 2511355360 | 2511231021 | Bacteria | 7302637 |
| 707 | 2511367081 | 2511231023 | Bacteria | 6808468 |
| 708 | 2511376013 | 2511231024 | Bacteria | 5835885 |
| 709 | 2511411566 | 2511231031 | Bacteria | 6558529 |
| 710 | 2512327592 | 2512047018 | Bacteria | 6663241 |
| 711 | 2555247811 | 2554235231 | Bacteria | 5215788 |
| 712 | 2555672609 | 2554235341 | Bacteria | 6867980 |
| 713 | 2583795157 | 2582580891 | Bacteria | 6800976 |
| 714 | 2597860674 | 2597489887 | Bacteria | 6666321 |
| 715 | 2597866412 | 2597489888 | Bacteria | 6179543 |
| 716 | 2597872255 | 2597489889 | Bacteria | 6297495 |
| 717 | 2599330728 | 2599185155 | Bacteria | 5827168 |
| 718 | 2599400758 | 2599185167 | Bacteria | 6353609 |
| 719 | 2599450085 | 2599185179 | Bacteria | 6611171 |
| 720 | 2599486093 | 2599185185 | Bacteria | 6652270 |
| 721 | 2599505542 | 2599185189 | Bacteria | 5862825 |
| 722 | 2599512157 | 2599185190 | Bacteria | 6285678 |
| 723 | 2599517138 | 2599185191 | Bacteria | 6297582 |
| 724 | 2599804874 | 2599185257 | Bacteria | 6492581 |
| 725 | 2599878821 | 2599185288 | Bacteria | 6666191 |
| 726 | 2599892481 | 2599185290 | Bacteria | 6289611 |
| 727 | 2599951033 | 2599185303 | Bacteria | 6512725 |
| 728 | 2599975156 | 2599185307 | Bacteria | 6194719 |
| 729 | 2601693654 | 2600255296 | Bacteria | 5784754 |
| 730 | 2621297052 | 2619619299 | Bacteria | 6649820 |
| 731 | 2624483195 | 2623620443 | Bacteria | 6427864 |
| 732 | 2624494720 | 2623620446 | Bacteria | 6500345 |
| 733 | 2643842759 | 2643221565 | Bacteria | 6216018 |
| 734 | 2643872049 | 2643221571 | Bacteria | 6228673 |
| 735 | 2643955845 | 2643221589 | Bacteria | 6250934 |
| 736 | 2644020639 | 2643221602 | Bacteria | 6249926 |
| 737 | 2644186155 | 2643221633 | Bacteria | 6733554 |
| 738 | 2644398185 | 2643221672 | Bacteria | 6322190 |
| 739 | 2671771881 | 2671180172 | Bacteria | 6495783 |
| 740 | 2677896914 | 2675903420 | Bacteria | 6247433 |
| 741 | 2715750036 | 2713897148 | Bacteria | 5883533 |
| 742 | 2718636398 | 2718217725 | Bacteria | 5758958 |
| 743 | 2723251151 | 2721755607 | Bacteria | 5841722 |
| 744 | 2738671873 | 2738541265 | Bacteria | 6594665 |
| 745 | 2738690246 | 2738541271 | Bacteria | 5657310 |
| 746 | 2738750267 | 2738541282 | Bacteria | 6593925 |
| 747 | 2738807038 | 2738541294 | Bacteria | 6925949 |
| 748 | 2738859307 | 2738541303 | Bacteria | 6591772 |
| 749 | 2738894398 | 2738541309 | Bacteria | 6926455 |
| 750 | 2739198846 | 2738543004 | Bacteria | 6381073 |
| 751 | 2739261575 | 2738543015 | Bacteria | 6750701 |
| 752 | 2739266020 | 2738543016 | Bacteria | 5657564 |
| 753 | 2739289708 | 2738543020 | Bacteria | 5718238 |
| 754 | 2739295020 | 2738543021 | Bacteria | 5718241 |
| 755 | 2739312727 | 2738543025 | Bacteria | 6600348 |
| 756 | 2743740221 | 2740892503 | Bacteria | 6855563 |
| 757 | 2765586420 | 2765235841 | Bacteria | 6137024 |
| 758 | 2774118597 | 2773857670 | Bacteria | 6407454 |
| 759 | 2774129606 | 2773857672 | Bacteria | 4993178 |
| 760 | 2774135784 | 2773857673 | Bacteria | 6513460 |
| 761 | 2784262037 | 2784132063 | Bacteria | 6262788 |
| 762 | 2784313270 | 2784132072 | Bacteria | 6596533 |
| 763 | 2807410665 | 2806310737 | Bacteria | 5751088 |
| 764 | 2807459006 | 2806310745 | Bacteria | 5742165 |
| 765 | 2808906349 | 2808606373 | Bacteria | 4423627 |
| 766 | 2808928664 | 2808606377 | Bacteria | 6646337 |
| 767 | 2808950153 | 2808606381 | Bacteria | 6646461 |
| 768 | 2808975928 | 2808606385 | Bacteria | 6711065 |
| 769 | 2808993037 | 2808606388 | Bacteria | 6706662 |
| 770 | 2812369281 | 2811994881 | Bacteria | 6298475 |
| 771 | 2817493834 | 2816332298 | Bacteria | 6852809 |
| 772 | 2819654917 | 2818991456 | Bacteria | 6123676 |
| 773 | 2823421792 | 2823421272 | Bacteria | 5372474 |
| 774 | 2826582010 | 2826581358 | Bacteria | 5963467 |
| 775 | 2834030741 | 2834028612 | Bacteria | 6354979 |
| 776 | 2842819367 | 2842815866 | Bacteria | 5947510 |
| 777 | 2842829224 | 2842826826 | Bacteria | 5974129 |
| 778 | 2842833256 | 2842832357 | Bacteria | 5959113 |
| 779 | 2842842073 | 2842837860 | Bacteria | 6066181 |
| 780 | 2842845484 | 2842843487 | Bacteria | 6004777 |
| 781 | 2842852345 | 2842849001 | Bacteria | 5924277 |
| 782 | 2852616139 | 2852612431 | Bacteria | 6885235 |
| 783 | 2852662464 | 2852657418 | Bacteria | 6472974 |
| 784 | 2852671107 | 2852667396 | Bacteria | 6885555 |
| 785 | 2860341501 | 2860339153 | Bacteria | 6846989 |
| 786 | 2880235780 | 2880230671 | Bacteria | 6140320 |
| 787 | 2904453576 | 2904449895 | Bacteria | 6927402 |
| 788 | 2904459093 | 2904456579 | Bacteria | 6819253 |
| 789 | 2904519169 | 2904518522 | Bacteria | 6068986 |
| 790 | 2904552198 | 2904550169 | Bacteria | 6221258 |
| 791 | 2908452355 | 2908446538 | Bacteria | 6829095 |
| 792 | 2912968699 | 2912963787 | Bacteria | 5646108 |
| 793 | 2917834574 | 2917832318 | Bacteria | 5346010 |
| 794 | 2919065740 | 2919063839 | Bacteria | 6302690 |
| 795 | 2919127218 | 2919125081 | Bacteria | 5385106 |
| 796 | 2919155733 | 2919155634 | Bacteria | 4860545 |
| 797 | 2919389405 | 2919385768 | Bacteria | 5897293 |
| 798 | 2919457336 | 2919456309 | Bacteria | 6586567 |
| 799 | 2919488370 | 2919487758 | Bacteria | 5929766 |
| 800 | 2919505669 | 2919501602 | Bacteria | 5286340 |
| 801 | 2919700784 | 2919697872 | Bacteria | 6553725 |
| 802 | 2923159313 | 2923153595 | Bacteria | 6870622 |
| 803 | 2923523366 | 2923519811 | Bacteria | 6298479 |
| 804 | 2926068053 | 2926063275 | Bacteria | 5285848 |
| 805 | 2929194933 | 2929189879 | Bacteria | 5930554 |
| 806 | 2929522408 | 2929520902 | Bacteria | 6765052 |
| 807 | 2931396204 | 2931390751 | Bacteria | 6273349 |
| 808 | 2931397854 | 2931396565 | Bacteria | 7251677 |
| 809 | 2939642082 | 2939636861 | Bacteria | 6297853 |
| 810 | 2939654039 | 2939651529 | Bacteria | 5895393 |
| 811 | 2945931128 | 2945928738 | Bacteria | 6053221 |
| 812 | 2945966625 | 2945961074 | Bacteria | 7342064 |
| 813 | 2946007153 | 2946006987 | Bacteria | 6705746 |
| 814 | 2946027692 | 2946027586 | Bacteria | 6049274 |
| 815 | 2947234205 | 2947233263 | Bacteria | 6439278 |
| 816 | 2969309960 | 2969304461 | Bacteria | 6601805 |
| 817 | 2974294291 | 2974289157 | Bacteria | 6080362 |
| 818 | 2974301993 | 2974298342 | Bacteria | 4840922 |
| 819 | 2984500439 | 2984499530 | Bacteria | 5020881 |
| 820 | 2984506952 | 2984504281 | Bacteria | 5262371 |
| 821 | 2990199557 | 2990196909 | Bacteria | 4054280 |
| 822 | 2998145186 | 2998139840 | Bacteria | 6073514 |
| 823 | 3007254680 | 3007252601 | Bacteria | 4559114 |
| 824 | 3007316542 | 3007315729 | Bacteria | 5076637 |
| 825 | 3007616544 | 3007614139 | Bacteria | 6053559 |
| 826 | 3007719297 | 3007718800 | Bacteria | 5971527 |
| 827 | 3007805369 | 3007803356 | Bacteria | 5931491 |
| 828 | 3007858103 | 3007855910 | Bacteria | 5637581 |
| 829 | 3007865315 | 3007861166 | Bacteria | 6045338 |
| 830 | 3007872404 | 3007872151 | Bacteria | 5268868 |
| 831 | 8011352503 | 8011350971 | Bacteria | 6158957 |
| 832 | 8015693402 | 8015687852 | Bacteria | 6613826 |
| 833 | 8019777892 | 8019775933 | Bacteria | 6858656 |
| 834 | 8029995710 | 8029995093 | Bacteria | 5990776 |
| 835 | 8034966408 | 8034962539 | Bacteria | 4884839 |
| 836 | 8052499634 | 8052494512 | Bacteria | 5765634 |
| 837 | 8054291592 | 8054285046 | Bacteria | 6919322 |
| 838 | 8054349792 | 8054347763 | Bacteria | 5901107 |
| 839 | 8054508705 | 8054503363 | Bacteria | 6101651 |
| 840 | 8054934191 | 8054929484 | Bacteria | 5599761 |
| 841 | 8055776653 | 8055770955 | Bacteria | 6827675 |
| 842 | 8055823679 | 8055817908 | Bacteria | 6609162 |
| 843 | 8056115957 | 8056115690 | Bacteria | 5527654 |
| 844 | 8056121089 | 8056120720 | Bacteria | 5758328 |
| 845 | 8056131396 | 8056125926 | Bacteria | 6228218 |
| 846 | 8056137106 | 8056131705 | Bacteria | 6107031 |
| 847 | 8056137806 | 8056137416 | Bacteria | 6147080 |
| 848 | 8056151716 | 8056148874 | Bacteria | 6479865 |
| 849 | 8056160631 | 8056155041 | Bacteria | 6486948 |
| 850 | 8056163405 | 8056161164 | Bacteria | 6106669 |
| 851 | 8056171382 | 8056166840 | Bacteria | 5820959 |
| 852 | 8056177626 | 8056172158 | Bacteria | 6133900 |
| 853 | 8056181792 | 8056177738 | Bacteria | 6748268 |
| 854 | 8056570253 | 8056569372 | Bacteria | 5997322 |
| 855 | Ga0495617_031435 | |||
| 856 | MRS2a_Contig_1749 | |||
| 857 | JGI24741J21665_1002957 | |||
| 858 | JGI25162J39368_1000076 | |||
| 859 | JGI25162J39368_1000104 | |||
| 860 | JGI25154J39366_1005394 | |||
| 861 | JGI25163J39215_1000198 | |||
| 862 | JGI25164J39214_1000083 | |||
| 863 | JGI25164J39214_1000084 | |||
| 864 | JGI25165J46597_1000140 | |||
| 865 | JGI25165J46597_1000186 | |||
| 866 | Ga0006562J51391_1056221 | |||
| 867 | Ga0006562J51391_1056222 | |||
| 868 | Ga0055538_1000074 | |||
| 869 | Ga0055539_1000112 | |||
| 870 | Ga0055533_1000118 | |||
| 871 | Ga0055532_1000106 | |||
| 872 | Ga0055525_1000157 | |||
| 873 | Ga0055535_1002953 | |||
| 874 | Ga0055536_1000289 | |||
| 875 | Ga0055536_1000620 | |||
| 876 | Ga0055536_1000625 | |||
| 877 | Ga0055530_10000389 | |||
| 878 | Ga0055530_10000757 | |||
| 879 | Ga0055530_10001107 | |||
| 880 | Ga0055540_1000259 | |||
| 881 | Ga0055540_1000366 | |||
| 882 | Ga0055540_1001425 | |||
| 883 | Ga0055531_10000109 | |||
| 884 | Ga0055541_1000075 | |||
| 885 | Ga0058692_1010636 | |||
| 886 | Ga0065714_10000526 | |||
| 887 | Ga0065714_10006723 | |||
| 888 | Ga0065714_10079851 | |||
| 889 | Ga0065714_10095472 | |||
| 890 | Ga0065704_10001207 | |||
| 891 | Ga0065704_10079943 | |||
| 892 | Ga0065712_10017828 | |||
| 893 | Ga0070670_100000368 | |||
| 894 | Ga0070670_100056184 | |||
| 895 | Ga0070661_100000038 | |||
| 896 | Ga0070669_100000626 | |||
| 897 | Ga0070669_100003116 | |||
| 898 | Ga0070662_100000787 | |||
| 899 | Ga0070662_100032555 | |||
| 900 | Ga0068853_100000155 | |||
| 901 | Ga0070665_100011929 | |||
| 902 | Ga0070665_100080326 | |||
| 903 | Ga0070664_100001315 | |||
| 904 | Ga0070664_100038811 | |||
| 905 | Ga0068854_100003965 | |||
| 906 | Ga0068851_10000012 | |||
| 907 | Ga0075364_10093140 | |||
| 908 | Ga0075364_10286262 | |||
| 909 | Ga0075432_10002115 | |||
| 910 | Ga0075432_10009609 | |||
| 911 | Ga0075362_10001209 | |||
| 912 | Ga0075362_10023071 | |||
| 913 | Ga0099823_1001650 | |||
| 914 | Ga0079104_1000752 | |||
| 915 | Ga0105251_10000019 | |||
| 916 | Ga0105251_10001508 | |||
| 917 | Ga0105251_10001556 | |||
| 918 | Ga0105251_10001642 | |||
| 919 | Ga0105251_10002891 | |||
| 920 | Ga0105251_10014004 | |||
| 921 | Ga0105244_10000150 | |||
| 922 | Ga0105244_10000711 | |||
| 923 | Ga0105244_10001478 | |||
| 924 | Ga0105244_10006568 | |||
| 925 | Ga0105244_10007253 | |||
| 926 | Ga0105244_10037387 | |||
| 927 | Ga0105244_10061700 | |||
| 928 | Ga0105244_10065901 | |||
| 929 | Ga0105244_10069185 | |||
| 930 | Ga0105244_10082667 | |||
| 931 | Ga0105250_10000519 | |||
| 932 | Ga0105250_10000752 | |||
| 933 | Ga0105250_10023832 | |||
| 934 | Ga0105250_10053748 | |||
| 935 | Ga0105243_10119166 | |||
| 936 | Ga0105242_10000169 | |||
| 937 | Ga0105242_10030577 | |||
| 938 | Ga0105248_10232939 | |||
| 939 | Ga0105237_10005893 | |||
| 940 | Ga0105246_10000617 | |||
| 941 | Ga0105246_10001973 | |||
| 942 | Ga0157345_1000021 | |||
| 943 | Ga0157373_10001281 | |||
| 944 | Ga0157373_10004690 | |||
| 945 | Ga0157373_10023736 | |||
| 946 | Ga0157373_10043580 | |||
| 947 | Ga0157373_10106007 | |||
| 948 | Ga0157373_10138254 | |||
| 949 | Ga0157373_10204153 | |||
| 950 | Ga0157371_10001747 | |||
| 951 | Ga0157371_10002492 | |||
| 952 | Ga0157371_10006333 | |||
| 953 | Ga0157370_10016538 | |||
| 954 | Ga0157370_10067825 | |||
| 955 | Ga0157370_10133835 | |||
| 956 | Ga0157369_10006372 | |||
| 957 | Ga0157369_10007915 | |||
| 958 | Ga0157369_10028628 | |||
| 959 | Ga0157369_10057638 | |||
| 960 | Ga0157369_10073051 | |||
| 961 | Ga0163162_10001061 | |||
| 962 | Ga0163162_10240437 | |||
| 963 | Ga0157372_10012514 | |||
| 964 | Ga0157372_10022580 | |||
| 965 | Ga0157372_10059867 | |||
| 966 | Ga0157375_10005580 | |||
| 967 | Ga0157375_10069687 | |||
| 968 | Ga0182008_10006385 | |||
| 969 | Ga0182008_10014722 | |||
| 970 | Ga0182008_10018747 | |||
| 971 | Ga0182008_10021787 | |||
| 972 | Ga0182008_10023826 | |||
| 973 | Ga0182008_10030419 | |||
| 974 | Ga0182008_10034988 | |||
| 975 | Ga0182006_1001027 | |||
| 976 | Ga0182006_1001586 | |||
| 977 | Ga0182006_1001598 | |||
| 978 | Ga0182006_1023686 | |||
| 979 | Ga0182006_1033011 | |||
| 980 | Ga0182006_1035592 | |||
| 981 | Ga0182007_10000408 | |||
| 982 | Ga0182007_10001004 | |||
| 983 | Ga0182005_1002494 | |||
| 984 | Ga0182005_1003495 | |||
| 985 | Ga0182005_1003776 | |||
| 986 | Ga0182005_1017337 | |||
| 987 | Ga0182005_1023792 | |||
| 988 | Ga0163161_10001087 | |||
| 989 | Ga0163161_10044753 | |||
| 990 | Ga0163161_10107479 | |||
| 991 | Ga0163161_10339589 | |||
| 992 | Ga0163161_10425647 | |||
| 993 | Ga0209760_100098 | |||
| 994 | Ga0209760_100274 | |||
| 995 | Ga0209784_100007 | |||
| 996 | Ga0209566_100062 | |||
| 997 | Ga0209674_100132 | |||
| 998 | Ga0209147_100009 | |||
| 999 | Ga0209563_100018 | |||
| 1000 | Ga0207427_100005 | |||
| 1001 | Ga0207427_100006 | |||
| 1002 | Ga0209437_100013 | |||
| 1003 | Ga0209437_100018 | |||
| 1004 | Ga0209258_100330 | |||
| 1005 | Ga0209646_1000185 | |||
| 1006 | Ga0209677_100056 | |||
| 1007 | Ga0209759_1014981 | |||
| 1008 | Ga0209233_1000021 | |||
| 1009 | Ga0209233_1000022 | |||
| 1010 | Ga0209676_1000015 | |||
| 1011 | Ga0209676_1000030 | |||
| 1012 | Ga0209676_1000041 | |||
| 1013 | Ga0209676_1000917 | |||
| 1014 | Ga0209050_1000075 | |||
| 1015 | Ga0209050_1000128 | |||
| 1016 | Ga0209050_1001373 | |||
| 1017 | Ga0209051_1000012 | |||
| 1018 | Ga0209051_1000041 | |||
| 1019 | Ga0209051_1000144 | |||
| 1020 | Ga0209051_1009490 | |||
| 1021 | Ga0209257_1000069 | |||
| 1022 | Ga0207656_10000006 | |||
| 1023 | Ga0207696_1000031 | |||
| 1024 | Ga0207696_1000064 | |||
| 1025 | Ga0207696_1000094 | |||
| 1026 | Ga0207696_1000095 | |||
| 1027 | Ga0207696_1000149 | |||
| 1028 | Ga0207696_1002997 | |||
| 1029 | Ga0207696_1008634 | |||
| 1030 | Ga0207696_1017447 | |||
| 1031 | Ga0207696_1037243 | |||
| 1032 | Ga0207655_1000107 | |||
| 1033 | Ga0207655_1000455 | |||
| 1034 | Ga0207655_1000847 | |||
| 1035 | Ga0207655_1000992 | |||
| 1036 | Ga0207655_1001195 | |||
| 1037 | Ga0207655_1001311 | |||
| 1038 | Ga0207655_1002303 | |||
| 1039 | Ga0207655_1012388 | |||
| 1040 | Ga0207655_1012657 | |||
| 1041 | Ga0207655_1013711 | |||
| 1042 | Ga0207655_1017834 | |||
| 1043 | Ga0207655_1031824 | |||
| 1044 | Ga0207655_1032389 | |||
| 1045 | Ga0207713_1000010 | |||
| 1046 | Ga0207713_1001139 | |||
| 1047 | Ga0207713_1001437 | |||
| 1048 | Ga0207713_1001904 | |||
| 1049 | Ga0207713_1002108 | |||
| 1050 | Ga0207713_1002895 | |||
| 1051 | Ga0207713_1008495 | |||
| 1052 | Ga0207713_1011728 | |||
| 1053 | Ga0207713_1013045 | |||
| 1054 | Ga0207713_1015928 | |||
| 1055 | Ga0207713_1024358 | |||
| 1056 | Ga0207671_10000299 | |||
| 1057 | Ga0207649_10000022 | |||
| 1058 | Ga0207681_10000422 | |||
| 1059 | Ga0207681_10002906 | |||
| 1060 | Ga0207650_10000138 | |||
| 1061 | Ga0207650_10000159 | |||
| 1062 | Ga0207706_10000290 | |||
| 1063 | Ga0207706_10004400 | |||
| 1064 | Ga0207686_10000305 | |||
| 1065 | Ga0207686_10171489 | |||
| 1066 | Ga0207709_10000086 | |||
| 1067 | Ga0207709_10008628 | |||
| 1068 | Ga0207711_10158830 | |||
| 1069 | Ga0207679_10000027 | |||
| 1070 | Ga0207639_10001167 | |||
| 1071 | Ga0209281_1000016 | |||
| 1072 | Ga0209281_1001719 | |||
| 1073 | Ga0209389_1000095 | |||
| 1074 | Ga0209371_1000066 | |||
| 1075 | Ga0209371_1004519 | |||
| 1076 | Ga0207428_10011576 | |||
| 1077 | Ga0207428_10042461 | |||
| 1078 | Ga0207428_10049641 | |||
| 1079 | Ga0207428_10049870 | |||
| 1080 | Ga0207428_10082591 | |||
| 1081 | Ga0207428_10158677 | |||
| 1082 | Ga0207428_10177269 | |||
| 1083 | Ga0268266_10006578 | |||
| 1084 | Ga0265334_10000011 | |||
| 1085 | Ga0268256_1000063 | |||
| 1086 | Ga0268256_1003588 | |||
| 1087 | Ga0307511_10040857 | |||
| 1088 | Ga0316179_1031537 | |||
| 1089 | Ga0316178_1083275 | |||
| 1090 | Ga0307408_100000019 | |||
| 1091 | Ga0307408_100001812 | |||
| 1092 | Ga0307408_100127531 | |||
| 1093 | Ga0307405_10019766 | |||
| 1094 | Ga0307405_10431161 | |||
| 1095 | Ga0307413_10132296 | |||
| 1096 | Ga0307406_10000970 | |||
| 1097 | Ga0307412_10024028 | |||
| 1098 | Ga0307412_10151144 | |||
| 1099 | Ga0307409_100020735 | |||
| 1100 | Ga0307416_100162343 | |||
| 1101 | Ga0307414_10077621 | |||
| 1102 | Ga0307411_10003310 | |||
| 1103 | Ga0307411_10204196 | |||
| 1104 | Ga0307510_10002877 | |||
| 1105 | Ga0373925_0199427 | |||
| 1106 | Ga0395905_0010256 | |||
| 1107 | Ga0237819_00209 | |||
| 1108 | Ga0400487_09819 | |||
| 1109 | Ga0439436_0003377 | |||
| 1110 | Ga0439438_000779 | |||
| 1111 | Ga0439438_000931 | |||
| 1112 | Ga0439438_012440 | |||
| 1113 | Ga0439447_023349 | |||
| 1114 | Ga0439466_0001641 | |||
| 1115 | Ga0439466_0003559 | |||
| 1116 | Ga0439466_0011358 | |||
| 1117 | Ga0439432_000859 | |||
| 1118 | Ga0439432_003308 | |||
| 1119 | Ga0439432_009057 | |||
| 1120 | Ga0439432_014193 | |||
| 1121 | Ga0439432_035953 | |||
| 1122 | Ga0439451_005341 | |||
| 1123 | Ga0439452_000507 | |||
| 1124 | Ga0439452_000648 | |||
| 1125 | Ga0439452_003067 | |||
| 1126 | Ga0439456_000068 | |||
| 1127 | Ga0439456_002218 | |||
| 1128 | Ga0439456_004119 | |||
| 1129 | Ga0439463_000149 | |||
| 1130 | Ga0439463_000438 | |||
| 1131 | Ga0450911_000003 | |||
| 1132 | Ga0450911_000581 | |||
| 1133 | Ga0450917_001206 | |||
| 1134 | Ga0450922_000034 | |||
| 1135 | Ga0450923_000592 | |||
| 1136 | Ga0450904_000051 | |||
| 1137 | Ga0450904_000479 | |||
| 1138 | Ga0450906_007442 | |||
| 1139 | Ga0450907_000760 | |||
| 1140 | Ga0439446_0002675 | |||
| 1141 | Ga0450908_003667 | |||
| 1142 | Ga0439464_0000142 | |||
| 1143 | Ga0439460_0003661 | |||
| 1144 | Ga0450916_000325 | |||
| 1145 | Ga0439440_0001743 | |||
| 1146 | Ga0453684_0052308 | |||
| 1147 | Ga0495617_000582 | |||
| 1148 | Ga0495617_002152 | |||
| 1149 | Ga0495617_010002 | |||
| 1150 | Ga0495617_027341 | |||
| 1151 | Ga0495627_000023 | |||
| 1152 | Ga0495627_000134 | |||
| 1153 | Ga0495627_001005 | |||
| 1154 | Ga0495627_002276 | |||
| 1155 | Ga0495627_004374 | |||
| 1156 | Ga0495627_014907 | |||
| 1157 | Ga0495603_0063755 | |||
| 1158 | Ga0495590_0000356 | |||
| 1159 | Ga0495590_0001252 | |||
| 1160 | Ga0495590_0056514 | |||
| 1161 | Ga0495591_000025 | |||
| 1162 | Ga0495591_000728 | |||
| 1163 | Ga0495591_000970 | |||
| 1164 | Ga0495591_001914 | |||
| 1165 | Ga0495591_001960 | |||
| 1166 | Ga0495591_003795 | |||
| 1167 | Ga0495591_006789 | |||
| 1168 | Ga0495591_012572 | |||
| 1169 | Ga0495591_017961 | |||
| 1170 | Ga0495591_025601 | |||
| 1171 | Ga0495638_0002423 | |||
| 1172 | Ga0495638_0009363 | |||
| 1173 | Ga0495638_0016132 | |||
| 1174 | Ga0495638_0022024 | |||
| 1175 | Ga0495638_0023288 | |||
| 1176 | Ga0495638_0026660 | |||
| 1177 | Ga0495638_0077315 | |||
| 1178 | Ga0495653_0002339 | |||
| 1179 | Ga0495653_0003298 | |||
| 1180 | Ga0495653_0017970 | |||
| 1181 | Ga0495650_0002155 | |||
| 1182 | Ga0495650_0003462 | |||
| 1183 | Ga0495650_0009445 | |||
| 1184 | Ga0495650_0016777 | |||
| 1185 | Ga0495605_0001169 | |||
| 1186 | Ga0495605_0003351 | |||
| 1187 | Ga0495605_0015636 | |||
| 1188 | Ga0495605_0040265 | |||
| 1189 | Ga0495639_0000577 | |||
| 1190 | Ga0495639_0015405 | |||
| 1191 | Ga0495584_0001354 | |||
| 1192 | Ga0495584_0007191 | |||
| 1193 | Ga0495584_0010611 | |||
| 1194 | Ga0495584_0020423 | |||
| 1195 | Ga0495584_0031642 | |||
| 1196 | Ga0495584_0039065 | |||
| 1197 | Ga0495584_0055637 | |||
| 1198 | Ga0495585_0000705 | |||
| 1199 | Ga0495585_0001233 | |||
| 1200 | Ga0495585_0003913 | |||
| 1201 | Ga0495585_0012245 | |||
| 1202 | Ga0495585_0014493 | |||
| 1203 | Ga0495585_0018776 | |||
| 1204 | Ga0495585_0021613 | |||
| 1205 | Ga0495594_0066064 | |||
| 1206 | Ga0495596_0000478 | |||
| 1207 | Ga0495607_0000069 | |||
| 1208 | Ga0495607_0001688 | |||
| 1209 | Ga0495607_0003172 | |||
| 1210 | Ga0495607_0003303 | |||
| 1211 | Ga0495607_0004123 | |||
| 1212 | Ga0495607_0009558 | |||
| 1213 | Ga0495607_0011736 | |||
| 1214 | Ga0495607_0012648 | |||
| 1215 | Ga0495607_0055511 | |||
| 1216 | Ga0495607_0090195 | |||
| 1217 | Ga0495607_0119073 | |||
| 1218 | Ga0495583_0002951 | |||
| 1219 | Ga0495583_0003018 | |||
| 1220 | Ga0495583_0043336 | |||
| 1221 | Ga0495583_0053729 | |||
| 1222 | Ga0495606_0004110 | |||
| 1223 | Ga0495606_0006032 | |||
| 1224 | Ga0495606_0006404 | |||
| 1225 | Ga0495606_0010755 | |||
| 1226 | Ga0495606_0018269 | |||
| 1227 | Ga0495606_0022823 | |||
| 1228 | Ga0495606_0070275 | |||
| 1229 | Ga0495606_0089323 | |||
| 1230 | Ga0495610_0002777 | |||
| 1231 | Ga0495610_0005863 | |||
| 1232 | Ga0495610_0013003 | |||
| 1233 | Ga0495610_0023436 | |||
| 1234 | Ga0495616_0002193 | |||
| 1235 | Ga0495616_0002782 | |||
| 1236 | Ga0495616_0017155 | |||
| 1237 | Ga0495616_0057430 | |||
| 1238 | Ga0495616_0072336 | |||
| 1239 | Ga0495620_0000879 | |||
| 1240 | Ga0495620_0001236 | |||
| 1241 | Ga0495620_0001871 | |||
| 1242 | Ga0495620_0005263 | |||
| 1243 | Ga0495620_0005831 | |||
| 1244 | Ga0495620_0082316 | |||
| 1245 | Ga0495630_0128933 | |||
| 1246 | Ga0495631_0000557 | |||
| 1247 | Ga0495631_0001273 | |||
| 1248 | Ga0495631_0001898 | |||
| 1249 | Ga0495631_0009216 | |||
| 1250 | Ga0495631_0022766 | |||
| 1251 | Ga0495631_0100615 | |||
| 1252 | Ga0495632_0002203 | |||
| 1253 | Ga0495632_0002244 | |||
| 1254 | Ga0495632_0002355 | |||
| 1255 | Ga0495632_0006993 | |||
| 1256 | Ga0495632_0028208 | |||
| 1257 | Ga0495632_0044728 | |||
| 1258 | Ga0495632_0064361 | |||
| 1259 | Ga0495632_0070666 | |||
| 1260 | Ga0495632_0071073 | |||
| 1261 | Ga0495637_0000982 | |||
| 1262 | Ga0495637_0001013 | |||
| 1263 | Ga0495637_0002185 | |||
| 1264 | Ga0495637_0004272 | |||
| 1265 | Ga0495637_0005147 | |||
| 1266 | Ga0495637_0007429 | |||
| 1267 | Ga0495637_0016381 | |||
| 1268 | Ga0495637_0018073 | |||
| 1269 | Ga0495637_0018784 | |||
| 1270 | Ga0495637_0020252 | |||
| 1271 | Ga0495637_0024037 | |||
| 1272 | Ga0495637_0034885 | |||
| 1273 | Ga0495637_0053008 | |||
| 1274 | Ga0495637_0057048 | |||
| 1275 | Ga0495643_0001214 | |||
| 1276 | Ga0495643_0006720 | |||
| 1277 | Ga0495643_0013302 | |||
| 1278 | Ga0495643_0030237 | |||
| 1279 | Ga0495643_0056107 | |||
| 1280 | Ga0495643_0087371 | |||
| 1281 | Ga0495644_0000474 | |||
| 1282 | Ga0495644_0033998 | |||
| 1283 | Ga0495644_0045073 | |||
| 1284 | Ga0495648_0001169 | |||
| 1285 | Ga0495648_0001874 | |||
| 1286 | Ga0495648_0002169 | |||
| 1287 | Ga0495648_0004794 | |||
| 1288 | Ga0495648_0005415 | |||
| 1289 | Ga0495648_0023508 | |||
| 1290 | Ga0495648_0028304 | |||
| 1291 | Ga0495648_0038394 | |||
| 1292 | Ga0495648_0093759 | |||
| 1293 | Ga0495648_0094826 | |||
| 1294 | Ga0495648_0139352 | |||
| 1295 | Ga0495642_0000253 | |||
| 1296 | Ga0495642_0000574 | |||
| 1297 | Ga0495642_0001251 | |||
| 1298 | Ga0495654_0000947 | |||
| 1299 | Ga0495654_0001612 | |||
| 1300 | Ga0495654_0002089 | |||
| 1301 | Ga0495654_0002168 | |||
| 1302 | Ga0495654_0002476 | |||
| 1303 | Ga0495654_0010516 | |||
| 1304 | Ga0495654_0015217 | |||
| 1305 | Ga0495654_0018982 | |||
| 1306 | Ga0495654_0023761 | |||
| 1307 | Ga0495654_0028857 | |||
| 1308 | Ga0495654_0031052 | |||
| 1309 | Ga0495654_0047218 | |||
| 1310 | Ga0495587_0009814 | |||
| 1311 | Ga0495609_0000057 | |||
| 1312 | Ga0495609_0010555 | |||
| 1313 | Ga0495609_0012057 | |||
| 1314 | Ga0495609_0016335 | |||
| 1315 | Ga0495609_0126374 | |||
| 1316 | Ga0495597_0000229 | |||
| 1317 | Ga0495597_0001472 | |||
| 1318 | Ga0495597_0002031 | |||
| 1319 | Ga0495597_0004119 | |||
| 1320 | Ga0495597_0010651 | |||
| 1321 | Ga0495597_0031005 | |||
| 1322 | Ga0495622_0000871 | |||
| 1323 | Ga0495622_0001113 | |||
| 1324 | Ga0495622_0003393 | |||
| 1325 | Ga0495622_0051148 | |||
| 1326 | Ga0495633_0002371 | |||
| 1327 | Ga0495656_0032589 | |||
| 1328 | Ga0495668_0001637 | |||
| 1329 | Ga0495668_0010876 | |||
| 1330 | Ga0495668_0011902 | |||
| 1331 | Ga0495668_0013844 | |||
| 1332 | Ga0495611_0000398 | |||
| 1333 | Ga0495625_0001611 | |||
| 1334 | Ga0495625_0005979 | |||
| 1335 | Ga0495625_0008586 | |||
| 1336 | Ga0495625_0010435 | |||
| 1337 | Ga0495625_0015095 | |||
| 1338 | Ga0495625_0024032 | |||
| 1339 | Ga0495625_0028783 | |||
| 1340 | Ga0495625_0055556 | |||
| 1341 | Ga0495625_0061846 | |||
| 1342 | Ga0495635_0002400 | |||
| 1343 | Ga0495635_0014787 | |||
| 1344 | Ga0495659_0024028 | |||
| 1345 | Ga0495661_0000027 | |||
| 1346 | Ga0495661_0000571 | |||
| 1347 | Ga0495661_0003441 | |||
| 1348 | Ga0495661_0012541 | |||
| 1349 | Ga0495661_0027461 | |||
| 1350 | Ga0495661_0129785 | |||
| 1351 | Ga0495661_0132934 | |||
| 1352 | Ga0495588_0003618 | |||
| 1353 | Ga0495588_0015925 | |||
| 1354 | Ga0495623_0004003 | |||
| 1355 | Ga0495646_0003143 | |||
| 1356 | Ga0495646_0014400 | |||
| 1357 | Ga0495613_0023434 | |||
| 1358 | Ga0495624_0001016 | |||
| 1359 | Ga0495670_0000898 | |||
| 1360 | Ga0495670_0001148 | |||
| 1361 | Ga0495670_0001629 | |||
| 1362 | Ga0495671_0000860 | |||
| 1363 | Ga0495671_0001062 | |||
| 1364 | Ga0495671_0002728 | |||
| 1365 | Ga0495671_0003121 | |||
| 1366 | Ga0495671_0006460 | |||
| 1367 | Ga0495671_0016960 | |||
| 1368 | Ga0495671_0025098 | |||
| 1369 | Ga0495671_0031230 | |||
| 1370 | Ga0495671_0073639 | |||
| 1371 | Ga0495671_0082388 | |||
| 1372 | Ga0495671_0087314 | |||
| 1373 | Ga0495671_0096697 | |||
| 1374 | Ga0495649_0000950 | |||
| 1375 | Ga0495649_0003030 | |||
| 1376 | Ga0495649_0009177 | |||
| 1377 | Ga0495649_0009407 | |||
| 1378 | Ga0495649_0012447 | |||
| 1379 | Ga0495649_0024115 | |||
| 1380 | Ga0495649_0094265 | |||
| 1381 | Ga0495649_0096994 | |||
| 1382 | Ga0495649_0180428 | |||
| 1383 | Ga0495589_0001444 | |||
| 1384 | Ga0495589_0006684 | |||
| 1385 | Ga0495589_0011088 | |||
| 1386 | Ga0495589_0013075 | |||
| 1387 | Ga0495600_0015051 | |||
| 1388 | Ga0495660_0001871 | |||
| 1389 | Ga0495660_0001949 | |||
| 1390 | Ga0495660_0004554 | |||
| 1391 | Ga0495660_0009310 | |||
| 1392 | Ga0495660_0009972 | |||
| 1393 | Ga0495660_0010711 | |||
| 1394 | Ga0495660_0013744 | |||
| 1395 | Ga0495660_0020234 | |||
| 1396 | Ga0495660_0037445 | |||
| 1397 | Ga0495660_0066718 | |||
| 1398 | Ga0495660_0071553 | |||
| 1399 | Ga0495660_0100319 | |||
| 1400 | Ga0495660_0101481 | |||
| 1401 | Ga0495604_0004835 | |||
| 1402 | Ga0495604_0042857 | |||
| 1403 | Ga0495636_0008286 | |||
| 1404 | Ga0495674_0010280 | |||
| 1405 | Ga0495672_0001187 | |||
| 1406 | Ga0495672_0001861 | |||
| 1407 | Ga0495672_0002241 | |||
| 1408 | Ga0495672_0002630 | |||
| 1409 | Ga0495672_0004619 | |||
| 1410 | Ga0495672_0008985 | |||
| 1411 | Ga0495672_0009137 | |||
| 1412 | Ga0495672_0009191 | |||
| 1413 | Ga0495672_0033904 | |||
| 1414 | Ga0495672_0034522 | |||
| 1415 | Ga0495672_0051836 | |||
| 1416 | Ga0495672_0061802 | |||
| 1417 | Ga0495672_0102697 | |||
| 1418 | Ga0495672_0171934 | |||
| 1419 | Ga0495676_0024333 | |||
| 1420 | Ga0495676_0037406 | |||
| 1421 | Ga0495680_0008892 | |||
| 1422 | Ga0495680_0040858 | |||
| 1423 | Ga0495680_0158885 | |||
| 1424 | Ga0495680_0305255 | |||
| 1425 | Ga0495683_0000032 | |||
| 1426 | Ga0495683_0000584 | |||
| 1427 | Ga0495683_0000905 | |||
| 1428 | Ga0495683_0011935 | |||
| 1429 | Ga0495683_0017678 | |||
| 1430 | Ga0495683_0022727 | |||
| 1431 | Ga0495687_001410 | |||
| 1432 | Ga0495687_001593 | |||
| 1433 | Ga0495687_001720 | |||
| 1434 | Ga0495675_0007362 | |||
| 1435 | Ga0495675_0195133 | |||
| 1436 | Ga0495677_0001304 | |||
| 1437 | Ga0495679_000721 | |||
| 1438 | Ga0495679_005501 | |||
| 1439 | Ga0495679_006071 | |||
| 1440 | Ga0495679_019394 | |||
| 1441 | Ga0495679_024712 | |||
| 1442 | Ga0495685_038423 | |||
| 1443 | Ga0495673_0001703 | |||
| 1444 | Ga0495673_0001708 | |||
| 1445 | Ga0495673_0001879 | |||
| 1446 | Ga0495673_0002166 | |||
| 1447 | Ga0495673_0003787 | |||
| 1448 | Ga0495673_0004038 | |||
| 1449 | Ga0495673_0004292 | |||
| 1450 | Ga0495673_0005096 | |||
| 1451 | Ga0495673_0005300 | |||
| 1452 | Ga0495673_0011643 | |||
| 1453 | Ga0495673_0050441 | |||
| 1454 | Ga0495673_0061429 | |||
| 1455 | Ga0495681_0001535 | |||
| 1456 | Ga0495681_0002339 | |||
| 1457 | Ga0495681_0002940 | |||
| 1458 | Ga0495681_0004215 | |||
| 1459 | Ga0495681_0005581 | |||
| 1460 | Ga0495681_0014801 | |||
| 1461 | Ga0495681_0015012 | |||
| 1462 | Ga0495681_0022720 | |||
| 1463 | Ga0495681_0041300 | |||
| 1464 | Ga0495681_0048687 | |||
| 1465 | Ga0495684_0025758 | |||
| 1466 | Ga0495686_0005103 | |||
| 1467 | Ga0495686_0006282 | |||
| 1468 | Ga0495686_0015694 | |||
| 1469 | Ga0495593_0067458 | |||
| 1470 | Ga0495602_0030875 | |||
| 1471 | Ga0495626_0000831 | |||
| 1472 | Ga0495626_0001108 | |||
| 1473 | Ga0495626_0002541 | |||
| 1474 | Ga0495626_0005222 | |||
| 1475 | Ga0495626_0006203 | |||
| 1476 | Ga0495626_0016707 | |||
| 1477 | Ga0495626_0053489 | |||
| 1478 | Ga0496102_0002311 | |||
| 1479 | Ga0496103_0002862 | |||
| 1480 | Ga0496116_0002775 | |||
| 1481 | Ga0496116_0004594 | |||
| 1482 | Ga0496116_0006605 | |||
| 1483 | Ga0496116_0007417 | |||
| 1484 | Ga0496116_0014607 | |||
| 1485 | Ga0496117_0005359 | |||
| 1486 | Ga0496117_0031812 | |||
| 1487 | Ga0496117_0211872 | |||
| 1488 | Ga0496117_0211885 | |||
| 1489 | Ga0496118_0007335 | |||
| 1490 | Ga0496118_0007906 | |||
| 1491 | Ga0496118_0009100 | |||
| 1492 | Ga0496118_0036847 | |||
| 1493 | Ga0496118_0079709 | |||
| 1494 | Ga0496118_0156456 | |||
| 1495 | Ga0496119_0000071 | |||
| 1496 | Ga0496120_0002726 | |||
| 1497 | Ga0496121_0007900 | |||
| 1498 | Ga0496121_0037516 | |||
| 1499 | Ga0496122_0002157 | |||
| 1500 | Ga0496122_0006460 | |||
| 1501 | Ga0496122_0010517 | |||
| 1502 | Ga0496122_0037573 | |||
| 1503 | Ga0496122_0094946 | |||
| 1504 | Ga0496123_0001464 | |||
| 1505 | Ga0496123_0011812 | |||
| 1506 | Ga0496123_0016348 | |||
| 1507 | Ga0496123_0049495 | |||
| 1508 | Ga0496123_0143414 | |||
| 1509 | Ga0496124_0000407 | |||
| 1510 | Ga0496124_0005384 | |||
| 1511 | Ga0496124_0006059 | |||
| 1512 | Ga0496124_0015951 | |||
| 1513 | Ga0496124_0022335 | |||
| 1514 | Ga0496124_0039119 | |||
| 1515 | Ga0496124_0039847 | |||
| 1516 | Ga0496124_0188712 | |||
| 1517 | Ga0496124_0352512 | |||
| 1518 | Ga0496125_0002636 | |||
| 1519 | Ga0496125_0002716 | |||
| 1520 | Ga0496125_0017906 | |||
| 1521 | Ga0496126_0062641 | |||
| 1522 | Ga0495678_000541 | |||
| 1523 | Ga0495678_001270 | |||
| 1524 | Ga0495678_001393 | |||
| 1525 | Ga0495678_002041 | |||
| 1526 | Ga0495678_003217 | |||
| 1527 | Ga0495678_008652 | |||
| 1528 | Ga0495678_028588 | |||
| 1529 | Ga0495678_036912 | |||
| 1530 | Ga0495678_052112 | |||
| 1531 | Ga0495682_0001635 | |||
| 1532 | Ga0495682_0003896 | |||
| 1533 | Ga0495682_0022278 | |||
| 1534 | Ga0495682_0055634 | |||
| 1535 | Ga0501032_0041522 | |||
| 1536 | Ga0501033_0093077 | |||
| 1537 | Ga0501034_0041130 | |||
| 1538 | Ga0501034_0150183 | |||
| 1539 | Ga0501034_0179197 | |||
| 1540 | Ga0501037_0101041 | |||
| 1541 | Ga0501035_0204272 | |||
| 1542 | Ga0501226_000065 | |||
| 1543 | nmdc:mga03683_579_c1 | |||
| 1544 | Ga0500572_003770 | |||
| 1545 | Ga0500659_0005178 | |||
| 1546 | Ga0500573_0036557 | |||
| 1547 | Ga0500634_0013813 | |||
| 1548 | 2510285356 | |||
| 1549 | 2510294772 | |||
| 1550 | 2510311368 | |||
| 1551 | 2511265662 | |||
| 1552 | 2511270896 | |||
| 1553 | 2511279504 | |||
| 1554 | 2511294543 | |||
| 1555 | 2511304699 | |||
| 1556 | 2511311273 | |||
| 1557 | 2511318009 | |||
| 1558 | 2511333215 | |||
| 1559 | 2511349274 | |||
| 1560 | 2511355360 | |||
| 1561 | 2511367081 | |||
| 1562 | 2511376013 | |||
| 1563 | 2511411566 | |||
| 1564 | 2512327592 | |||
| 1565 | 2555247811 | |||
| 1566 | 2555672609 | |||
| 1567 | 2583795157 | |||
| 1568 | 2597860674 | |||
| 1569 | 2597866412 | |||
| 1570 | 2597872255 | |||
| 1571 | 2599330728 | |||
| 1572 | 2599400758 | |||
| 1573 | 2599450085 | |||
| 1574 | 2599486093 | |||
| 1575 | 2599505542 | |||
| 1576 | 2599512157 | |||
| 1577 | 2599517138 | |||
| 1578 | 2599804874 | |||
| 1579 | 2599878821 | |||
| 1580 | 2599892481 | |||
| 1581 | 2599951033 | |||
| 1582 | 2599975156 | |||
| 1583 | 2601693654 | |||
| 1584 | 2621297052 | |||
| 1585 | 2624483195 | |||
| 1586 | 2624494720 | |||
| 1587 | 2643842759 | |||
| 1588 | 2643872049 | |||
| 1589 | 2643955845 | |||
| 1590 | 2644020639 | |||
| 1591 | 2644186155 | |||
| 1592 | 2644398185 | |||
| 1593 | 2671771881 | |||
| 1594 | 2677896914 | |||
| 1595 | 2715750036 | |||
| 1596 | 2718636398 | |||
| 1597 | 2723251151 | |||
| 1598 | 2738671873 | |||
| 1599 | 2738690246 | |||
| 1600 | 2738750267 | |||
| 1601 | 2738807038 | |||
| 1602 | 2738859307 | |||
| 1603 | 2738894398 | |||
| 1604 | 2739198846 | |||
| 1605 | 2739261575 | |||
| 1606 | 2739266020 | |||
| 1607 | 2739289708 | |||
| 1608 | 2739295020 | |||
| 1609 | 2739312727 | |||
| 1610 | 2743740221 | |||
| 1611 | 2765586420 | |||
| 1612 | 2774118597 | |||
| 1613 | 2774129606 | |||
| 1614 | 2774135784 | |||
| 1615 | 2784262037 | |||
| 1616 | 2784313270 | |||
| 1617 | 2807410665 | |||
| 1618 | 2807459006 | |||
| 1619 | 2808906349 | |||
| 1620 | 2808928664 | |||
| 1621 | 2808950153 | |||
| 1622 | 2808975928 | |||
| 1623 | 2808993037 | |||
| 1624 | 2812369281 | |||
| 1625 | 2817493834 | |||
| 1626 | 2819654917 | |||
| 1627 | 2823421792 | |||
| 1628 | 2826582010 | |||
| 1629 | 2834030741 | |||
| 1630 | 2842819367 | |||
| 1631 | 2842829224 | |||
| 1632 | 2842833256 | |||
| 1633 | 2842842073 | |||
| 1634 | 2842845484 | |||
| 1635 | 2842852345 | |||
| 1636 | 2852616139 | |||
| 1637 | 2852662464 | |||
| 1638 | 2852671107 | |||
| 1639 | 2860341501 | |||
| 1640 | 2880235780 | |||
| 1641 | 2904453576 | |||
| 1642 | 2904459093 | |||
| 1643 | 2904519169 | |||
| 1644 | 2904552198 | |||
| 1645 | 2908452355 | |||
| 1646 | 2912968699 | |||
| 1647 | 2917834574 | |||
| 1648 | 2919065740 | |||
| 1649 | 2919127218 | |||
| 1650 | 2919155733 | |||
| 1651 | 2919389405 | |||
| 1652 | 2919457336 | |||
| 1653 | 2919488370 | |||
| 1654 | 2919505669 | |||
| 1655 | 2919700784 | |||
| 1656 | 2923159313 | |||
| 1657 | 2923523366 | |||
| 1658 | 2926068053 | |||
| 1659 | 2929194933 | |||
| 1660 | 2929522408 | |||
| 1661 | 2931396204 | |||
| 1662 | 2931397854 | |||
| 1663 | 2939642082 | |||
| 1664 | 2939654039 | |||
| 1665 | 2945931128 | |||
| 1666 | 2945966625 | |||
| 1667 | 2946007153 | |||
| 1668 | 2946027692 | |||
| 1669 | 2947234205 | |||
| 1670 | 2969309960 | |||
| 1671 | 2974294291 | |||
| 1672 | 2974301993 | |||
| 1673 | 2984500439 | |||
| 1674 | 2984506952 | |||
| 1675 | 2990199557 | |||
| 1676 | 2998145186 | |||
| 1677 | 3007254680 | |||
| 1678 | 3007316542 | |||
| 1679 | 3007616544 | |||
| 1680 | 3007719297 | |||
| 1681 | 3007805369 | |||
| 1682 | 3007858103 | |||
| 1683 | 3007865315 | |||
| 1684 | 3007872404 | |||
| 1685 | 8011352503 | |||
| 1686 | 8015693402 | |||
| 1687 | 8019777892 | |||
| 1688 | 8029995710 | |||
| 1689 | 8034966408 | |||
| 1690 | 8052499634 | |||
| 1691 | 8054291592 | |||
| 1692 | 8054349792 | |||
| 1693 | 8054508705 | |||
| 1694 | 8054934191 | |||
| 1695 | 8055776653 | |||
| 1696 | 8055823679 | |||
| 1697 | 8056115957 | |||
| 1698 | 8056121089 | |||
| 1699 | 8056131396 | |||
| 1700 | 8056137106 | |||
| 1701 | 8056137806 | |||
| 1702 | 8056151716 | |||
| 1703 | 8056160631 | |||
| 1704 | 8056163405 | |||
| 1705 | 8056171382 | |||
| 1706 | 8056177626 | |||
| 1707 | 8056181792 | |||
| 1708 | 8056570253 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bqt-assembly1.cif.gz_B | complex of 14-3-3 theta with an irsp53 peptide doubly-phosphorylated at t340 and t360 | 0.7467 | 21 | 69 |
| 6qk8-assembly2.cif.gz_B | crystal structure of yeast 14-3-3 protein (bmh1) from saccharomyces cerevisiae with the nha1p (yeast na+/h+ antiporter) 14-3-3 binding motif ser481 | 0.7205 | 28 | 67 |
| 6r7z-assembly1.cif.gz_B | cryoem structure of calcium-free human tmem16k / anoctamin 10 in detergent (closed form) | 0.6135 | 2 | 64 |
| 5kym-assembly1.cif.gz_A | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.6058 | 1 | 279 |
| 5kym-assembly2.cif.gz_B | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.6003 | 2 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pu8A02 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8584 | 28 | 65 | 3.90.1200.10 |
| af_P32129_82_238_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8484 | 69 | 222 | 3.40.50.620 |
| af_P32129_82_238_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8289 | 69 | 222 | 3.40.50.620 |
| af_Q9NRZ5_70_233_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7348 | 82 | 222 | 3.40.50.620 |
| af_Q22267_77_205_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7295 | 74 | 210 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P9SIR0-F1-model_v4 | Acyltransferase | 0.9786 | 181 | 293 |
GO:0016746
|
| AF-A0A0P9CUI6-F1-model_v4 | Acyltransferase | 0.9763 | 168 | 293 |
GO:0016746
|
| AF-A0A656H741-F1-model_v4 | deleted | 0.9731 | 52 | 284 |
|
| AF-A0A136Q9J9-F1-model_v4 | deleted | 0.9698 | 97 | 295 |
|
| AF-A0A433FBK4-F1-model_v4 | deleted | 0.9652 | 168 | 294 |
|