F483595
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 854 | 254 | 1708 | 93 |
Family's Representative Sequence
| Representative Sequence | 3300047443|Ga0495687_000411|Ga0495687_000411_26888_27217 |
| Length | 109 |
| Sequence | MSLDTNMPPQTDARVERIRSLLQAALAPSQLEVGDDSHLHVGHAGAASGGGHYSVKIVAERFEGLRLVMRHRLVYDAVQGMMHTDIHALAITALAPSEVATAHPSGSLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 25 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 40 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 41 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 70 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 71 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 72 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 73 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 74 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 75 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 76 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 77 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 78 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 79 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 80 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 81 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 82 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 83 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 84 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 85 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 86 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 87 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 88 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 89 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 90 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 91 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 92 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 93 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 94 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 95 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 96 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 97 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 98 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 99 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 100 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 101 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 102 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 103 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 104 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 105 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 106 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 107 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 192 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 193 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 194 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 195 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 196 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 205 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 206 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 207 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 208 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 209 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 210 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 211 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 216 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 222 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 223 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 224 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 225 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 227 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 228 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 231 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 232 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.25 |
| Metatranscriptomes | 3.75 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.82 |
| Nodule | 0 |
| Rhizoplane | 5.39 |
| Rhizosphere | 91.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495687_000411 | 3300047443 | Bacteria | 53055 |
| 2 | rootH2_10189217 | 3300003320 | Bacteria | 1591 |
| 3 | rootL2_10011198 | 3300003322 | Bacteria | 1142 |
| 4 | Ga0007410J51695_1017414 | 3300003574 | Bacteria | 2296 |
| 5 | Ga0055525_1000008 | 3300003759 | Bacteria | 604287 |
| 6 | Ga0055542_1007860 | 3300003762 | Bacteria | 2126 |
| 7 | Ga0065165_1002057 | 3300005262 | Bacteria | 18601 |
| 8 | Ga0065165_1021713 | 3300005262 | Bacteria | 2222 |
| 9 | Ga0065714_10132036 | 3300005288 | Bacteria | 1223 |
| 10 | Ga0070658_10091401 | 3300005327 | Bacteria | 2508 |
| 11 | Ga0070658_10173858 | 3300005327 | Bacteria | 1810 |
| 12 | Ga0070658_10959788 | 3300005327 | Bacteria | 743 |
| 13 | Ga0070658_11081712 | 3300005327 | Bacteria | 697 |
| 14 | Ga0070670_101336589 | 3300005331 | Bacteria | 656 |
| 15 | Ga0070682_100568529 | 3300005337 | Bacteria | 890 |
| 16 | Ga0070660_100265035 | 3300005339 | Bacteria | 1403 |
| 17 | Ga0070660_101290600 | 3300005339 | Bacteria | 619 |
| 18 | Ga0070660_101572380 | 3300005339 | Bacteria | 559 |
| 19 | Ga0070661_100103074 | 3300005344 | Bacteria | 2125 |
| 20 | Ga0070659_100343872 | 3300005366 | Bacteria | 1250 |
| 21 | Ga0070667_100774409 | 3300005367 | Bacteria | 890 |
| 22 | Ga0070663_100593245 | 3300005455 | Bacteria | 931 |
| 23 | Ga0070662_100130144 | 3300005457 | Bacteria | 1939 |
| 24 | Ga0070662_100627296 | 3300005457 | Bacteria | 905 |
| 25 | Ga0068867_100791149 | 3300005459 | Bacteria | 845 |
| 26 | Ga0068853_100228345 | 3300005539 | Bacteria | 1702 |
| 27 | Ga0070672_100128483 | 3300005543 | Bacteria | 2081 |
| 28 | Ga0068855_100071413 | 3300005563 | Bacteria | 4037 |
| 29 | Ga0068855_100556760 | 3300005563 | Bacteria | 1241 |
| 30 | Ga0070664_100916519 | 3300005564 | Bacteria | 822 |
| 31 | Ga0070664_101155930 | 3300005564 | Bacteria | 730 |
| 32 | Ga0068852_100046601 | 3300005616 | Bacteria | 3694 |
| 33 | Ga0068866_10224569 | 3300005718 | Bacteria | 1135 |
| 34 | Ga0105244_10376530 | 3300009036 | Bacteria | 654 |
| 35 | Ga0105245_10192652 | 3300009098 | Bacteria | 1953 |
| 36 | Ga0105243_10050716 | 3300009148 | Bacteria | 3280 |
| 37 | Ga0105241_10057928 | 3300009174 | Bacteria | 2974 |
| 38 | Ga0105242_10009383 | 3300009176 | Bacteria | 7508 |
| 39 | Ga0105237_10052079 | 3300009545 | Bacteria | 4110 |
| 40 | Ga0105238_10525231 | 3300009551 | Bacteria | 1186 |
| 41 | Ga0105239_10399324 | 3300010375 | Bacteria | 1556 |
| 42 | Ga0105239_12887261 | 3300010375 | Bacteria | 561 |
| 43 | Ga0105246_10919948 | 3300011119 | Bacteria | 786 |
| 44 | Ga0157371_10000149 | 3300013102 | Bacteria | 101593 |
| 45 | Ga0157370_10464208 | 3300013104 | Bacteria | 1164 |
| 46 | Ga0157369_11008966 | 3300013105 | Bacteria | 852 |
| 47 | Ga0157369_11210192 | 3300013105 | Bacteria | 771 |
| 48 | Ga0157374_10475745 | 3300013296 | Bacteria | 1252 |
| 49 | Ga0157374_12019076 | 3300013296 | Bacteria | 603 |
| 50 | Ga0157372_10135257 | 3300013307 | Bacteria | 2838 |
| 51 | Ga0157372_11023564 | 3300013307 | Bacteria | 956 |
| 52 | Ga0157372_11069717 | 3300013307 | Bacteria | 934 |
| 53 | Ga0157372_11831313 | 3300013307 | Bacteria | 698 |
| 54 | Ga0182006_1073772 | 3300015261 | Bacteria | 1259 |
| 55 | Ga0182007_10068111 | 3300015262 | Bacteria | 1166 |
| 56 | Ga0182007_10206179 | 3300015262 | Bacteria | 689 |
| 57 | Ga0163161_10759428 | 3300017792 | Bacteria | 812 |
| 58 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 59 | Ga0209677_106012 | 3300025253 | Bacteria | 2997 |
| 60 | Ga0209148_1000403 | 3300025254 | Bacteria | 50194 |
| 61 | Ga0207642_10989157 | 3300025899 | Bacteria | 541 |
| 62 | Ga0207705_10005671 | 3300025909 | Bacteria | 9320 |
| 63 | Ga0207705_10079021 | 3300025909 | Bacteria | 2395 |
| 64 | Ga0207654_10116350 | 3300025911 | Bacteria | 1671 |
| 65 | Ga0207671_10164551 | 3300025914 | Bacteria | 1719 |
| 66 | Ga0207657_10028684 | 3300025919 | Bacteria | 5072 |
| 67 | Ga0207657_10187015 | 3300025919 | Bacteria | 1672 |
| 68 | Ga0207657_10331810 | 3300025919 | Bacteria | 1201 |
| 69 | Ga0207649_10077342 | 3300025920 | Bacteria | 2144 |
| 70 | Ga0207649_10289115 | 3300025920 | Bacteria | 1195 |
| 71 | Ga0207694_10223810 | 3300025924 | Bacteria | 1535 |
| 72 | Ga0207687_10412997 | 3300025927 | Bacteria | 1112 |
| 73 | Ga0207690_10109813 | 3300025932 | Bacteria | 1984 |
| 74 | Ga0207690_10595403 | 3300025932 | Bacteria | 902 |
| 75 | Ga0207690_11564661 | 3300025932 | Bacteria | 551 |
| 76 | Ga0207706_10113901 | 3300025933 | Bacteria | 2379 |
| 77 | Ga0207706_10121471 | 3300025933 | Bacteria | 2297 |
| 78 | Ga0207686_10057523 | 3300025934 | Bacteria | 2448 |
| 79 | Ga0207709_10080665 | 3300025935 | Bacteria | 2096 |
| 80 | Ga0207704_10203948 | 3300025938 | Bacteria | 1450 |
| 81 | Ga0207661_10819702 | 3300025944 | Bacteria | 857 |
| 82 | Ga0207679_10074584 | 3300025945 | Bacteria | 2571 |
| 83 | Ga0207679_10305288 | 3300025945 | Bacteria | 1373 |
| 84 | Ga0207667_10012297 | 3300025949 | Bacteria | 9875 |
| 85 | Ga0207667_11853012 | 3300025949 | Bacteria | 566 |
| 86 | Ga0207640_12096901 | 3300025981 | Bacteria | 513 |
| 87 | Ga0207658_10610504 | 3300025986 | Bacteria | 981 |
| 88 | Ga0207639_10741030 | 3300026041 | Bacteria | 913 |
| 89 | Ga0207678_10058990 | 3300026067 | Bacteria | 3302 |
| 90 | Ga0207702_10299780 | 3300026078 | Bacteria | 1525 |
| 91 | Ga0207648_10124022 | 3300026089 | Bacteria | 2272 |
| 92 | Ga0207674_11593918 | 3300026116 | Bacteria | 621 |
| 93 | Ga0207698_10395425 | 3300026142 | Bacteria | 1319 |
| 94 | Ga0316177_1087656 | 3300030731 | Bacteria | 1685 |
| 95 | Ga0316180_1076152 | 3300030736 | Bacteria | 2265 |
| 96 | Ga0316182_1045793 | 3300030745 | Bacteria | 1924 |
| 97 | Ga0316182_1068880 | 3300030745 | Bacteria | 552 |
| 98 | Ga0316182_1395676 | 3300030745 | Bacteria | 1685 |
| 99 | Ga0307408_100749939 | 3300031548 | Bacteria | 882 |
| 100 | Ga0307414_10038809 | 3300032004 | Bacteria | 3201 |
| 101 | Ga0373934_0031476 | 3300035086 | Bacteria | 2077 |
| 102 | Ga0395899_0000012 | 3300037312 | Bacteria | 517561 |
| 103 | Ga0395899_0044141 | 3300037312 | Bacteria | 3322 |
| 104 | Ga0395899_0071787 | 3300037312 | Bacteria | 2533 |
| 105 | Ga0395899_0236117 | 3300037312 | Bacteria | 1260 |
| 106 | Ga0395899_0248109 | 3300037312 | Bacteria | 1222 |
| 107 | Ga0395899_0471143 | 3300037312 | Bacteria | 819 |
| 108 | Ga0395900_0000028 | 3300037418 | Bacteria | 285042 |
| 109 | Ga0395900_0177724 | 3300037418 | Bacteria | 2164 |
| 110 | Ga0395900_0192545 | 3300037418 | Bacteria | 2067 |
| 111 | Ga0395900_0206530 | 3300037418 | Bacteria | 1985 |
| 112 | Ga0395900_0249315 | 3300037418 | Bacteria | 1777 |
| 113 | Ga0395900_0315765 | 3300037418 | Bacteria | 1544 |
| 114 | Ga0395900_0392115 | 3300037418 | Bacteria | 1354 |
| 115 | Ga0395900_0526281 | 3300037418 | Bacteria | 1129 |
| 116 | Ga0395900_0745766 | 3300037418 | Bacteria | 910 |
| 117 | Ga0395900_0995271 | 3300037418 | Bacteria | 758 |
| 118 | Ga0395898_0037410 | 3300037466 | Bacteria | 4814 |
| 119 | Ga0395898_0052983 | 3300037466 | Bacteria | 3963 |
| 120 | Ga0395898_0150061 | 3300037466 | Bacteria | 2230 |
| 121 | Ga0395898_0620310 | 3300037466 | Bacteria | 1024 |
| 122 | Ga0395898_1437851 | 3300037466 | Bacteria | 616 |
| 123 | Ga0395898_1554679 | 3300037466 | Bacteria | 586 |
| 124 | Ga0395905_0063674 | 3300037471 | Bacteria | 3450 |
| 125 | Ga0395905_0144826 | 3300037471 | Bacteria | 2235 |
| 126 | Ga0395905_0277986 | 3300037471 | Bacteria | 1560 |
| 127 | Ga0395905_0341564 | 3300037471 | Bacteria | 1388 |
| 128 | Ga0395905_1018153 | 3300037471 | Bacteria | 731 |
| 129 | Ga0395905_1041359 | 3300037471 | Bacteria | 721 |
| 130 | Ga0395905_1163544 | 3300037471 | Bacteria | 675 |
| 131 | Ga0395905_1380814 | 3300037471 | Bacteria | 608 |
| 132 | Ga0395901_0000191 | 3300038443 | Bacteria | 78454 |
| 133 | Ga0395901_0022134 | 3300038443 | Bacteria | 6512 |
| 134 | Ga0395901_0219529 | 3300038443 | Bacteria | 1987 |
| 135 | Ga0395901_0259851 | 3300038443 | Bacteria | 1807 |
| 136 | Ga0395901_0714387 | 3300038443 | Bacteria | 998 |
| 137 | Ga0395901_0788608 | 3300038443 | Bacteria | 940 |
| 138 | Ga0395901_1755899 | 3300038443 | Bacteria | 570 |
| 139 | Ga0439465_0093817 | 3300041413 | Bacteria | 1030 |
| 140 | Ga0439433_0034034 | 3300041999 | Bacteria | 1172 |
| 141 | Ga0439448_0000186 | 3300042005 | Bacteria | 12766 |
| 142 | Ga0439448_0019632 | 3300042005 | Bacteria | 2083 |
| 143 | Ga0439448_0184581 | 3300042005 | Bacteria | 729 |
| 144 | Ga0439449_0054322 | 3300042007 | Bacteria | 1480 |
| 145 | Ga0439449_0141226 | 3300042007 | Bacteria | 896 |
| 146 | Ga0439450_004176 | 3300042008 | Bacteria | 2449 |
| 147 | Ga0439450_004316 | 3300042008 | Bacteria | 2419 |
| 148 | Ga0439450_011518 | 3300042008 | Bacteria | 1734 |
| 149 | Ga0439455_0001253 | 3300042012 | Bacteria | 4163 |
| 150 | Ga0439455_0012610 | 3300042012 | Bacteria | 1902 |
| 151 | Ga0450904_002779 | 3300042139 | Bacteria | 1999 |
| 152 | Ga0439458_0015566 | 3300042157 | Bacteria | 1724 |
| 153 | Ga0439458_0060439 | 3300042157 | Bacteria | 945 |
| 154 | Ga0439458_0074181 | 3300042157 | Bacteria | 862 |
| 155 | Ga0439464_0198643 | 3300042439 | Bacteria | 639 |
| 156 | Ga0451577_0038734 | 3300042876 | Bacteria | 4286 |
| 157 | Ga0466969_0060006 | 3300044656 | Bacteria | 1849 |
| 158 | Ga0466969_0169923 | 3300044656 | Bacteria | 1000 |
| 159 | Ga0466969_0281839 | 3300044656 | Bacteria | 752 |
| 160 | Ga0466972_0009118 | 3300044658 | Bacteria | 4982 |
| 161 | Ga0466972_0100353 | 3300044658 | Bacteria | 1370 |
| 162 | Ga0466972_0283026 | 3300044658 | Bacteria | 775 |
| 163 | Ga0466965_0001489 | 3300044683 | Bacteria | 9480 |
| 164 | Ga0466965_0037013 | 3300044683 | Bacteria | 2395 |
| 165 | Ga0466965_0038557 | 3300044683 | Bacteria | 2347 |
| 166 | Ga0466965_0134162 | 3300044683 | Bacteria | 1285 |
| 167 | Ga0466965_0158341 | 3300044683 | Bacteria | 1186 |
| 168 | Ga0466966_0021307 | 3300044684 | Bacteria | 4256 |
| 169 | Ga0466966_0087627 | 3300044684 | Bacteria | 1934 |
| 170 | Ga0466966_0236949 | 3300044684 | Bacteria | 1100 |
| 171 | Ga0466961_0095437 | 3300044693 | Bacteria | 1875 |
| 172 | Ga0466961_0228824 | 3300044693 | Bacteria | 1144 |
| 173 | Ga0466963_0531514 | 3300044694 | Bacteria | 830 |
| 174 | Ga0466963_0828084 | 3300044694 | Bacteria | 653 |
| 175 | Ga0466964_0000184 | 3300044706 | Bacteria | 17322 |
| 176 | Ga0466964_0002194 | 3300044706 | Bacteria | 6906 |
| 177 | Ga0466964_0111350 | 3300044706 | Bacteria | 1221 |
| 178 | Ga0466964_0565148 | 3300044706 | Bacteria | 619 |
| 179 | Ga0453684_0128088 | 3300044712 | Bacteria | 3051 |
| 180 | Ga0466971_0125281 | 3300044719 | Bacteria | 1190 |
| 181 | Ga0466971_0218704 | 3300044719 | Bacteria | 902 |
| 182 | Ga0466971_0236287 | 3300044719 | Bacteria | 868 |
| 183 | Ga0466968_0004442 | 3300044735 | Bacteria | 5247 |
| 184 | Ga0466968_0635161 | 3300044735 | Bacteria | 541 |
| 185 | Ga0466970_0127095 | 3300044765 | Bacteria | 1398 |
| 186 | Ga0466970_0580313 | 3300044765 | Bacteria | 649 |
| 187 | Ga0466957_0000008 | 3300044842 | Bacteria | 80479 |
| 188 | Ga0466957_0044716 | 3300044842 | Bacteria | 2684 |
| 189 | Ga0466957_0299367 | 3300044842 | Bacteria | 1080 |
| 190 | Ga0466957_0565656 | 3300044842 | Bacteria | 793 |
| 191 | Ga0466957_0668751 | 3300044842 | Bacteria | 731 |
| 192 | Ga0466957_1210777 | 3300044842 | Bacteria | 546 |
| 193 | Ga0466960_0537418 | 3300044901 | Bacteria | 688 |
| 194 | Ga0466959_0069731 | 3300045049 | Bacteria | 2546 |
| 195 | Ga0466959_0210965 | 3300045049 | Bacteria | 1349 |
| 196 | Ga0466959_0258773 | 3300045049 | Bacteria | 1198 |
| 197 | Ga0466959_0311289 | 3300045049 | Bacteria | 1077 |
| 198 | Ga0466959_0332376 | 3300045049 | Bacteria | 1037 |
| 199 | Ga0451576_0239777 | 3300045051 | Bacteria | 1894 |
| 200 | Ga0451576_0660295 | 3300045051 | Bacteria | 1099 |
| 201 | Ga0466958_0007091 | 3300045836 | Bacteria | 6137 |
| 202 | Ga0466958_0183129 | 3300045836 | Bacteria | 1329 |
| 203 | Ga0466958_0287642 | 3300045836 | Bacteria | 1054 |
| 204 | Ga0466958_0331948 | 3300045836 | Bacteria | 978 |
| 205 | Ga0466958_0369253 | 3300045836 | Bacteria | 924 |
| 206 | Ga0466967_0022249 | 3300045976 | Bacteria | 5168 |
| 207 | Ga0466967_0139320 | 3300045976 | Bacteria | 2258 |
| 208 | Ga0466967_0444013 | 3300045976 | Bacteria | 1267 |
| 209 | Ga0495617_000001 | 3300046452 | Bacteria | 877032 |
| 210 | Ga0495617_008419 | 3300046452 | Bacteria | 3554 |
| 211 | Ga0495627_000035 | 3300046453 | Bacteria | 213698 |
| 212 | Ga0495627_025272 | 3300046453 | Bacteria | 1927 |
| 213 | Ga0495627_076288 | 3300046453 | Bacteria | 975 |
| 214 | Ga0495603_0016847 | 3300046455 | Bacteria | 4422 |
| 215 | Ga0495603_0039719 | 3300046455 | Bacteria | 2818 |
| 216 | Ga0495603_0253304 | 3300046455 | Bacteria | 1013 |
| 217 | Ga0495590_0000029 | 3300046457 | Bacteria | 146662 |
| 218 | Ga0495590_0000794 | 3300046457 | Bacteria | 14382 |
| 219 | Ga0495590_0000886 | 3300046457 | Bacteria | 13425 |
| 220 | Ga0495590_0003598 | 3300046457 | Bacteria | 6306 |
| 221 | Ga0495590_0119052 | 3300046457 | Bacteria | 946 |
| 222 | Ga0495590_0173022 | 3300046457 | Bacteria | 787 |
| 223 | Ga0495590_0223533 | 3300046457 | Bacteria | 696 |
| 224 | Ga0495591_000359 | 3300046458 | Bacteria | 39622 |
| 225 | Ga0495591_099776 | 3300046458 | Bacteria | 721 |
| 226 | Ga0495629_0011614 | 3300046459 | Bacteria | 6394 |
| 227 | Ga0495629_0138582 | 3300046459 | Bacteria | 1693 |
| 228 | Ga0495629_0175154 | 3300046459 | Bacteria | 1488 |
| 229 | Ga0495629_0188599 | 3300046459 | Bacteria | 1427 |
| 230 | Ga0495638_0005949 | 3300046460 | Bacteria | 8954 |
| 231 | Ga0495638_0023751 | 3300046460 | Bacteria | 4005 |
| 232 | Ga0495638_0026384 | 3300046460 | Bacteria | 3764 |
| 233 | Ga0495638_0047389 | 3300046460 | Bacteria | 2694 |
| 234 | Ga0495638_0221213 | 3300046460 | Bacteria | 1058 |
| 235 | Ga0495653_0182734 | 3300046463 | Bacteria | 1437 |
| 236 | Ga0495650_0013452 | 3300046471 | Bacteria | 4324 |
| 237 | Ga0495650_0057271 | 3300046471 | Bacteria | 1578 |
| 238 | Ga0495580_0026281 | 3300046472 | Bacteria | 4245 |
| 239 | Ga0495580_0727967 | 3300046472 | Bacteria | 647 |
| 240 | Ga0495582_0008008 | 3300046473 | Bacteria | 5833 |
| 241 | Ga0495582_0050892 | 3300046473 | Bacteria | 2283 |
| 242 | Ga0495605_0000138 | 3300046474 | Bacteria | 94241 |
| 243 | Ga0495605_0000304 | 3300046474 | Bacteria | 52709 |
| 244 | Ga0495605_0013483 | 3300046474 | Bacteria | 4500 |
| 245 | Ga0495605_0018512 | 3300046474 | Bacteria | 3732 |
| 246 | Ga0495605_0022570 | 3300046474 | Bacteria | 3321 |
| 247 | Ga0495605_0031571 | 3300046474 | Bacteria | 2705 |
| 248 | Ga0495605_0032507 | 3300046474 | Bacteria | 2656 |
| 249 | Ga0495605_0041338 | 3300046474 | Bacteria | 2296 |
| 250 | Ga0495605_0072236 | 3300046474 | Bacteria | 1627 |
| 251 | Ga0495605_0175226 | 3300046474 | Bacteria | 946 |
| 252 | Ga0495605_0197745 | 3300046474 | Bacteria | 877 |
| 253 | Ga0495605_0223409 | 3300046474 | Bacteria | 813 |
| 254 | Ga0495605_0429156 | 3300046474 | Bacteria | 546 |
| 255 | Ga0495639_0184090 | 3300046475 | Bacteria | 1018 |
| 256 | Ga0495584_0000637 | 3300046491 | Bacteria | 23364 |
| 257 | Ga0495584_0001166 | 3300046491 | Bacteria | 16163 |
| 258 | Ga0495584_0001464 | 3300046491 | Bacteria | 14181 |
| 259 | Ga0495584_0005183 | 3300046491 | Bacteria | 6920 |
| 260 | Ga0495584_0010783 | 3300046491 | Bacteria | 4692 |
| 261 | Ga0495584_0011336 | 3300046491 | Bacteria | 4565 |
| 262 | Ga0495584_0014262 | 3300046491 | Bacteria | 4048 |
| 263 | Ga0495584_0021529 | 3300046491 | Bacteria | 3274 |
| 264 | Ga0495584_0068816 | 3300046491 | Bacteria | 1778 |
| 265 | Ga0495584_0097820 | 3300046491 | Bacteria | 1482 |
| 266 | Ga0495584_0112579 | 3300046491 | Bacteria | 1377 |
| 267 | Ga0495584_0154619 | 3300046491 | Bacteria | 1165 |
| 268 | Ga0495584_0155384 | 3300046491 | Bacteria | 1162 |
| 269 | Ga0495584_0186036 | 3300046491 | Bacteria | 1055 |
| 270 | Ga0495584_0214559 | 3300046491 | Bacteria | 978 |
| 271 | Ga0495584_0303552 | 3300046491 | Bacteria | 811 |
| 272 | Ga0495585_0001218 | 3300046492 | Bacteria | 20845 |
| 273 | Ga0495585_0001766 | 3300046492 | Bacteria | 16412 |
| 274 | Ga0495585_0003751 | 3300046492 | Bacteria | 10141 |
| 275 | Ga0495585_0005220 | 3300046492 | Bacteria | 8233 |
| 276 | Ga0495585_0014341 | 3300046492 | Bacteria | 4619 |
| 277 | Ga0495585_0015018 | 3300046492 | Bacteria | 4502 |
| 278 | Ga0495585_0035228 | 3300046492 | Bacteria | 2830 |
| 279 | Ga0495585_0059062 | 3300046492 | Bacteria | 2114 |
| 280 | Ga0495585_0070727 | 3300046492 | Bacteria | 1903 |
| 281 | Ga0495585_0142506 | 3300046492 | Bacteria | 1254 |
| 282 | Ga0495585_0193290 | 3300046492 | Bacteria | 1040 |
| 283 | Ga0495594_0023243 | 3300046499 | Bacteria | 3320 |
| 284 | Ga0495594_0023269 | 3300046499 | Bacteria | 3318 |
| 285 | Ga0495594_0027973 | 3300046499 | Bacteria | 3040 |
| 286 | Ga0495594_0045645 | 3300046499 | Bacteria | 2405 |
| 287 | Ga0495594_0051030 | 3300046499 | Bacteria | 2276 |
| 288 | Ga0495594_0064737 | 3300046499 | Bacteria | 2027 |
| 289 | Ga0495594_0068935 | 3300046499 | Bacteria | 1964 |
| 290 | Ga0495594_0086923 | 3300046499 | Bacteria | 1749 |
| 291 | Ga0495594_0230591 | 3300046499 | Bacteria | 1055 |
| 292 | Ga0495596_0001476 | 3300046500 | Bacteria | 13448 |
| 293 | Ga0495596_0003276 | 3300046500 | Bacteria | 8269 |
| 294 | Ga0495596_0005692 | 3300046500 | Bacteria | 5850 |
| 295 | Ga0495596_0005906 | 3300046500 | Bacteria | 5712 |
| 296 | Ga0495596_0013804 | 3300046500 | Bacteria | 3416 |
| 297 | Ga0495596_0015723 | 3300046500 | Bacteria | 3160 |
| 298 | Ga0495596_0018289 | 3300046500 | Bacteria | 2889 |
| 299 | Ga0495596_0021565 | 3300046500 | Bacteria | 2628 |
| 300 | Ga0495596_0031264 | 3300046500 | Bacteria | 2127 |
| 301 | Ga0495596_0089397 | 3300046500 | Bacteria | 1195 |
| 302 | Ga0495596_0210226 | 3300046500 | Bacteria | 755 |
| 303 | Ga0495607_0002300 | 3300046501 | Bacteria | 15698 |
| 304 | Ga0495607_0007345 | 3300046501 | Bacteria | 7634 |
| 305 | Ga0495607_0007423 | 3300046501 | Bacteria | 7588 |
| 306 | Ga0495607_0012432 | 3300046501 | Bacteria | 5618 |
| 307 | Ga0495607_0029774 | 3300046501 | Bacteria | 3358 |
| 308 | Ga0495607_0096180 | 3300046501 | Bacteria | 1595 |
| 309 | Ga0495607_0107124 | 3300046501 | Bacteria | 1487 |
| 310 | Ga0495607_0192027 | 3300046501 | Bacteria | 1016 |
| 311 | Ga0495607_0222739 | 3300046501 | Bacteria | 921 |
| 312 | Ga0495607_0266160 | 3300046501 | Bacteria | 819 |
| 313 | Ga0495607_0273898 | 3300046501 | Bacteria | 803 |
| 314 | Ga0495607_0461671 | 3300046501 | Bacteria | 568 |
| 315 | Ga0495583_0000274 | 3300046506 | Bacteria | 83322 |
| 316 | Ga0495583_0000438 | 3300046506 | Bacteria | 62697 |
| 317 | Ga0495583_0000647 | 3300046506 | Bacteria | 45977 |
| 318 | Ga0495583_0000712 | 3300046506 | Bacteria | 42668 |
| 319 | Ga0495583_0002574 | 3300046506 | Bacteria | 15237 |
| 320 | Ga0495583_0003058 | 3300046506 | Bacteria | 13285 |
| 321 | Ga0495583_0013015 | 3300046506 | Bacteria | 4670 |
| 322 | Ga0495583_0016746 | 3300046506 | Bacteria | 3925 |
| 323 | Ga0495583_0024876 | 3300046506 | Bacteria | 3000 |
| 324 | Ga0495583_0035838 | 3300046506 | Bacteria | 2364 |
| 325 | Ga0495583_0053760 | 3300046506 | Bacteria | 1826 |
| 326 | Ga0495583_0077301 | 3300046506 | Bacteria | 1452 |
| 327 | Ga0495583_0174621 | 3300046506 | Bacteria | 881 |
| 328 | Ga0495583_0178386 | 3300046506 | Bacteria | 870 |
| 329 | Ga0495606_0018070 | 3300046507 | Bacteria | 5302 |
| 330 | Ga0495606_0018807 | 3300046507 | Bacteria | 5168 |
| 331 | Ga0495606_0046052 | 3300046507 | Bacteria | 2885 |
| 332 | Ga0495606_0070020 | 3300046507 | Bacteria | 2214 |
| 333 | Ga0495606_0100279 | 3300046507 | Bacteria | 1764 |
| 334 | Ga0495606_0174451 | 3300046507 | Bacteria | 1244 |
| 335 | Ga0495606_0246401 | 3300046507 | Bacteria | 993 |
| 336 | Ga0495610_0001514 | 3300046512 | Bacteria | 20445 |
| 337 | Ga0495610_0388553 | 3300046512 | Bacteria | 517 |
| 338 | Ga0495616_0000037 | 3300046513 | Bacteria | 123624 |
| 339 | Ga0495616_0000494 | 3300046513 | Bacteria | 30040 |
| 340 | Ga0495616_0000550 | 3300046513 | Bacteria | 28322 |
| 341 | Ga0495616_0004947 | 3300046513 | Bacteria | 8321 |
| 342 | Ga0495616_0020073 | 3300046513 | Bacteria | 3640 |
| 343 | Ga0495616_0024924 | 3300046513 | Bacteria | 3202 |
| 344 | Ga0495616_0029300 | 3300046513 | Bacteria | 2908 |
| 345 | Ga0495616_0033927 | 3300046513 | Bacteria | 2654 |
| 346 | Ga0495616_0048252 | 3300046513 | Bacteria | 2140 |
| 347 | Ga0495616_0056202 | 3300046513 | Bacteria | 1944 |
| 348 | Ga0495616_0069724 | 3300046513 | Bacteria | 1703 |
| 349 | Ga0495616_0073397 | 3300046513 | Bacteria | 1651 |
| 350 | Ga0495616_0093742 | 3300046513 | Bacteria | 1418 |
| 351 | Ga0495616_0180203 | 3300046513 | Bacteria | 939 |
| 352 | Ga0495620_0040971 | 3300046515 | Bacteria | 2034 |
| 353 | Ga0495630_0102234 | 3300046517 | Bacteria | 2168 |
| 354 | Ga0495631_0000220 | 3300046518 | Bacteria | 39150 |
| 355 | Ga0495631_0003343 | 3300046518 | Bacteria | 8800 |
| 356 | Ga0495631_0003934 | 3300046518 | Bacteria | 8026 |
| 357 | Ga0495631_0010003 | 3300046518 | Bacteria | 4713 |
| 358 | Ga0495631_0010449 | 3300046518 | Bacteria | 4590 |
| 359 | Ga0495631_0073698 | 3300046518 | Bacteria | 1474 |
| 360 | Ga0495631_0080393 | 3300046518 | Bacteria | 1406 |
| 361 | Ga0495631_0117366 | 3300046518 | Bacteria | 1144 |
| 362 | Ga0495631_0155978 | 3300046518 | Bacteria | 979 |
| 363 | Ga0495631_0157434 | 3300046518 | Bacteria | 974 |
| 364 | Ga0495631_0165201 | 3300046518 | Bacteria | 950 |
| 365 | Ga0495631_0309068 | 3300046518 | Bacteria | 672 |
| 366 | Ga0495631_0446703 | 3300046518 | Bacteria | 550 |
| 367 | Ga0495632_0000126 | 3300046519 | Bacteria | 77591 |
| 368 | Ga0495632_0000133 | 3300046519 | Bacteria | 75692 |
| 369 | Ga0495632_0000462 | 3300046519 | Bacteria | 38625 |
| 370 | Ga0495632_0000589 | 3300046519 | Bacteria | 33727 |
| 371 | Ga0495632_0006635 | 3300046519 | Bacteria | 7404 |
| 372 | Ga0495632_0008147 | 3300046519 | Bacteria | 6479 |
| 373 | Ga0495632_0025836 | 3300046519 | Bacteria | 3100 |
| 374 | Ga0495632_0494490 | 3300046519 | Bacteria | 528 |
| 375 | Ga0495637_0000002 | 3300046520 | Bacteria | 629280 |
| 376 | Ga0495637_0037223 | 3300046520 | Bacteria | 2114 |
| 377 | Ga0495643_0000096 | 3300046522 | Bacteria | 146041 |
| 378 | Ga0495643_0000441 | 3300046522 | Bacteria | 53599 |
| 379 | Ga0495643_0003747 | 3300046522 | Bacteria | 10995 |
| 380 | Ga0495643_0010783 | 3300046522 | Bacteria | 5606 |
| 381 | Ga0495643_0015130 | 3300046522 | Bacteria | 4571 |
| 382 | Ga0495643_0042916 | 3300046522 | Bacteria | 2462 |
| 383 | Ga0495643_0077750 | 3300046522 | Bacteria | 1733 |
| 384 | Ga0495643_0113673 | 3300046522 | Bacteria | 1374 |
| 385 | Ga0495643_0222455 | 3300046522 | Bacteria | 894 |
| 386 | Ga0495643_0239145 | 3300046522 | Bacteria | 852 |
| 387 | Ga0495643_0366748 | 3300046522 | Bacteria | 641 |
| 388 | Ga0495644_0002535 | 3300046523 | Bacteria | 7276 |
| 389 | Ga0495644_0004349 | 3300046523 | Bacteria | 5566 |
| 390 | Ga0495644_0005835 | 3300046523 | Bacteria | 4809 |
| 391 | Ga0495644_0007208 | 3300046523 | Bacteria | 4296 |
| 392 | Ga0495644_0020592 | 3300046523 | Bacteria | 2516 |
| 393 | Ga0495644_0031789 | 3300046523 | Bacteria | 1995 |
| 394 | Ga0495644_0041370 | 3300046523 | Bacteria | 1735 |
| 395 | Ga0495644_0042582 | 3300046523 | Bacteria | 1710 |
| 396 | Ga0495644_0172165 | 3300046523 | Bacteria | 831 |
| 397 | Ga0495648_0000252 | 3300046524 | Bacteria | 60717 |
| 398 | Ga0495648_0003183 | 3300046524 | Bacteria | 14608 |
| 399 | Ga0495648_0004850 | 3300046524 | Bacteria | 11355 |
| 400 | Ga0495648_0019199 | 3300046524 | Bacteria | 4816 |
| 401 | Ga0495648_0032963 | 3300046524 | Bacteria | 3391 |
| 402 | Ga0495648_0063586 | 3300046524 | Bacteria | 2178 |
| 403 | Ga0495648_0197353 | 3300046524 | Bacteria | 1010 |
| 404 | Ga0495663_0009179 | 3300046525 | Bacteria | 2742 |
| 405 | Ga0495663_0022331 | 3300046525 | Bacteria | 1827 |
| 406 | Ga0495663_0039356 | 3300046525 | Bacteria | 1432 |
| 407 | Ga0495663_0259179 | 3300046525 | Bacteria | 619 |
| 408 | Ga0495666_0001103 | 3300046526 | Bacteria | 12904 |
| 409 | Ga0495666_0006315 | 3300046526 | Bacteria | 5969 |
| 410 | Ga0495666_0007475 | 3300046526 | Bacteria | 5471 |
| 411 | Ga0495666_0011864 | 3300046526 | Bacteria | 4347 |
| 412 | Ga0495666_0172920 | 3300046526 | Bacteria | 998 |
| 413 | Ga0495666_0491965 | 3300046526 | Bacteria | 548 |
| 414 | Ga0495642_0000009 | 3300046528 | Bacteria | 152645 |
| 415 | Ga0495642_0000274 | 3300046528 | Bacteria | 29118 |
| 416 | Ga0495642_0001508 | 3300046528 | Bacteria | 10362 |
| 417 | Ga0495642_0003767 | 3300046528 | Bacteria | 5935 |
| 418 | Ga0495642_0009018 | 3300046528 | Bacteria | 3816 |
| 419 | Ga0495642_0011068 | 3300046528 | Bacteria | 3460 |
| 420 | Ga0495642_0020071 | 3300046528 | Bacteria | 2621 |
| 421 | Ga0495642_0033717 | 3300046528 | Bacteria | 2059 |
| 422 | Ga0495642_0063696 | 3300046528 | Bacteria | 1533 |
| 423 | Ga0495642_0080264 | 3300046528 | Bacteria | 1373 |
| 424 | Ga0495642_0093537 | 3300046528 | Bacteria | 1274 |
| 425 | Ga0495642_0117536 | 3300046528 | Bacteria | 1139 |
| 426 | Ga0495642_0168068 | 3300046528 | Bacteria | 952 |
| 427 | Ga0495642_0172700 | 3300046528 | Bacteria | 939 |
| 428 | Ga0495642_0196418 | 3300046528 | Bacteria | 879 |
| 429 | Ga0495642_0288882 | 3300046528 | Bacteria | 718 |
| 430 | Ga0495642_0333216 | 3300046528 | Bacteria | 666 |
| 431 | Ga0495652_0049112 | 3300046529 | Bacteria | 3613 |
| 432 | Ga0495654_0003261 | 3300046530 | Bacteria | 10010 |
| 433 | Ga0495654_0008701 | 3300046530 | Bacteria | 5596 |
| 434 | Ga0495654_0089601 | 3300046530 | Bacteria | 1429 |
| 435 | Ga0495654_0123433 | 3300046530 | Bacteria | 1170 |
| 436 | Ga0495665_0013081 | 3300046531 | Bacteria | 4493 |
| 437 | Ga0495665_0022112 | 3300046531 | Bacteria | 3419 |
| 438 | Ga0495665_0026917 | 3300046531 | Bacteria | 3087 |
| 439 | Ga0495665_0209764 | 3300046531 | Bacteria | 1008 |
| 440 | Ga0495586_0019756 | 3300046535 | Bacteria | 3587 |
| 441 | Ga0495586_0034639 | 3300046535 | Bacteria | 2712 |
| 442 | Ga0495586_0039029 | 3300046535 | Bacteria | 2552 |
| 443 | Ga0495586_0107520 | 3300046535 | Bacteria | 1551 |
| 444 | Ga0495586_0125601 | 3300046535 | Bacteria | 1435 |
| 445 | Ga0495587_0014374 | 3300046536 | Bacteria | 4967 |
| 446 | Ga0495587_0256683 | 3300046536 | Bacteria | 982 |
| 447 | Ga0495587_0304147 | 3300046536 | Bacteria | 891 |
| 448 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 449 | Ga0495609_0000848 | 3300046538 | Bacteria | 22555 |
| 450 | Ga0495609_0004021 | 3300046538 | Bacteria | 8209 |
| 451 | Ga0495609_0004505 | 3300046538 | Bacteria | 7598 |
| 452 | Ga0495609_0009953 | 3300046538 | Bacteria | 4579 |
| 453 | Ga0495609_0095372 | 3300046538 | Bacteria | 1291 |
| 454 | Ga0495609_0133378 | 3300046538 | Bacteria | 1062 |
| 455 | Ga0495609_0186265 | 3300046538 | Bacteria | 872 |
| 456 | Ga0495597_0000145 | 3300046542 | Bacteria | 63472 |
| 457 | Ga0495597_0001301 | 3300046542 | Bacteria | 18331 |
| 458 | Ga0495597_0001490 | 3300046542 | Bacteria | 16756 |
| 459 | Ga0495597_0004896 | 3300046542 | Bacteria | 7203 |
| 460 | Ga0495597_0022312 | 3300046542 | Bacteria | 2937 |
| 461 | Ga0495597_0026189 | 3300046542 | Bacteria | 2680 |
| 462 | Ga0495597_0056415 | 3300046542 | Bacteria | 1720 |
| 463 | Ga0495597_0107304 | 3300046542 | Bacteria | 1173 |
| 464 | Ga0495597_0118250 | 3300046542 | Bacteria | 1106 |
| 465 | Ga0495597_0137192 | 3300046542 | Bacteria | 1011 |
| 466 | Ga0495597_0226728 | 3300046542 | Bacteria | 740 |
| 467 | Ga0495597_0227259 | 3300046542 | Bacteria | 739 |
| 468 | Ga0495597_0394580 | 3300046542 | Bacteria | 527 |
| 469 | Ga0495622_0007211 | 3300046557 | Bacteria | 5163 |
| 470 | Ga0495622_0029359 | 3300046557 | Bacteria | 2569 |
| 471 | Ga0495622_0033944 | 3300046557 | Bacteria | 2381 |
| 472 | Ga0495622_0078918 | 3300046557 | Bacteria | 1515 |
| 473 | Ga0495622_0127395 | 3300046557 | Bacteria | 1160 |
| 474 | Ga0495622_0148465 | 3300046557 | Bacteria | 1061 |
| 475 | Ga0495633_0004643 | 3300046558 | Bacteria | 8653 |
| 476 | Ga0495633_0012570 | 3300046558 | Bacteria | 4493 |
| 477 | Ga0495633_0026725 | 3300046558 | Bacteria | 2828 |
| 478 | Ga0495633_0058572 | 3300046558 | Bacteria | 1807 |
| 479 | Ga0495633_0060591 | 3300046558 | Bacteria | 1773 |
| 480 | Ga0495633_0131624 | 3300046558 | Bacteria | 1157 |
| 481 | Ga0495633_0194349 | 3300046558 | Bacteria | 932 |
| 482 | Ga0495633_0398909 | 3300046558 | Bacteria | 622 |
| 483 | Ga0495667_0933971 | 3300046559 | Bacteria | 531 |
| 484 | Ga0495656_0001830 | 3300046615 | Bacteria | 6994 |
| 485 | Ga0495656_0032636 | 3300046615 | Bacteria | 2120 |
| 486 | Ga0495656_0032929 | 3300046615 | Bacteria | 2112 |
| 487 | Ga0495656_0093500 | 3300046615 | Bacteria | 1379 |
| 488 | Ga0495656_0209631 | 3300046615 | Bacteria | 970 |
| 489 | Ga0495656_0299261 | 3300046615 | Bacteria | 824 |
| 490 | Ga0495668_0000052 | 3300046616 | Bacteria | 212864 |
| 491 | Ga0495668_0000555 | 3300046616 | Bacteria | 46198 |
| 492 | Ga0495668_0002738 | 3300046616 | Bacteria | 14108 |
| 493 | Ga0495668_0003177 | 3300046616 | Bacteria | 12617 |
| 494 | Ga0495668_0035034 | 3300046616 | Bacteria | 2813 |
| 495 | Ga0495668_0055876 | 3300046616 | Bacteria | 2179 |
| 496 | Ga0495668_0056637 | 3300046616 | Bacteria | 2163 |
| 497 | Ga0495668_0126925 | 3300046616 | Bacteria | 1396 |
| 498 | Ga0495668_0710499 | 3300046616 | Bacteria | 556 |
| 499 | Ga0495634_0145785 | 3300046642 | Bacteria | 1500 |
| 500 | Ga0495611_0000132 | 3300046648 | Bacteria | 52191 |
| 501 | Ga0495611_0004043 | 3300046648 | Bacteria | 6382 |
| 502 | Ga0495611_0019938 | 3300046648 | Bacteria | 2883 |
| 503 | Ga0495611_0020126 | 3300046648 | Bacteria | 2870 |
| 504 | Ga0495611_0024063 | 3300046648 | Bacteria | 2647 |
| 505 | Ga0495611_0108148 | 3300046648 | Bacteria | 1293 |
| 506 | Ga0495611_0124341 | 3300046648 | Bacteria | 1203 |
| 507 | Ga0495611_0502860 | 3300046648 | Bacteria | 550 |
| 508 | Ga0495625_0013292 | 3300046660 | Bacteria | 6620 |
| 509 | Ga0495625_0018354 | 3300046660 | Bacteria | 5464 |
| 510 | Ga0495625_0032581 | 3300046660 | Bacteria | 3862 |
| 511 | Ga0495625_0058042 | 3300046660 | Bacteria | 2750 |
| 512 | Ga0495625_0087102 | 3300046660 | Bacteria | 2165 |
| 513 | Ga0495625_0091639 | 3300046660 | Bacteria | 2101 |
| 514 | Ga0495625_0116728 | 3300046660 | Bacteria | 1820 |
| 515 | Ga0495625_0214665 | 3300046660 | Bacteria | 1263 |
| 516 | Ga0495625_0568549 | 3300046660 | Bacteria | 684 |
| 517 | Ga0495635_0012836 | 3300046663 | Bacteria | 5868 |
| 518 | Ga0495635_0525586 | 3300046663 | Bacteria | 777 |
| 519 | Ga0495659_0009819 | 3300046664 | Bacteria | 3062 |
| 520 | Ga0495659_0085647 | 3300046664 | Bacteria | 1202 |
| 521 | Ga0495661_0000090 | 3300046665 | Bacteria | 110201 |
| 522 | Ga0495661_0000238 | 3300046665 | Bacteria | 63454 |
| 523 | Ga0495661_0000659 | 3300046665 | Bacteria | 34605 |
| 524 | Ga0495661_0001722 | 3300046665 | Bacteria | 17709 |
| 525 | Ga0495661_0006126 | 3300046665 | Bacteria | 8468 |
| 526 | Ga0495661_0015425 | 3300046665 | Bacteria | 5099 |
| 527 | Ga0495661_0015852 | 3300046665 | Bacteria | 5017 |
| 528 | Ga0495661_0024805 | 3300046665 | Bacteria | 3880 |
| 529 | Ga0495661_0031177 | 3300046665 | Bacteria | 3386 |
| 530 | Ga0495661_0038468 | 3300046665 | Bacteria | 2979 |
| 531 | Ga0495661_0046547 | 3300046665 | Bacteria | 2647 |
| 532 | Ga0495661_0101064 | 3300046665 | Bacteria | 1623 |
| 533 | Ga0495661_0107749 | 3300046665 | Bacteria | 1557 |
| 534 | Ga0495661_0114666 | 3300046665 | Bacteria | 1497 |
| 535 | Ga0495661_0119746 | 3300046665 | Bacteria | 1455 |
| 536 | Ga0495661_0190431 | 3300046665 | Bacteria | 1080 |
| 537 | Ga0495661_0192147 | 3300046665 | Bacteria | 1074 |
| 538 | Ga0495661_0234172 | 3300046665 | Bacteria | 945 |
| 539 | Ga0495661_0266876 | 3300046665 | Bacteria | 867 |
| 540 | Ga0495661_0292192 | 3300046665 | Bacteria | 818 |
| 541 | Ga0495661_0321778 | 3300046665 | Bacteria | 768 |
| 542 | Ga0495661_0329501 | 3300046665 | Bacteria | 757 |
| 543 | Ga0495588_0000095 | 3300046674 | Bacteria | 175627 |
| 544 | Ga0495588_0005558 | 3300046674 | Bacteria | 5616 |
| 545 | Ga0495588_0014176 | 3300046674 | Bacteria | 3811 |
| 546 | Ga0495588_0016820 | 3300046674 | Bacteria | 3539 |
| 547 | Ga0495588_0018574 | 3300046674 | Bacteria | 3392 |
| 548 | Ga0495588_0037047 | 3300046674 | Bacteria | 2477 |
| 549 | Ga0495588_0047477 | 3300046674 | Bacteria | 2204 |
| 550 | Ga0495588_0084012 | 3300046674 | Bacteria | 1663 |
| 551 | Ga0495588_0107368 | 3300046674 | Bacteria | 1469 |
| 552 | Ga0495588_0164145 | 3300046674 | Bacteria | 1174 |
| 553 | Ga0495588_0732617 | 3300046674 | Bacteria | 517 |
| 554 | Ga0495623_0045995 | 3300046679 | Bacteria | 2770 |
| 555 | Ga0495623_0162198 | 3300046679 | Bacteria | 1313 |
| 556 | Ga0495646_0055408 | 3300046680 | Bacteria | 2381 |
| 557 | Ga0495669_0000040 | 3300046684 | Bacteria | 90851 |
| 558 | Ga0495669_0000455 | 3300046684 | Bacteria | 19161 |
| 559 | Ga0495669_0005288 | 3300046684 | Bacteria | 5377 |
| 560 | Ga0495669_0024931 | 3300046684 | Bacteria | 2606 |
| 561 | Ga0495669_0034771 | 3300046684 | Bacteria | 2222 |
| 562 | Ga0495669_0117964 | 3300046684 | Bacteria | 1242 |
| 563 | Ga0495613_0073804 | 3300046689 | Bacteria | 2485 |
| 564 | Ga0495613_0121968 | 3300046689 | Bacteria | 1871 |
| 565 | Ga0495624_0003630 | 3300046690 | Bacteria | 11410 |
| 566 | Ga0495670_0009691 | 3300046691 | Bacteria | 4734 |
| 567 | Ga0495670_0014390 | 3300046691 | Bacteria | 3888 |
| 568 | Ga0495670_0017005 | 3300046691 | Bacteria | 3576 |
| 569 | Ga0495670_0019637 | 3300046691 | Bacteria | 3329 |
| 570 | Ga0495670_0027528 | 3300046691 | Bacteria | 2817 |
| 571 | Ga0495670_0039411 | 3300046691 | Bacteria | 2356 |
| 572 | Ga0495670_0046835 | 3300046691 | Bacteria | 2160 |
| 573 | Ga0495670_0275451 | 3300046691 | Bacteria | 899 |
| 574 | Ga0495671_0000047 | 3300046692 | Bacteria | 156459 |
| 575 | Ga0495671_0014119 | 3300046692 | Bacteria | 4306 |
| 576 | Ga0495671_0058403 | 3300046692 | Bacteria | 1908 |
| 577 | Ga0495671_0250338 | 3300046692 | Bacteria | 855 |
| 578 | Ga0495671_0369487 | 3300046692 | Bacteria | 687 |
| 579 | Ga0495649_0000174 | 3300046694 | Bacteria | 56050 |
| 580 | Ga0495649_0000967 | 3300046694 | Bacteria | 22674 |
| 581 | Ga0495649_0001231 | 3300046694 | Bacteria | 19717 |
| 582 | Ga0495649_0035460 | 3300046694 | Bacteria | 2744 |
| 583 | Ga0495649_0043922 | 3300046694 | Bacteria | 2439 |
| 584 | Ga0495649_0059933 | 3300046694 | Bacteria | 2048 |
| 585 | Ga0495649_0083568 | 3300046694 | Bacteria | 1706 |
| 586 | Ga0495649_0135312 | 3300046694 | Bacteria | 1299 |
| 587 | Ga0495649_0294316 | 3300046694 | Bacteria | 827 |
| 588 | Ga0495649_0576937 | 3300046694 | Bacteria | 556 |
| 589 | Ga0495649_0663660 | 3300046694 | Bacteria | 512 |
| 590 | Ga0495589_0000029 | 3300046794 | Bacteria | 173640 |
| 591 | Ga0495589_0000301 | 3300046794 | Bacteria | 39328 |
| 592 | Ga0495589_0000304 | 3300046794 | Bacteria | 39263 |
| 593 | Ga0495589_0009270 | 3300046794 | Bacteria | 5119 |
| 594 | Ga0495589_0014301 | 3300046794 | Bacteria | 4089 |
| 595 | Ga0495589_0020283 | 3300046794 | Bacteria | 3400 |
| 596 | Ga0495589_0029633 | 3300046794 | Bacteria | 2759 |
| 597 | Ga0495589_0040774 | 3300046794 | Bacteria | 2317 |
| 598 | Ga0495589_0051593 | 3300046794 | Bacteria | 2033 |
| 599 | Ga0495589_0075839 | 3300046794 | Bacteria | 1639 |
| 600 | Ga0495589_0353768 | 3300046794 | Bacteria | 676 |
| 601 | Ga0495600_0012572 | 3300046809 | Bacteria | 5297 |
| 602 | Ga0495600_0042305 | 3300046809 | Bacteria | 2970 |
| 603 | Ga0495600_0318329 | 3300046809 | Bacteria | 979 |
| 604 | Ga0495660_0000033 | 3300046810 | Bacteria | 212425 |
| 605 | Ga0495660_0013473 | 3300046810 | Bacteria | 4738 |
| 606 | Ga0495660_0025758 | 3300046810 | Bacteria | 3338 |
| 607 | Ga0495660_0036080 | 3300046810 | Bacteria | 2759 |
| 608 | Ga0495660_0101624 | 3300046810 | Bacteria | 1479 |
| 609 | Ga0495660_0130091 | 3300046810 | Bacteria | 1263 |
| 610 | Ga0495660_0130803 | 3300046810 | Bacteria | 1259 |
| 611 | Ga0495581_0004022 | 3300047315 | Bacteria | 8464 |
| 612 | Ga0495581_0089387 | 3300047315 | Bacteria | 1786 |
| 613 | Ga0495581_0751714 | 3300047315 | Bacteria | 561 |
| 614 | Ga0495581_0758634 | 3300047315 | Bacteria | 558 |
| 615 | Ga0495604_0022852 | 3300047317 | Bacteria | 4991 |
| 616 | Ga0495604_0107568 | 3300047317 | Bacteria | 2038 |
| 617 | Ga0495604_0203356 | 3300047317 | Bacteria | 1372 |
| 618 | Ga0495604_0232123 | 3300047317 | Bacteria | 1265 |
| 619 | Ga0495604_0787372 | 3300047317 | Bacteria | 599 |
| 620 | Ga0495604_0941589 | 3300047317 | Bacteria | 537 |
| 621 | Ga0495636_0006935 | 3300047318 | Bacteria | 4455 |
| 622 | Ga0495636_0011307 | 3300047318 | Bacteria | 3532 |
| 623 | Ga0495636_0018843 | 3300047318 | Bacteria | 2770 |
| 624 | Ga0495636_0515681 | 3300047318 | Bacteria | 579 |
| 625 | Ga0495636_0668743 | 3300047318 | Bacteria | 511 |
| 626 | Ga0495674_0011313 | 3300047319 | Bacteria | 8424 |
| 627 | Ga0495674_1065826 | 3300047319 | Bacteria | 617 |
| 628 | Ga0495672_0000056 | 3300047320 | Bacteria | 223740 |
| 629 | Ga0495672_0000430 | 3300047320 | Bacteria | 50227 |
| 630 | Ga0495672_0000445 | 3300047320 | Bacteria | 49224 |
| 631 | Ga0495672_0020997 | 3300047320 | Bacteria | 4266 |
| 632 | Ga0495672_0090357 | 3300047320 | Bacteria | 1683 |
| 633 | Ga0495672_0099651 | 3300047320 | Bacteria | 1579 |
| 634 | Ga0495676_0000007 | 3300047321 | Bacteria | 276148 |
| 635 | Ga0495676_0063289 | 3300047321 | Bacteria | 2884 |
| 636 | Ga0495676_0102245 | 3300047321 | Bacteria | 2118 |
| 637 | Ga0495676_0186013 | 3300047321 | Bacteria | 1452 |
| 638 | Ga0495680_0028170 | 3300047322 | Bacteria | 4608 |
| 639 | Ga0495680_0388751 | 3300047322 | Bacteria | 965 |
| 640 | Ga0495680_0416448 | 3300047322 | Bacteria | 925 |
| 641 | Ga0495680_0724277 | 3300047322 | Bacteria | 655 |
| 642 | Ga0495683_0000017 | 3300047323 | Bacteria | 189599 |
| 643 | Ga0495683_0015398 | 3300047323 | Bacteria | 3980 |
| 644 | Ga0495683_0052397 | 3300047323 | Bacteria | 2037 |
| 645 | Ga0495683_0134522 | 3300047323 | Bacteria | 1163 |
| 646 | Ga0495683_0151685 | 3300047323 | Bacteria | 1078 |
| 647 | Ga0495683_0179324 | 3300047323 | Bacteria | 968 |
| 648 | Ga0495683_0194149 | 3300047323 | Bacteria | 919 |
| 649 | Ga0495683_0343348 | 3300047323 | Bacteria | 631 |
| 650 | Ga0495683_0400965 | 3300047323 | Bacteria | 570 |
| 651 | Ga0495687_000003 | 3300047443 | Bacteria | 859509 |
| 652 | Ga0495687_000092 | 3300047443 | Bacteria | 140313 |
| 653 | Ga0495687_000150 | 3300047443 | Bacteria | 105759 |
| 654 | Ga0495687_000486 | 3300047443 | Bacteria | 48072 |
| 655 | Ga0495687_001901 | 3300047443 | Bacteria | 17963 |
| 656 | Ga0495675_0025745 | 3300047444 | Bacteria | 3749 |
| 657 | Ga0495675_0026183 | 3300047444 | Bacteria | 3718 |
| 658 | Ga0495675_0094011 | 3300047444 | Bacteria | 1880 |
| 659 | Ga0495675_0212882 | 3300047444 | Bacteria | 1172 |
| 660 | Ga0495675_0332687 | 3300047444 | Bacteria | 896 |
| 661 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 662 | Ga0495677_0000587 | 3300047445 | Bacteria | 14912 |
| 663 | Ga0495677_0000625 | 3300047445 | Bacteria | 14244 |
| 664 | Ga0495677_0000627 | 3300047445 | Bacteria | 14243 |
| 665 | Ga0495677_0006239 | 3300047445 | Bacteria | 4501 |
| 666 | Ga0495677_0007115 | 3300047445 | Bacteria | 4189 |
| 667 | Ga0495677_0009529 | 3300047445 | Bacteria | 3585 |
| 668 | Ga0495677_0009698 | 3300047445 | Bacteria | 3550 |
| 669 | Ga0495677_0014337 | 3300047445 | Bacteria | 2887 |
| 670 | Ga0495677_0017547 | 3300047445 | Bacteria | 2594 |
| 671 | Ga0495677_0037585 | 3300047445 | Bacteria | 1768 |
| 672 | Ga0495677_0139513 | 3300047445 | Bacteria | 930 |
| 673 | Ga0495677_0216708 | 3300047445 | Bacteria | 745 |
| 674 | Ga0495677_0226879 | 3300047445 | Bacteria | 728 |
| 675 | Ga0495677_0317961 | 3300047445 | Bacteria | 613 |
| 676 | Ga0495677_0348849 | 3300047445 | Bacteria | 584 |
| 677 | Ga0495679_002314 | 3300047446 | Bacteria | 9799 |
| 678 | Ga0495679_038989 | 3300047446 | Bacteria | 1484 |
| 679 | Ga0495679_110372 | 3300047446 | Bacteria | 757 |
| 680 | Ga0495679_150082 | 3300047446 | Bacteria | 626 |
| 681 | Ga0495685_000557 | 3300047447 | Bacteria | 11550 |
| 682 | Ga0495685_000751 | 3300047447 | Bacteria | 9938 |
| 683 | Ga0495685_022602 | 3300047447 | Bacteria | 2164 |
| 684 | Ga0495685_024552 | 3300047447 | Bacteria | 2075 |
| 685 | Ga0495685_066711 | 3300047447 | Bacteria | 1209 |
| 686 | Ga0495681_0000054 | 3300047470 | Bacteria | 106578 |
| 687 | Ga0495681_0000080 | 3300047470 | Bacteria | 84770 |
| 688 | Ga0495681_0001856 | 3300047470 | Bacteria | 15509 |
| 689 | Ga0495681_0004546 | 3300047470 | Bacteria | 9459 |
| 690 | Ga0495681_0017857 | 3300047470 | Bacteria | 3927 |
| 691 | Ga0495681_0022659 | 3300047470 | Bacteria | 3356 |
| 692 | Ga0495681_0030902 | 3300047470 | Bacteria | 2720 |
| 693 | Ga0495681_0066130 | 3300047470 | Bacteria | 1651 |
| 694 | Ga0495681_0075103 | 3300047470 | Bacteria | 1522 |
| 695 | Ga0495681_0080279 | 3300047470 | Bacteria | 1457 |
| 696 | Ga0495681_0102830 | 3300047470 | Bacteria | 1246 |
| 697 | Ga0495686_0000235 | 3300047472 | Bacteria | 101102 |
| 698 | Ga0495686_0000379 | 3300047472 | Bacteria | 71434 |
| 699 | Ga0495686_0010909 | 3300047472 | Bacteria | 6434 |
| 700 | Ga0495686_0022934 | 3300047472 | Bacteria | 4124 |
| 701 | Ga0495686_0148160 | 3300047472 | Bacteria | 1380 |
| 702 | Ga0495593_0003479 | 3300047673 | Bacteria | 9431 |
| 703 | Ga0495593_0004899 | 3300047673 | Bacteria | 7939 |
| 704 | Ga0495593_0233922 | 3300047673 | Bacteria | 921 |
| 705 | Ga0495593_0350823 | 3300047673 | Bacteria | 737 |
| 706 | Ga0495602_0085738 | 3300048088 | Bacteria | 2631 |
| 707 | Ga0495602_0091336 | 3300048088 | Bacteria | 2526 |
| 708 | Ga0495602_0793568 | 3300048088 | Bacteria | 636 |
| 709 | Ga0495614_0009386 | 3300048089 | Bacteria | 4326 |
| 710 | Ga0495614_0015146 | 3300048089 | Bacteria | 3364 |
| 711 | Ga0495614_0026416 | 3300048089 | Bacteria | 2502 |
| 712 | Ga0495615_0021975 | 3300048090 | Bacteria | 1445 |
| 713 | Ga0495615_0120860 | 3300048090 | Bacteria | 757 |
| 714 | Ga0495626_0000018 | 3300048091 | Bacteria | 230153 |
| 715 | Ga0495626_0000159 | 3300048091 | Bacteria | 83571 |
| 716 | Ga0495626_0001482 | 3300048091 | Bacteria | 18513 |
| 717 | Ga0495626_0001668 | 3300048091 | Bacteria | 17140 |
| 718 | Ga0495626_0006333 | 3300048091 | Bacteria | 6749 |
| 719 | Ga0495626_0006510 | 3300048091 | Bacteria | 6640 |
| 720 | Ga0495626_0010665 | 3300048091 | Bacteria | 4886 |
| 721 | Ga0495626_0017336 | 3300048091 | Bacteria | 3638 |
| 722 | Ga0495626_0018254 | 3300048091 | Bacteria | 3526 |
| 723 | Ga0495626_0018279 | 3300048091 | Bacteria | 3523 |
| 724 | Ga0495626_0027183 | 3300048091 | Bacteria | 2783 |
| 725 | Ga0495626_0048931 | 3300048091 | Bacteria | 1959 |
| 726 | Ga0495626_0049677 | 3300048091 | Bacteria | 1941 |
| 727 | Ga0495626_0088640 | 3300048091 | Bacteria | 1363 |
| 728 | Ga0495626_0097541 | 3300048091 | Bacteria | 1285 |
| 729 | Ga0495626_0138234 | 3300048091 | Bacteria | 1034 |
| 730 | Ga0495626_0163330 | 3300048091 | Bacteria | 932 |
| 731 | Ga0495626_0382166 | 3300048091 | Bacteria | 546 |
| 732 | Ga0496100_0107382 | 3300048903 | Bacteria | 1933 |
| 733 | Ga0496101_0022528 | 3300048904 | Bacteria | 4337 |
| 734 | Ga0496102_0000176 | 3300048905 | Bacteria | 86747 |
| 735 | Ga0496102_0000323 | 3300048905 | Bacteria | 59717 |
| 736 | Ga0496102_0027488 | 3300048905 | Bacteria | 5080 |
| 737 | Ga0496102_0039918 | 3300048905 | Bacteria | 4243 |
| 738 | Ga0496102_0069184 | 3300048905 | Bacteria | 3240 |
| 739 | Ga0496102_0295605 | 3300048905 | Bacteria | 1526 |
| 740 | Ga0496102_0427793 | 3300048905 | Bacteria | 1243 |
| 741 | Ga0496103_0007567 | 3300048906 | Bacteria | 6472 |
| 742 | Ga0496103_0020276 | 3300048906 | Bacteria | 3993 |
| 743 | Ga0496103_0165919 | 3300048906 | Bacteria | 1417 |
| 744 | Ga0496103_0778305 | 3300048906 | Bacteria | 604 |
| 745 | Ga0496104_0698306 | 3300048907 | Bacteria | 922 |
| 746 | Ga0496104_0885527 | 3300048907 | Bacteria | 798 |
| 747 | Ga0496105_0076559 | 3300048908 | Bacteria | 2763 |
| 748 | Ga0496105_0419372 | 3300048908 | Bacteria | 1060 |
| 749 | Ga0496106_0010178 | 3300048909 | Bacteria | 6948 |
| 750 | Ga0496106_0660486 | 3300048909 | Bacteria | 835 |
| 751 | Ga0496106_0688783 | 3300048909 | Bacteria | 815 |
| 752 | Ga0496107_0142399 | 3300048910 | Bacteria | 1772 |
| 753 | Ga0496108_0091304 | 3300048911 | Bacteria | 2589 |
| 754 | Ga0496108_0701238 | 3300048911 | Bacteria | 878 |
| 755 | Ga0496109_0006989 | 3300048912 | Bacteria | 9526 |
| 756 | Ga0496109_0207287 | 3300048912 | Bacteria | 1843 |
| 757 | Ga0496109_1510193 | 3300048912 | Bacteria | 607 |
| 758 | Ga0496110_0000002 | 3300048913 | Bacteria | 166613 |
| 759 | Ga0496110_0481475 | 3300048913 | Bacteria | 1130 |
| 760 | Ga0496110_1160352 | 3300048913 | Bacteria | 681 |
| 761 | Ga0496110_1529012 | 3300048913 | Bacteria | 577 |
| 762 | Ga0496110_1683018 | 3300048913 | Bacteria | 544 |
| 763 | Ga0496111_0114257 | 3300048914 | Bacteria | 1990 |
| 764 | Ga0496111_0361038 | 3300048914 | Bacteria | 1075 |
| 765 | Ga0496112_0090323 | 3300048915 | Bacteria | 3032 |
| 766 | Ga0496112_0946775 | 3300048915 | Bacteria | 782 |
| 767 | Ga0496113_0008610 | 3300048916 | Bacteria | 6654 |
| 768 | Ga0496113_0022590 | 3300048916 | Bacteria | 4452 |
| 769 | Ga0496113_0817167 | 3300048916 | Bacteria | 740 |
| 770 | Ga0496113_1005320 | 3300048916 | Bacteria | 657 |
| 771 | Ga0496114_0449565 | 3300048917 | Bacteria | 1141 |
| 772 | Ga0496115_0000708 | 3300048918 | Bacteria | 24708 |
| 773 | Ga0496115_0090803 | 3300048918 | Bacteria | 2495 |
| 774 | Ga0496115_0092509 | 3300048918 | Bacteria | 2472 |
| 775 | Ga0496115_0116460 | 3300048918 | Bacteria | 2198 |
| 776 | Ga0496115_0175241 | 3300048918 | Bacteria | 1773 |
| 777 | Ga0496115_0715214 | 3300048918 | Bacteria | 786 |
| 778 | Ga0496121_0226586 | 3300048924 | Bacteria | 1312 |
| 779 | Ga0496122_0000299 | 3300048925 | Bacteria | 109780 |
| 780 | Ga0496122_0008202 | 3300048925 | Bacteria | 11345 |
| 781 | Ga0496122_0026288 | 3300048925 | Bacteria | 5022 |
| 782 | Ga0496122_0372410 | 3300048925 | Bacteria | 736 |
| 783 | Ga0496123_0000783 | 3300048926 | Bacteria | 51354 |
| 784 | Ga0496123_0004032 | 3300048926 | Bacteria | 15844 |
| 785 | Ga0496123_0499482 | 3300048926 | Bacteria | 532 |
| 786 | Ga0496124_0004757 | 3300048927 | Bacteria | 15634 |
| 787 | Ga0496124_0046616 | 3300048927 | Bacteria | 3711 |
| 788 | Ga0496124_0089253 | 3300048927 | Bacteria | 2517 |
| 789 | Ga0496124_0103257 | 3300048927 | Bacteria | 2306 |
| 790 | Ga0496124_0112070 | 3300048927 | Bacteria | 2194 |
| 791 | Ga0496124_0140982 | 3300048927 | Bacteria | 1902 |
| 792 | Ga0496124_0471383 | 3300048927 | Bacteria | 850 |
| 793 | Ga0496125_0004760 | 3300048928 | Bacteria | 15465 |
| 794 | Ga0496125_0036084 | 3300048928 | Bacteria | 4324 |
| 795 | Ga0496126_0177411 | 3300048929 | Bacteria | 1812 |
| 796 | Ga0501308_000151 | 3300049128 | Bacteria | 3653 |
| 797 | Ga0501304_002999 | 3300049160 | Bacteria | 1211 |
| 798 | Ga0495678_000048 | 3300049459 | Bacteria | 165744 |
| 799 | Ga0495678_000050 | 3300049459 | Bacteria | 160887 |
| 800 | Ga0495678_000122 | 3300049459 | Bacteria | 91100 |
| 801 | Ga0495678_000257 | 3300049459 | Bacteria | 59306 |
| 802 | Ga0495682_0000144 | 3300049460 | Bacteria | 61914 |
| 803 | Ga0495682_0001333 | 3300049460 | Bacteria | 13680 |
| 804 | Ga0495682_0008506 | 3300049460 | Bacteria | 4039 |
| 805 | Ga0495682_0021606 | 3300049460 | Bacteria | 2410 |
| 806 | Ga0501297_039683 | 3300049520 | Bacteria | 658 |
| 807 | Ga0501313_000568 | 3300049529 | Bacteria | 2639 |
| 808 | Ga0501315_000954 | 3300049531 | Bacteria | 2278 |
| 809 | Ga0501315_026364 | 3300049531 | Bacteria | 814 |
| 810 | Ga0501034_0168575 | 3300049571 | Bacteria | 2158 |
| 811 | Ga0501034_1195480 | 3300049571 | Bacteria | 639 |
| 812 | Ga0501036_0215315 | 3300049572 | Bacteria | 1614 |
| 813 | Ga0501047_0560030 | 3300049581 | Bacteria | 967 |
| 814 | Ga0501206_012442 | 3300049653 | Bacteria | 1155 |
| 815 | Ga0501217_235619 | 3300049661 | Bacteria | 584 |
| 816 | Ga0501222_005723 | 3300049662 | Bacteria | 1672 |
| 817 | Ga0501230_042323 | 3300049667 | Bacteria | 885 |
| 818 | Ga0501236_069521 | 3300049670 | Bacteria | 641 |
| 819 | Ga0501257_197828 | 3300049686 | Bacteria | 576 |
| 820 | Ga0501221_083214 | 3300049704 | Bacteria | 773 |
| 821 | Ga0501279_077020 | 3300049775 | Bacteria | 570 |
| 822 | Ga0501035_0000613 | 3300049822 | Bacteria | 39265 |
| 823 | Ga0501204_040648 | 3300049850 | Bacteria | 680 |
| 824 | Ga0501226_035316 | 3300049853 | Bacteria | 573 |
| 825 | Ga0587084_014879 | 3300059477 | Bacteria | 1091 |
| 826 | Ga0587066_022117 | 3300059490 | Bacteria | 1061 |
| 827 | Ga0587070_031612 | 3300059491 | Bacteria | 963 |
| 828 | Ga0587070_044477 | 3300059491 | Bacteria | 863 |
| 829 | Ga0587080_008070 | 3300059503 | Bacteria | 1497 |
| 830 | Ga0587082_001204 | 3300059504 | Bacteria | 2594 |
| 831 | Ga0587082_035639 | 3300059504 | Bacteria | 889 |
| 832 | Ga0587083_0008376 | 3300059505 | Bacteria | 1616 |
| 833 | Ga0587088_002006 | 3300059508 | Bacteria | 2235 |
| 834 | Ga0587090_020398 | 3300059510 | Bacteria | 1031 |
| 835 | Ga0587090_023613 | 3300059510 | Bacteria | 981 |
| 836 | Ga0587098_005248 | 3300059604 | Bacteria | 1262 |
| 837 | Ga0587106_000728 | 3300059605 | Bacteria | 2538 |
| 838 | Ga0587125_004684 | 3300059607 | Bacteria | 1228 |
| 839 | Ga0587101_006472 | 3300059623 | Bacteria | 1345 |
| 840 | Ga0587067_011005 | 3300059640 | Bacteria | 1385 |
| 841 | Ga0587068_000200 | 3300059641 | Bacteria | 4613 |
| 842 | Ga0587069_001016 | 3300059642 | Bacteria | 2423 |
| 843 | Ga0587072_001324 | 3300059643 | Bacteria | 3018 |
| 844 | Ga0587076_018910 | 3300059645 | Bacteria | 1115 |
| 845 | Ga0587079_000185 | 3300059647 | Bacteria | 4462 |
| 846 | Ga0587079_039651 | 3300059647 | Bacteria | 946 |
| 847 | Ga0587105_004475 | 3300059651 | Bacteria | 895 |
| 848 | Ga0587107_004301 | 3300059652 | Bacteria | 1441 |
| 849 | Ga0587071_007542 | 3300060344 | Bacteria | 1738 |
| 850 | Ga0587111_0029589 | 3300060346 | Bacteria | 1110 |
| 851 | Ga0466962_0029931 | 3300061719 | Bacteria | 2606 |
| 852 | Ga0466962_0261738 | 3300061719 | Bacteria | 851 |
| 853 | Ga0466962_0406063 | 3300061719 | Bacteria | 682 |
| 854 | Ga0466962_0500924 | 3300061719 | Bacteria | 615 |
| 855 | Ga0495687_000411 | |||
| 856 | rootH2_10189217 | |||
| 857 | rootL2_10011198 | |||
| 858 | Ga0007410J51695_1017414 | |||
| 859 | Ga0055525_1000008 | |||
| 860 | Ga0055542_1007860 | |||
| 861 | Ga0065165_1002057 | |||
| 862 | Ga0065165_1021713 | |||
| 863 | Ga0065714_10132036 | |||
| 864 | Ga0070658_10091401 | |||
| 865 | Ga0070658_10173858 | |||
| 866 | Ga0070658_10959788 | |||
| 867 | Ga0070658_11081712 | |||
| 868 | Ga0070670_101336589 | |||
| 869 | Ga0070682_100568529 | |||
| 870 | Ga0070660_100265035 | |||
| 871 | Ga0070660_101290600 | |||
| 872 | Ga0070660_101572380 | |||
| 873 | Ga0070661_100103074 | |||
| 874 | Ga0070659_100343872 | |||
| 875 | Ga0070667_100774409 | |||
| 876 | Ga0070663_100593245 | |||
| 877 | Ga0070662_100130144 | |||
| 878 | Ga0070662_100627296 | |||
| 879 | Ga0068867_100791149 | |||
| 880 | Ga0068853_100228345 | |||
| 881 | Ga0070672_100128483 | |||
| 882 | Ga0068855_100071413 | |||
| 883 | Ga0068855_100556760 | |||
| 884 | Ga0070664_100916519 | |||
| 885 | Ga0070664_101155930 | |||
| 886 | Ga0068852_100046601 | |||
| 887 | Ga0068866_10224569 | |||
| 888 | Ga0105244_10376530 | |||
| 889 | Ga0105245_10192652 | |||
| 890 | Ga0105243_10050716 | |||
| 891 | Ga0105241_10057928 | |||
| 892 | Ga0105242_10009383 | |||
| 893 | Ga0105237_10052079 | |||
| 894 | Ga0105238_10525231 | |||
| 895 | Ga0105239_10399324 | |||
| 896 | Ga0105239_12887261 | |||
| 897 | Ga0105246_10919948 | |||
| 898 | Ga0157371_10000149 | |||
| 899 | Ga0157370_10464208 | |||
| 900 | Ga0157369_11008966 | |||
| 901 | Ga0157369_11210192 | |||
| 902 | Ga0157374_10475745 | |||
| 903 | Ga0157374_12019076 | |||
| 904 | Ga0157372_10135257 | |||
| 905 | Ga0157372_11023564 | |||
| 906 | Ga0157372_11069717 | |||
| 907 | Ga0157372_11831313 | |||
| 908 | Ga0182006_1073772 | |||
| 909 | Ga0182007_10068111 | |||
| 910 | Ga0182007_10206179 | |||
| 911 | Ga0163161_10759428 | |||
| 912 | Ga0209563_100003 | |||
| 913 | Ga0209677_106012 | |||
| 914 | Ga0209148_1000403 | |||
| 915 | Ga0207642_10989157 | |||
| 916 | Ga0207705_10005671 | |||
| 917 | Ga0207705_10079021 | |||
| 918 | Ga0207654_10116350 | |||
| 919 | Ga0207671_10164551 | |||
| 920 | Ga0207657_10028684 | |||
| 921 | Ga0207657_10187015 | |||
| 922 | Ga0207657_10331810 | |||
| 923 | Ga0207649_10077342 | |||
| 924 | Ga0207649_10289115 | |||
| 925 | Ga0207694_10223810 | |||
| 926 | Ga0207687_10412997 | |||
| 927 | Ga0207690_10109813 | |||
| 928 | Ga0207690_10595403 | |||
| 929 | Ga0207690_11564661 | |||
| 930 | Ga0207706_10113901 | |||
| 931 | Ga0207706_10121471 | |||
| 932 | Ga0207686_10057523 | |||
| 933 | Ga0207709_10080665 | |||
| 934 | Ga0207704_10203948 | |||
| 935 | Ga0207661_10819702 | |||
| 936 | Ga0207679_10074584 | |||
| 937 | Ga0207679_10305288 | |||
| 938 | Ga0207667_10012297 | |||
| 939 | Ga0207667_11853012 | |||
| 940 | Ga0207640_12096901 | |||
| 941 | Ga0207658_10610504 | |||
| 942 | Ga0207639_10741030 | |||
| 943 | Ga0207678_10058990 | |||
| 944 | Ga0207702_10299780 | |||
| 945 | Ga0207648_10124022 | |||
| 946 | Ga0207674_11593918 | |||
| 947 | Ga0207698_10395425 | |||
| 948 | Ga0316177_1087656 | |||
| 949 | Ga0316180_1076152 | |||
| 950 | Ga0316182_1045793 | |||
| 951 | Ga0316182_1068880 | |||
| 952 | Ga0316182_1395676 | |||
| 953 | Ga0307408_100749939 | |||
| 954 | Ga0307414_10038809 | |||
| 955 | Ga0373934_0031476 | |||
| 956 | Ga0395899_0000012 | |||
| 957 | Ga0395899_0044141 | |||
| 958 | Ga0395899_0071787 | |||
| 959 | Ga0395899_0236117 | |||
| 960 | Ga0395899_0248109 | |||
| 961 | Ga0395899_0471143 | |||
| 962 | Ga0395900_0000028 | |||
| 963 | Ga0395900_0177724 | |||
| 964 | Ga0395900_0192545 | |||
| 965 | Ga0395900_0206530 | |||
| 966 | Ga0395900_0249315 | |||
| 967 | Ga0395900_0315765 | |||
| 968 | Ga0395900_0392115 | |||
| 969 | Ga0395900_0526281 | |||
| 970 | Ga0395900_0745766 | |||
| 971 | Ga0395900_0995271 | |||
| 972 | Ga0395898_0037410 | |||
| 973 | Ga0395898_0052983 | |||
| 974 | Ga0395898_0150061 | |||
| 975 | Ga0395898_0620310 | |||
| 976 | Ga0395898_1437851 | |||
| 977 | Ga0395898_1554679 | |||
| 978 | Ga0395905_0063674 | |||
| 979 | Ga0395905_0144826 | |||
| 980 | Ga0395905_0277986 | |||
| 981 | Ga0395905_0341564 | |||
| 982 | Ga0395905_1018153 | |||
| 983 | Ga0395905_1041359 | |||
| 984 | Ga0395905_1163544 | |||
| 985 | Ga0395905_1380814 | |||
| 986 | Ga0395901_0000191 | |||
| 987 | Ga0395901_0022134 | |||
| 988 | Ga0395901_0219529 | |||
| 989 | Ga0395901_0259851 | |||
| 990 | Ga0395901_0714387 | |||
| 991 | Ga0395901_0788608 | |||
| 992 | Ga0395901_1755899 | |||
| 993 | Ga0439465_0093817 | |||
| 994 | Ga0439433_0034034 | |||
| 995 | Ga0439448_0000186 | |||
| 996 | Ga0439448_0019632 | |||
| 997 | Ga0439448_0184581 | |||
| 998 | Ga0439449_0054322 | |||
| 999 | Ga0439449_0141226 | |||
| 1000 | Ga0439450_004176 | |||
| 1001 | Ga0439450_004316 | |||
| 1002 | Ga0439450_011518 | |||
| 1003 | Ga0439455_0001253 | |||
| 1004 | Ga0439455_0012610 | |||
| 1005 | Ga0450904_002779 | |||
| 1006 | Ga0439458_0015566 | |||
| 1007 | Ga0439458_0060439 | |||
| 1008 | Ga0439458_0074181 | |||
| 1009 | Ga0439464_0198643 | |||
| 1010 | Ga0451577_0038734 | |||
| 1011 | Ga0466969_0060006 | |||
| 1012 | Ga0466969_0169923 | |||
| 1013 | Ga0466969_0281839 | |||
| 1014 | Ga0466972_0009118 | |||
| 1015 | Ga0466972_0100353 | |||
| 1016 | Ga0466972_0283026 | |||
| 1017 | Ga0466965_0001489 | |||
| 1018 | Ga0466965_0037013 | |||
| 1019 | Ga0466965_0038557 | |||
| 1020 | Ga0466965_0134162 | |||
| 1021 | Ga0466965_0158341 | |||
| 1022 | Ga0466966_0021307 | |||
| 1023 | Ga0466966_0087627 | |||
| 1024 | Ga0466966_0236949 | |||
| 1025 | Ga0466961_0095437 | |||
| 1026 | Ga0466961_0228824 | |||
| 1027 | Ga0466963_0531514 | |||
| 1028 | Ga0466963_0828084 | |||
| 1029 | Ga0466964_0000184 | |||
| 1030 | Ga0466964_0002194 | |||
| 1031 | Ga0466964_0111350 | |||
| 1032 | Ga0466964_0565148 | |||
| 1033 | Ga0453684_0128088 | |||
| 1034 | Ga0466971_0125281 | |||
| 1035 | Ga0466971_0218704 | |||
| 1036 | Ga0466971_0236287 | |||
| 1037 | Ga0466968_0004442 | |||
| 1038 | Ga0466968_0635161 | |||
| 1039 | Ga0466970_0127095 | |||
| 1040 | Ga0466970_0580313 | |||
| 1041 | Ga0466957_0000008 | |||
| 1042 | Ga0466957_0044716 | |||
| 1043 | Ga0466957_0299367 | |||
| 1044 | Ga0466957_0565656 | |||
| 1045 | Ga0466957_0668751 | |||
| 1046 | Ga0466957_1210777 | |||
| 1047 | Ga0466960_0537418 | |||
| 1048 | Ga0466959_0069731 | |||
| 1049 | Ga0466959_0210965 | |||
| 1050 | Ga0466959_0258773 | |||
| 1051 | Ga0466959_0311289 | |||
| 1052 | Ga0466959_0332376 | |||
| 1053 | Ga0451576_0239777 | |||
| 1054 | Ga0451576_0660295 | |||
| 1055 | Ga0466958_0007091 | |||
| 1056 | Ga0466958_0183129 | |||
| 1057 | Ga0466958_0287642 | |||
| 1058 | Ga0466958_0331948 | |||
| 1059 | Ga0466958_0369253 | |||
| 1060 | Ga0466967_0022249 | |||
| 1061 | Ga0466967_0139320 | |||
| 1062 | Ga0466967_0444013 | |||
| 1063 | Ga0495617_000001 | |||
| 1064 | Ga0495617_008419 | |||
| 1065 | Ga0495627_000035 | |||
| 1066 | Ga0495627_025272 | |||
| 1067 | Ga0495627_076288 | |||
| 1068 | Ga0495603_0016847 | |||
| 1069 | Ga0495603_0039719 | |||
| 1070 | Ga0495603_0253304 | |||
| 1071 | Ga0495590_0000029 | |||
| 1072 | Ga0495590_0000794 | |||
| 1073 | Ga0495590_0000886 | |||
| 1074 | Ga0495590_0003598 | |||
| 1075 | Ga0495590_0119052 | |||
| 1076 | Ga0495590_0173022 | |||
| 1077 | Ga0495590_0223533 | |||
| 1078 | Ga0495591_000359 | |||
| 1079 | Ga0495591_099776 | |||
| 1080 | Ga0495629_0011614 | |||
| 1081 | Ga0495629_0138582 | |||
| 1082 | Ga0495629_0175154 | |||
| 1083 | Ga0495629_0188599 | |||
| 1084 | Ga0495638_0005949 | |||
| 1085 | Ga0495638_0023751 | |||
| 1086 | Ga0495638_0026384 | |||
| 1087 | Ga0495638_0047389 | |||
| 1088 | Ga0495638_0221213 | |||
| 1089 | Ga0495653_0182734 | |||
| 1090 | Ga0495650_0013452 | |||
| 1091 | Ga0495650_0057271 | |||
| 1092 | Ga0495580_0026281 | |||
| 1093 | Ga0495580_0727967 | |||
| 1094 | Ga0495582_0008008 | |||
| 1095 | Ga0495582_0050892 | |||
| 1096 | Ga0495605_0000138 | |||
| 1097 | Ga0495605_0000304 | |||
| 1098 | Ga0495605_0013483 | |||
| 1099 | Ga0495605_0018512 | |||
| 1100 | Ga0495605_0022570 | |||
| 1101 | Ga0495605_0031571 | |||
| 1102 | Ga0495605_0032507 | |||
| 1103 | Ga0495605_0041338 | |||
| 1104 | Ga0495605_0072236 | |||
| 1105 | Ga0495605_0175226 | |||
| 1106 | Ga0495605_0197745 | |||
| 1107 | Ga0495605_0223409 | |||
| 1108 | Ga0495605_0429156 | |||
| 1109 | Ga0495639_0184090 | |||
| 1110 | Ga0495584_0000637 | |||
| 1111 | Ga0495584_0001166 | |||
| 1112 | Ga0495584_0001464 | |||
| 1113 | Ga0495584_0005183 | |||
| 1114 | Ga0495584_0010783 | |||
| 1115 | Ga0495584_0011336 | |||
| 1116 | Ga0495584_0014262 | |||
| 1117 | Ga0495584_0021529 | |||
| 1118 | Ga0495584_0068816 | |||
| 1119 | Ga0495584_0097820 | |||
| 1120 | Ga0495584_0112579 | |||
| 1121 | Ga0495584_0154619 | |||
| 1122 | Ga0495584_0155384 | |||
| 1123 | Ga0495584_0186036 | |||
| 1124 | Ga0495584_0214559 | |||
| 1125 | Ga0495584_0303552 | |||
| 1126 | Ga0495585_0001218 | |||
| 1127 | Ga0495585_0001766 | |||
| 1128 | Ga0495585_0003751 | |||
| 1129 | Ga0495585_0005220 | |||
| 1130 | Ga0495585_0014341 | |||
| 1131 | Ga0495585_0015018 | |||
| 1132 | Ga0495585_0035228 | |||
| 1133 | Ga0495585_0059062 | |||
| 1134 | Ga0495585_0070727 | |||
| 1135 | Ga0495585_0142506 | |||
| 1136 | Ga0495585_0193290 | |||
| 1137 | Ga0495594_0023243 | |||
| 1138 | Ga0495594_0023269 | |||
| 1139 | Ga0495594_0027973 | |||
| 1140 | Ga0495594_0045645 | |||
| 1141 | Ga0495594_0051030 | |||
| 1142 | Ga0495594_0064737 | |||
| 1143 | Ga0495594_0068935 | |||
| 1144 | Ga0495594_0086923 | |||
| 1145 | Ga0495594_0230591 | |||
| 1146 | Ga0495596_0001476 | |||
| 1147 | Ga0495596_0003276 | |||
| 1148 | Ga0495596_0005692 | |||
| 1149 | Ga0495596_0005906 | |||
| 1150 | Ga0495596_0013804 | |||
| 1151 | Ga0495596_0015723 | |||
| 1152 | Ga0495596_0018289 | |||
| 1153 | Ga0495596_0021565 | |||
| 1154 | Ga0495596_0031264 | |||
| 1155 | Ga0495596_0089397 | |||
| 1156 | Ga0495596_0210226 | |||
| 1157 | Ga0495607_0002300 | |||
| 1158 | Ga0495607_0007345 | |||
| 1159 | Ga0495607_0007423 | |||
| 1160 | Ga0495607_0012432 | |||
| 1161 | Ga0495607_0029774 | |||
| 1162 | Ga0495607_0096180 | |||
| 1163 | Ga0495607_0107124 | |||
| 1164 | Ga0495607_0192027 | |||
| 1165 | Ga0495607_0222739 | |||
| 1166 | Ga0495607_0266160 | |||
| 1167 | Ga0495607_0273898 | |||
| 1168 | Ga0495607_0461671 | |||
| 1169 | Ga0495583_0000274 | |||
| 1170 | Ga0495583_0000438 | |||
| 1171 | Ga0495583_0000647 | |||
| 1172 | Ga0495583_0000712 | |||
| 1173 | Ga0495583_0002574 | |||
| 1174 | Ga0495583_0003058 | |||
| 1175 | Ga0495583_0013015 | |||
| 1176 | Ga0495583_0016746 | |||
| 1177 | Ga0495583_0024876 | |||
| 1178 | Ga0495583_0035838 | |||
| 1179 | Ga0495583_0053760 | |||
| 1180 | Ga0495583_0077301 | |||
| 1181 | Ga0495583_0174621 | |||
| 1182 | Ga0495583_0178386 | |||
| 1183 | Ga0495606_0018070 | |||
| 1184 | Ga0495606_0018807 | |||
| 1185 | Ga0495606_0046052 | |||
| 1186 | Ga0495606_0070020 | |||
| 1187 | Ga0495606_0100279 | |||
| 1188 | Ga0495606_0174451 | |||
| 1189 | Ga0495606_0246401 | |||
| 1190 | Ga0495610_0001514 | |||
| 1191 | Ga0495610_0388553 | |||
| 1192 | Ga0495616_0000037 | |||
| 1193 | Ga0495616_0000494 | |||
| 1194 | Ga0495616_0000550 | |||
| 1195 | Ga0495616_0004947 | |||
| 1196 | Ga0495616_0020073 | |||
| 1197 | Ga0495616_0024924 | |||
| 1198 | Ga0495616_0029300 | |||
| 1199 | Ga0495616_0033927 | |||
| 1200 | Ga0495616_0048252 | |||
| 1201 | Ga0495616_0056202 | |||
| 1202 | Ga0495616_0069724 | |||
| 1203 | Ga0495616_0073397 | |||
| 1204 | Ga0495616_0093742 | |||
| 1205 | Ga0495616_0180203 | |||
| 1206 | Ga0495620_0040971 | |||
| 1207 | Ga0495630_0102234 | |||
| 1208 | Ga0495631_0000220 | |||
| 1209 | Ga0495631_0003343 | |||
| 1210 | Ga0495631_0003934 | |||
| 1211 | Ga0495631_0010003 | |||
| 1212 | Ga0495631_0010449 | |||
| 1213 | Ga0495631_0073698 | |||
| 1214 | Ga0495631_0080393 | |||
| 1215 | Ga0495631_0117366 | |||
| 1216 | Ga0495631_0155978 | |||
| 1217 | Ga0495631_0157434 | |||
| 1218 | Ga0495631_0165201 | |||
| 1219 | Ga0495631_0309068 | |||
| 1220 | Ga0495631_0446703 | |||
| 1221 | Ga0495632_0000126 | |||
| 1222 | Ga0495632_0000133 | |||
| 1223 | Ga0495632_0000462 | |||
| 1224 | Ga0495632_0000589 | |||
| 1225 | Ga0495632_0006635 | |||
| 1226 | Ga0495632_0008147 | |||
| 1227 | Ga0495632_0025836 | |||
| 1228 | Ga0495632_0494490 | |||
| 1229 | Ga0495637_0000002 | |||
| 1230 | Ga0495637_0037223 | |||
| 1231 | Ga0495643_0000096 | |||
| 1232 | Ga0495643_0000441 | |||
| 1233 | Ga0495643_0003747 | |||
| 1234 | Ga0495643_0010783 | |||
| 1235 | Ga0495643_0015130 | |||
| 1236 | Ga0495643_0042916 | |||
| 1237 | Ga0495643_0077750 | |||
| 1238 | Ga0495643_0113673 | |||
| 1239 | Ga0495643_0222455 | |||
| 1240 | Ga0495643_0239145 | |||
| 1241 | Ga0495643_0366748 | |||
| 1242 | Ga0495644_0002535 | |||
| 1243 | Ga0495644_0004349 | |||
| 1244 | Ga0495644_0005835 | |||
| 1245 | Ga0495644_0007208 | |||
| 1246 | Ga0495644_0020592 | |||
| 1247 | Ga0495644_0031789 | |||
| 1248 | Ga0495644_0041370 | |||
| 1249 | Ga0495644_0042582 | |||
| 1250 | Ga0495644_0172165 | |||
| 1251 | Ga0495648_0000252 | |||
| 1252 | Ga0495648_0003183 | |||
| 1253 | Ga0495648_0004850 | |||
| 1254 | Ga0495648_0019199 | |||
| 1255 | Ga0495648_0032963 | |||
| 1256 | Ga0495648_0063586 | |||
| 1257 | Ga0495648_0197353 | |||
| 1258 | Ga0495663_0009179 | |||
| 1259 | Ga0495663_0022331 | |||
| 1260 | Ga0495663_0039356 | |||
| 1261 | Ga0495663_0259179 | |||
| 1262 | Ga0495666_0001103 | |||
| 1263 | Ga0495666_0006315 | |||
| 1264 | Ga0495666_0007475 | |||
| 1265 | Ga0495666_0011864 | |||
| 1266 | Ga0495666_0172920 | |||
| 1267 | Ga0495666_0491965 | |||
| 1268 | Ga0495642_0000009 | |||
| 1269 | Ga0495642_0000274 | |||
| 1270 | Ga0495642_0001508 | |||
| 1271 | Ga0495642_0003767 | |||
| 1272 | Ga0495642_0009018 | |||
| 1273 | Ga0495642_0011068 | |||
| 1274 | Ga0495642_0020071 | |||
| 1275 | Ga0495642_0033717 | |||
| 1276 | Ga0495642_0063696 | |||
| 1277 | Ga0495642_0080264 | |||
| 1278 | Ga0495642_0093537 | |||
| 1279 | Ga0495642_0117536 | |||
| 1280 | Ga0495642_0168068 | |||
| 1281 | Ga0495642_0172700 | |||
| 1282 | Ga0495642_0196418 | |||
| 1283 | Ga0495642_0288882 | |||
| 1284 | Ga0495642_0333216 | |||
| 1285 | Ga0495652_0049112 | |||
| 1286 | Ga0495654_0003261 | |||
| 1287 | Ga0495654_0008701 | |||
| 1288 | Ga0495654_0089601 | |||
| 1289 | Ga0495654_0123433 | |||
| 1290 | Ga0495665_0013081 | |||
| 1291 | Ga0495665_0022112 | |||
| 1292 | Ga0495665_0026917 | |||
| 1293 | Ga0495665_0209764 | |||
| 1294 | Ga0495586_0019756 | |||
| 1295 | Ga0495586_0034639 | |||
| 1296 | Ga0495586_0039029 | |||
| 1297 | Ga0495586_0107520 | |||
| 1298 | Ga0495586_0125601 | |||
| 1299 | Ga0495587_0014374 | |||
| 1300 | Ga0495587_0256683 | |||
| 1301 | Ga0495587_0304147 | |||
| 1302 | Ga0495609_0000001 | |||
| 1303 | Ga0495609_0000848 | |||
| 1304 | Ga0495609_0004021 | |||
| 1305 | Ga0495609_0004505 | |||
| 1306 | Ga0495609_0009953 | |||
| 1307 | Ga0495609_0095372 | |||
| 1308 | Ga0495609_0133378 | |||
| 1309 | Ga0495609_0186265 | |||
| 1310 | Ga0495597_0000145 | |||
| 1311 | Ga0495597_0001301 | |||
| 1312 | Ga0495597_0001490 | |||
| 1313 | Ga0495597_0004896 | |||
| 1314 | Ga0495597_0022312 | |||
| 1315 | Ga0495597_0026189 | |||
| 1316 | Ga0495597_0056415 | |||
| 1317 | Ga0495597_0107304 | |||
| 1318 | Ga0495597_0118250 | |||
| 1319 | Ga0495597_0137192 | |||
| 1320 | Ga0495597_0226728 | |||
| 1321 | Ga0495597_0227259 | |||
| 1322 | Ga0495597_0394580 | |||
| 1323 | Ga0495622_0007211 | |||
| 1324 | Ga0495622_0029359 | |||
| 1325 | Ga0495622_0033944 | |||
| 1326 | Ga0495622_0078918 | |||
| 1327 | Ga0495622_0127395 | |||
| 1328 | Ga0495622_0148465 | |||
| 1329 | Ga0495633_0004643 | |||
| 1330 | Ga0495633_0012570 | |||
| 1331 | Ga0495633_0026725 | |||
| 1332 | Ga0495633_0058572 | |||
| 1333 | Ga0495633_0060591 | |||
| 1334 | Ga0495633_0131624 | |||
| 1335 | Ga0495633_0194349 | |||
| 1336 | Ga0495633_0398909 | |||
| 1337 | Ga0495667_0933971 | |||
| 1338 | Ga0495656_0001830 | |||
| 1339 | Ga0495656_0032636 | |||
| 1340 | Ga0495656_0032929 | |||
| 1341 | Ga0495656_0093500 | |||
| 1342 | Ga0495656_0209631 | |||
| 1343 | Ga0495656_0299261 | |||
| 1344 | Ga0495668_0000052 | |||
| 1345 | Ga0495668_0000555 | |||
| 1346 | Ga0495668_0002738 | |||
| 1347 | Ga0495668_0003177 | |||
| 1348 | Ga0495668_0035034 | |||
| 1349 | Ga0495668_0055876 | |||
| 1350 | Ga0495668_0056637 | |||
| 1351 | Ga0495668_0126925 | |||
| 1352 | Ga0495668_0710499 | |||
| 1353 | Ga0495634_0145785 | |||
| 1354 | Ga0495611_0000132 | |||
| 1355 | Ga0495611_0004043 | |||
| 1356 | Ga0495611_0019938 | |||
| 1357 | Ga0495611_0020126 | |||
| 1358 | Ga0495611_0024063 | |||
| 1359 | Ga0495611_0108148 | |||
| 1360 | Ga0495611_0124341 | |||
| 1361 | Ga0495611_0502860 | |||
| 1362 | Ga0495625_0013292 | |||
| 1363 | Ga0495625_0018354 | |||
| 1364 | Ga0495625_0032581 | |||
| 1365 | Ga0495625_0058042 | |||
| 1366 | Ga0495625_0087102 | |||
| 1367 | Ga0495625_0091639 | |||
| 1368 | Ga0495625_0116728 | |||
| 1369 | Ga0495625_0214665 | |||
| 1370 | Ga0495625_0568549 | |||
| 1371 | Ga0495635_0012836 | |||
| 1372 | Ga0495635_0525586 | |||
| 1373 | Ga0495659_0009819 | |||
| 1374 | Ga0495659_0085647 | |||
| 1375 | Ga0495661_0000090 | |||
| 1376 | Ga0495661_0000238 | |||
| 1377 | Ga0495661_0000659 | |||
| 1378 | Ga0495661_0001722 | |||
| 1379 | Ga0495661_0006126 | |||
| 1380 | Ga0495661_0015425 | |||
| 1381 | Ga0495661_0015852 | |||
| 1382 | Ga0495661_0024805 | |||
| 1383 | Ga0495661_0031177 | |||
| 1384 | Ga0495661_0038468 | |||
| 1385 | Ga0495661_0046547 | |||
| 1386 | Ga0495661_0101064 | |||
| 1387 | Ga0495661_0107749 | |||
| 1388 | Ga0495661_0114666 | |||
| 1389 | Ga0495661_0119746 | |||
| 1390 | Ga0495661_0190431 | |||
| 1391 | Ga0495661_0192147 | |||
| 1392 | Ga0495661_0234172 | |||
| 1393 | Ga0495661_0266876 | |||
| 1394 | Ga0495661_0292192 | |||
| 1395 | Ga0495661_0321778 | |||
| 1396 | Ga0495661_0329501 | |||
| 1397 | Ga0495588_0000095 | |||
| 1398 | Ga0495588_0005558 | |||
| 1399 | Ga0495588_0014176 | |||
| 1400 | Ga0495588_0016820 | |||
| 1401 | Ga0495588_0018574 | |||
| 1402 | Ga0495588_0037047 | |||
| 1403 | Ga0495588_0047477 | |||
| 1404 | Ga0495588_0084012 | |||
| 1405 | Ga0495588_0107368 | |||
| 1406 | Ga0495588_0164145 | |||
| 1407 | Ga0495588_0732617 | |||
| 1408 | Ga0495623_0045995 | |||
| 1409 | Ga0495623_0162198 | |||
| 1410 | Ga0495646_0055408 | |||
| 1411 | Ga0495669_0000040 | |||
| 1412 | Ga0495669_0000455 | |||
| 1413 | Ga0495669_0005288 | |||
| 1414 | Ga0495669_0024931 | |||
| 1415 | Ga0495669_0034771 | |||
| 1416 | Ga0495669_0117964 | |||
| 1417 | Ga0495613_0073804 | |||
| 1418 | Ga0495613_0121968 | |||
| 1419 | Ga0495624_0003630 | |||
| 1420 | Ga0495670_0009691 | |||
| 1421 | Ga0495670_0014390 | |||
| 1422 | Ga0495670_0017005 | |||
| 1423 | Ga0495670_0019637 | |||
| 1424 | Ga0495670_0027528 | |||
| 1425 | Ga0495670_0039411 | |||
| 1426 | Ga0495670_0046835 | |||
| 1427 | Ga0495670_0275451 | |||
| 1428 | Ga0495671_0000047 | |||
| 1429 | Ga0495671_0014119 | |||
| 1430 | Ga0495671_0058403 | |||
| 1431 | Ga0495671_0250338 | |||
| 1432 | Ga0495671_0369487 | |||
| 1433 | Ga0495649_0000174 | |||
| 1434 | Ga0495649_0000967 | |||
| 1435 | Ga0495649_0001231 | |||
| 1436 | Ga0495649_0035460 | |||
| 1437 | Ga0495649_0043922 | |||
| 1438 | Ga0495649_0059933 | |||
| 1439 | Ga0495649_0083568 | |||
| 1440 | Ga0495649_0135312 | |||
| 1441 | Ga0495649_0294316 | |||
| 1442 | Ga0495649_0576937 | |||
| 1443 | Ga0495649_0663660 | |||
| 1444 | Ga0495589_0000029 | |||
| 1445 | Ga0495589_0000301 | |||
| 1446 | Ga0495589_0000304 | |||
| 1447 | Ga0495589_0009270 | |||
| 1448 | Ga0495589_0014301 | |||
| 1449 | Ga0495589_0020283 | |||
| 1450 | Ga0495589_0029633 | |||
| 1451 | Ga0495589_0040774 | |||
| 1452 | Ga0495589_0051593 | |||
| 1453 | Ga0495589_0075839 | |||
| 1454 | Ga0495589_0353768 | |||
| 1455 | Ga0495600_0012572 | |||
| 1456 | Ga0495600_0042305 | |||
| 1457 | Ga0495600_0318329 | |||
| 1458 | Ga0495660_0000033 | |||
| 1459 | Ga0495660_0013473 | |||
| 1460 | Ga0495660_0025758 | |||
| 1461 | Ga0495660_0036080 | |||
| 1462 | Ga0495660_0101624 | |||
| 1463 | Ga0495660_0130091 | |||
| 1464 | Ga0495660_0130803 | |||
| 1465 | Ga0495581_0004022 | |||
| 1466 | Ga0495581_0089387 | |||
| 1467 | Ga0495581_0751714 | |||
| 1468 | Ga0495581_0758634 | |||
| 1469 | Ga0495604_0022852 | |||
| 1470 | Ga0495604_0107568 | |||
| 1471 | Ga0495604_0203356 | |||
| 1472 | Ga0495604_0232123 | |||
| 1473 | Ga0495604_0787372 | |||
| 1474 | Ga0495604_0941589 | |||
| 1475 | Ga0495636_0006935 | |||
| 1476 | Ga0495636_0011307 | |||
| 1477 | Ga0495636_0018843 | |||
| 1478 | Ga0495636_0515681 | |||
| 1479 | Ga0495636_0668743 | |||
| 1480 | Ga0495674_0011313 | |||
| 1481 | Ga0495674_1065826 | |||
| 1482 | Ga0495672_0000056 | |||
| 1483 | Ga0495672_0000430 | |||
| 1484 | Ga0495672_0000445 | |||
| 1485 | Ga0495672_0020997 | |||
| 1486 | Ga0495672_0090357 | |||
| 1487 | Ga0495672_0099651 | |||
| 1488 | Ga0495676_0000007 | |||
| 1489 | Ga0495676_0063289 | |||
| 1490 | Ga0495676_0102245 | |||
| 1491 | Ga0495676_0186013 | |||
| 1492 | Ga0495680_0028170 | |||
| 1493 | Ga0495680_0388751 | |||
| 1494 | Ga0495680_0416448 | |||
| 1495 | Ga0495680_0724277 | |||
| 1496 | Ga0495683_0000017 | |||
| 1497 | Ga0495683_0015398 | |||
| 1498 | Ga0495683_0052397 | |||
| 1499 | Ga0495683_0134522 | |||
| 1500 | Ga0495683_0151685 | |||
| 1501 | Ga0495683_0179324 | |||
| 1502 | Ga0495683_0194149 | |||
| 1503 | Ga0495683_0343348 | |||
| 1504 | Ga0495683_0400965 | |||
| 1505 | Ga0495687_000003 | |||
| 1506 | Ga0495687_000092 | |||
| 1507 | Ga0495687_000150 | |||
| 1508 | Ga0495687_000486 | |||
| 1509 | Ga0495687_001901 | |||
| 1510 | Ga0495675_0025745 | |||
| 1511 | Ga0495675_0026183 | |||
| 1512 | Ga0495675_0094011 | |||
| 1513 | Ga0495675_0212882 | |||
| 1514 | Ga0495675_0332687 | |||
| 1515 | Ga0495677_0000001 | |||
| 1516 | Ga0495677_0000587 | |||
| 1517 | Ga0495677_0000625 | |||
| 1518 | Ga0495677_0000627 | |||
| 1519 | Ga0495677_0006239 | |||
| 1520 | Ga0495677_0007115 | |||
| 1521 | Ga0495677_0009529 | |||
| 1522 | Ga0495677_0009698 | |||
| 1523 | Ga0495677_0014337 | |||
| 1524 | Ga0495677_0017547 | |||
| 1525 | Ga0495677_0037585 | |||
| 1526 | Ga0495677_0139513 | |||
| 1527 | Ga0495677_0216708 | |||
| 1528 | Ga0495677_0226879 | |||
| 1529 | Ga0495677_0317961 | |||
| 1530 | Ga0495677_0348849 | |||
| 1531 | Ga0495679_002314 | |||
| 1532 | Ga0495679_038989 | |||
| 1533 | Ga0495679_110372 | |||
| 1534 | Ga0495679_150082 | |||
| 1535 | Ga0495685_000557 | |||
| 1536 | Ga0495685_000751 | |||
| 1537 | Ga0495685_022602 | |||
| 1538 | Ga0495685_024552 | |||
| 1539 | Ga0495685_066711 | |||
| 1540 | Ga0495681_0000054 | |||
| 1541 | Ga0495681_0000080 | |||
| 1542 | Ga0495681_0001856 | |||
| 1543 | Ga0495681_0004546 | |||
| 1544 | Ga0495681_0017857 | |||
| 1545 | Ga0495681_0022659 | |||
| 1546 | Ga0495681_0030902 | |||
| 1547 | Ga0495681_0066130 | |||
| 1548 | Ga0495681_0075103 | |||
| 1549 | Ga0495681_0080279 | |||
| 1550 | Ga0495681_0102830 | |||
| 1551 | Ga0495686_0000235 | |||
| 1552 | Ga0495686_0000379 | |||
| 1553 | Ga0495686_0010909 | |||
| 1554 | Ga0495686_0022934 | |||
| 1555 | Ga0495686_0148160 | |||
| 1556 | Ga0495593_0003479 | |||
| 1557 | Ga0495593_0004899 | |||
| 1558 | Ga0495593_0233922 | |||
| 1559 | Ga0495593_0350823 | |||
| 1560 | Ga0495602_0085738 | |||
| 1561 | Ga0495602_0091336 | |||
| 1562 | Ga0495602_0793568 | |||
| 1563 | Ga0495614_0009386 | |||
| 1564 | Ga0495614_0015146 | |||
| 1565 | Ga0495614_0026416 | |||
| 1566 | Ga0495615_0021975 | |||
| 1567 | Ga0495615_0120860 | |||
| 1568 | Ga0495626_0000018 | |||
| 1569 | Ga0495626_0000159 | |||
| 1570 | Ga0495626_0001482 | |||
| 1571 | Ga0495626_0001668 | |||
| 1572 | Ga0495626_0006333 | |||
| 1573 | Ga0495626_0006510 | |||
| 1574 | Ga0495626_0010665 | |||
| 1575 | Ga0495626_0017336 | |||
| 1576 | Ga0495626_0018254 | |||
| 1577 | Ga0495626_0018279 | |||
| 1578 | Ga0495626_0027183 | |||
| 1579 | Ga0495626_0048931 | |||
| 1580 | Ga0495626_0049677 | |||
| 1581 | Ga0495626_0088640 | |||
| 1582 | Ga0495626_0097541 | |||
| 1583 | Ga0495626_0138234 | |||
| 1584 | Ga0495626_0163330 | |||
| 1585 | Ga0495626_0382166 | |||
| 1586 | Ga0496100_0107382 | |||
| 1587 | Ga0496101_0022528 | |||
| 1588 | Ga0496102_0000176 | |||
| 1589 | Ga0496102_0000323 | |||
| 1590 | Ga0496102_0027488 | |||
| 1591 | Ga0496102_0039918 | |||
| 1592 | Ga0496102_0069184 | |||
| 1593 | Ga0496102_0295605 | |||
| 1594 | Ga0496102_0427793 | |||
| 1595 | Ga0496103_0007567 | |||
| 1596 | Ga0496103_0020276 | |||
| 1597 | Ga0496103_0165919 | |||
| 1598 | Ga0496103_0778305 | |||
| 1599 | Ga0496104_0698306 | |||
| 1600 | Ga0496104_0885527 | |||
| 1601 | Ga0496105_0076559 | |||
| 1602 | Ga0496105_0419372 | |||
| 1603 | Ga0496106_0010178 | |||
| 1604 | Ga0496106_0660486 | |||
| 1605 | Ga0496106_0688783 | |||
| 1606 | Ga0496107_0142399 | |||
| 1607 | Ga0496108_0091304 | |||
| 1608 | Ga0496108_0701238 | |||
| 1609 | Ga0496109_0006989 | |||
| 1610 | Ga0496109_0207287 | |||
| 1611 | Ga0496109_1510193 | |||
| 1612 | Ga0496110_0000002 | |||
| 1613 | Ga0496110_0481475 | |||
| 1614 | Ga0496110_1160352 | |||
| 1615 | Ga0496110_1529012 | |||
| 1616 | Ga0496110_1683018 | |||
| 1617 | Ga0496111_0114257 | |||
| 1618 | Ga0496111_0361038 | |||
| 1619 | Ga0496112_0090323 | |||
| 1620 | Ga0496112_0946775 | |||
| 1621 | Ga0496113_0008610 | |||
| 1622 | Ga0496113_0022590 | |||
| 1623 | Ga0496113_0817167 | |||
| 1624 | Ga0496113_1005320 | |||
| 1625 | Ga0496114_0449565 | |||
| 1626 | Ga0496115_0000708 | |||
| 1627 | Ga0496115_0090803 | |||
| 1628 | Ga0496115_0092509 | |||
| 1629 | Ga0496115_0116460 | |||
| 1630 | Ga0496115_0175241 | |||
| 1631 | Ga0496115_0715214 | |||
| 1632 | Ga0496121_0226586 | |||
| 1633 | Ga0496122_0000299 | |||
| 1634 | Ga0496122_0008202 | |||
| 1635 | Ga0496122_0026288 | |||
| 1636 | Ga0496122_0372410 | |||
| 1637 | Ga0496123_0000783 | |||
| 1638 | Ga0496123_0004032 | |||
| 1639 | Ga0496123_0499482 | |||
| 1640 | Ga0496124_0004757 | |||
| 1641 | Ga0496124_0046616 | |||
| 1642 | Ga0496124_0089253 | |||
| 1643 | Ga0496124_0103257 | |||
| 1644 | Ga0496124_0112070 | |||
| 1645 | Ga0496124_0140982 | |||
| 1646 | Ga0496124_0471383 | |||
| 1647 | Ga0496125_0004760 | |||
| 1648 | Ga0496125_0036084 | |||
| 1649 | Ga0496126_0177411 | |||
| 1650 | Ga0501308_000151 | |||
| 1651 | Ga0501304_002999 | |||
| 1652 | Ga0495678_000048 | |||
| 1653 | Ga0495678_000050 | |||
| 1654 | Ga0495678_000122 | |||
| 1655 | Ga0495678_000257 | |||
| 1656 | Ga0495682_0000144 | |||
| 1657 | Ga0495682_0001333 | |||
| 1658 | Ga0495682_0008506 | |||
| 1659 | Ga0495682_0021606 | |||
| 1660 | Ga0501297_039683 | |||
| 1661 | Ga0501313_000568 | |||
| 1662 | Ga0501315_000954 | |||
| 1663 | Ga0501315_026364 | |||
| 1664 | Ga0501034_0168575 | |||
| 1665 | Ga0501034_1195480 | |||
| 1666 | Ga0501036_0215315 | |||
| 1667 | Ga0501047_0560030 | |||
| 1668 | Ga0501206_012442 | |||
| 1669 | Ga0501217_235619 | |||
| 1670 | Ga0501222_005723 | |||
| 1671 | Ga0501230_042323 | |||
| 1672 | Ga0501236_069521 | |||
| 1673 | Ga0501257_197828 | |||
| 1674 | Ga0501221_083214 | |||
| 1675 | Ga0501279_077020 | |||
| 1676 | Ga0501035_0000613 | |||
| 1677 | Ga0501204_040648 | |||
| 1678 | Ga0501226_035316 | |||
| 1679 | Ga0587084_014879 | |||
| 1680 | Ga0587066_022117 | |||
| 1681 | Ga0587070_031612 | |||
| 1682 | Ga0587070_044477 | |||
| 1683 | Ga0587080_008070 | |||
| 1684 | Ga0587082_001204 | |||
| 1685 | Ga0587082_035639 | |||
| 1686 | Ga0587083_0008376 | |||
| 1687 | Ga0587088_002006 | |||
| 1688 | Ga0587090_020398 | |||
| 1689 | Ga0587090_023613 | |||
| 1690 | Ga0587098_005248 | |||
| 1691 | Ga0587106_000728 | |||
| 1692 | Ga0587125_004684 | |||
| 1693 | Ga0587101_006472 | |||
| 1694 | Ga0587067_011005 | |||
| 1695 | Ga0587068_000200 | |||
| 1696 | Ga0587069_001016 | |||
| 1697 | Ga0587072_001324 | |||
| 1698 | Ga0587076_018910 | |||
| 1699 | Ga0587079_000185 | |||
| 1700 | Ga0587079_039651 | |||
| 1701 | Ga0587105_004475 | |||
| 1702 | Ga0587107_004301 | |||
| 1703 | Ga0587071_007542 | |||
| 1704 | Ga0587111_0029589 | |||
| 1705 | Ga0466962_0029931 | |||
| 1706 | Ga0466962_0261738 | |||
| 1707 | Ga0466962_0406063 | |||
| 1708 | Ga0466962_0500924 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3o2e-assembly1.cif.gz_A | crystal structure of a bol-like protein from babesia bovis | 0.9413 | 11 | 94 |
| 4pui-assembly2.cif.gz_B | bola domain of sufe1 from arabidopsis thaliana | 0.9338 | 10 | 95 |
| 4pui-assembly1.cif.gz_A | bola domain of sufe1 from arabidopsis thaliana | 0.9263 | 10 | 95 |
| 4pug-assembly2.cif.gz_B | bola1 from arabidopsis thaliana | 0.9212 | 10 | 96 |
| 2mma-assembly1.cif.gz_B | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.8866 | 11 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3o2eA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9413 | 11 | 94 | 3.30.300.90 |
| af_Q3E793_13_109_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9319 | 12 | 94 | 3.30.300.90 |
| af_Q5AKW1_24_116_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9317 | 9 | 95 | 3.30.300.90 |
| 4puiA01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9273 | 9 | 95 | 3.30.300.90 |
| af_B6SIB6_2_91_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.921 | 12 | 96 | 3.30.300.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A5LGT2-F1-model_v4 | deleted | 0.9992 | 9 | 96 |
|
| AF-A0A7Z2W095-F1-model_v4 | BolA family transcriptional regulator | 0.9986 | 7 | 96 |
GO:0016226
|
| AF-A0A3M1AK59-F1-model_v4 | BolA family transcriptional regulator | 0.9929 | 8 | 90 |
GO:0005829
GO:0006351 |
| AF-A0A346N0Y8-F1-model_v4 | BolA family transcriptional regulator | 0.9889 | 10 | 94 |
GO:0016226
|
| AF-B5JWN7-F1-model_v4 | Morphogene BolA protein | 0.9888 | 9 | 94 |
GO:0016226
|