F483595

General Info

Members Datasets Scaffolds Average Seq Length
854 254 1708 93

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_000411|Ga0495687_000411_26888_27217
Length 109
Sequence MSLDTNMPPQTDARVERIRSLLQAALAPSQLEVGDDSHLHVGHAGAASGGGHYSVKIVAERFEGLRLVMRHRLVYDAVQGMMHTDIHALAITALAPSEVATAHPSGSLK

Samples

Sample ID Description Type Environment
1 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
40 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
70 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
71 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
81 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
82 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
83 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
84 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
85 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
86 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
87 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
88 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
216 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
222 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
223 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
224 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
225 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
226 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
227 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
228 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
231 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
232 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.25
Metatranscriptomes 3.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 5.39
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495687_000411 3300047443 Bacteria 53055
2 rootH2_10189217 3300003320 Bacteria 1591
3 rootL2_10011198 3300003322 Bacteria 1142
4 Ga0007410J51695_1017414 3300003574 Bacteria 2296
5 Ga0055525_1000008 3300003759 Bacteria 604287
6 Ga0055542_1007860 3300003762 Bacteria 2126
7 Ga0065165_1002057 3300005262 Bacteria 18601
8 Ga0065165_1021713 3300005262 Bacteria 2222
9 Ga0065714_10132036 3300005288 Bacteria 1223
10 Ga0070658_10091401 3300005327 Bacteria 2508
11 Ga0070658_10173858 3300005327 Bacteria 1810
12 Ga0070658_10959788 3300005327 Bacteria 743
13 Ga0070658_11081712 3300005327 Bacteria 697
14 Ga0070670_101336589 3300005331 Bacteria 656
15 Ga0070682_100568529 3300005337 Bacteria 890
16 Ga0070660_100265035 3300005339 Bacteria 1403
17 Ga0070660_101290600 3300005339 Bacteria 619
18 Ga0070660_101572380 3300005339 Bacteria 559
19 Ga0070661_100103074 3300005344 Bacteria 2125
20 Ga0070659_100343872 3300005366 Bacteria 1250
21 Ga0070667_100774409 3300005367 Bacteria 890
22 Ga0070663_100593245 3300005455 Bacteria 931
23 Ga0070662_100130144 3300005457 Bacteria 1939
24 Ga0070662_100627296 3300005457 Bacteria 905
25 Ga0068867_100791149 3300005459 Bacteria 845
26 Ga0068853_100228345 3300005539 Bacteria 1702
27 Ga0070672_100128483 3300005543 Bacteria 2081
28 Ga0068855_100071413 3300005563 Bacteria 4037
29 Ga0068855_100556760 3300005563 Bacteria 1241
30 Ga0070664_100916519 3300005564 Bacteria 822
31 Ga0070664_101155930 3300005564 Bacteria 730
32 Ga0068852_100046601 3300005616 Bacteria 3694
33 Ga0068866_10224569 3300005718 Bacteria 1135
34 Ga0105244_10376530 3300009036 Bacteria 654
35 Ga0105245_10192652 3300009098 Bacteria 1953
36 Ga0105243_10050716 3300009148 Bacteria 3280
37 Ga0105241_10057928 3300009174 Bacteria 2974
38 Ga0105242_10009383 3300009176 Bacteria 7508
39 Ga0105237_10052079 3300009545 Bacteria 4110
40 Ga0105238_10525231 3300009551 Bacteria 1186
41 Ga0105239_10399324 3300010375 Bacteria 1556
42 Ga0105239_12887261 3300010375 Bacteria 561
43 Ga0105246_10919948 3300011119 Bacteria 786
44 Ga0157371_10000149 3300013102 Bacteria 101593
45 Ga0157370_10464208 3300013104 Bacteria 1164
46 Ga0157369_11008966 3300013105 Bacteria 852
47 Ga0157369_11210192 3300013105 Bacteria 771
48 Ga0157374_10475745 3300013296 Bacteria 1252
49 Ga0157374_12019076 3300013296 Bacteria 603
50 Ga0157372_10135257 3300013307 Bacteria 2838
51 Ga0157372_11023564 3300013307 Bacteria 956
52 Ga0157372_11069717 3300013307 Bacteria 934
53 Ga0157372_11831313 3300013307 Bacteria 698
54 Ga0182006_1073772 3300015261 Bacteria 1259
55 Ga0182007_10068111 3300015262 Bacteria 1166
56 Ga0182007_10206179 3300015262 Bacteria 689
57 Ga0163161_10759428 3300017792 Bacteria 812
58 Ga0209563_100003 3300025230 Bacteria 1932942
59 Ga0209677_106012 3300025253 Bacteria 2997
60 Ga0209148_1000403 3300025254 Bacteria 50194
61 Ga0207642_10989157 3300025899 Bacteria 541
62 Ga0207705_10005671 3300025909 Bacteria 9320
63 Ga0207705_10079021 3300025909 Bacteria 2395
64 Ga0207654_10116350 3300025911 Bacteria 1671
65 Ga0207671_10164551 3300025914 Bacteria 1719
66 Ga0207657_10028684 3300025919 Bacteria 5072
67 Ga0207657_10187015 3300025919 Bacteria 1672
68 Ga0207657_10331810 3300025919 Bacteria 1201
69 Ga0207649_10077342 3300025920 Bacteria 2144
70 Ga0207649_10289115 3300025920 Bacteria 1195
71 Ga0207694_10223810 3300025924 Bacteria 1535
72 Ga0207687_10412997 3300025927 Bacteria 1112
73 Ga0207690_10109813 3300025932 Bacteria 1984
74 Ga0207690_10595403 3300025932 Bacteria 902
75 Ga0207690_11564661 3300025932 Bacteria 551
76 Ga0207706_10113901 3300025933 Bacteria 2379
77 Ga0207706_10121471 3300025933 Bacteria 2297
78 Ga0207686_10057523 3300025934 Bacteria 2448
79 Ga0207709_10080665 3300025935 Bacteria 2096
80 Ga0207704_10203948 3300025938 Bacteria 1450
81 Ga0207661_10819702 3300025944 Bacteria 857
82 Ga0207679_10074584 3300025945 Bacteria 2571
83 Ga0207679_10305288 3300025945 Bacteria 1373
84 Ga0207667_10012297 3300025949 Bacteria 9875
85 Ga0207667_11853012 3300025949 Bacteria 566
86 Ga0207640_12096901 3300025981 Bacteria 513
87 Ga0207658_10610504 3300025986 Bacteria 981
88 Ga0207639_10741030 3300026041 Bacteria 913
89 Ga0207678_10058990 3300026067 Bacteria 3302
90 Ga0207702_10299780 3300026078 Bacteria 1525
91 Ga0207648_10124022 3300026089 Bacteria 2272
92 Ga0207674_11593918 3300026116 Bacteria 621
93 Ga0207698_10395425 3300026142 Bacteria 1319
94 Ga0316177_1087656 3300030731 Bacteria 1685
95 Ga0316180_1076152 3300030736 Bacteria 2265
96 Ga0316182_1045793 3300030745 Bacteria 1924
97 Ga0316182_1068880 3300030745 Bacteria 552
98 Ga0316182_1395676 3300030745 Bacteria 1685
99 Ga0307408_100749939 3300031548 Bacteria 882
100 Ga0307414_10038809 3300032004 Bacteria 3201
101 Ga0373934_0031476 3300035086 Bacteria 2077
102 Ga0395899_0000012 3300037312 Bacteria 517561
103 Ga0395899_0044141 3300037312 Bacteria 3322
104 Ga0395899_0071787 3300037312 Bacteria 2533
105 Ga0395899_0236117 3300037312 Bacteria 1260
106 Ga0395899_0248109 3300037312 Bacteria 1222
107 Ga0395899_0471143 3300037312 Bacteria 819
108 Ga0395900_0000028 3300037418 Bacteria 285042
109 Ga0395900_0177724 3300037418 Bacteria 2164
110 Ga0395900_0192545 3300037418 Bacteria 2067
111 Ga0395900_0206530 3300037418 Bacteria 1985
112 Ga0395900_0249315 3300037418 Bacteria 1777
113 Ga0395900_0315765 3300037418 Bacteria 1544
114 Ga0395900_0392115 3300037418 Bacteria 1354
115 Ga0395900_0526281 3300037418 Bacteria 1129
116 Ga0395900_0745766 3300037418 Bacteria 910
117 Ga0395900_0995271 3300037418 Bacteria 758
118 Ga0395898_0037410 3300037466 Bacteria 4814
119 Ga0395898_0052983 3300037466 Bacteria 3963
120 Ga0395898_0150061 3300037466 Bacteria 2230
121 Ga0395898_0620310 3300037466 Bacteria 1024
122 Ga0395898_1437851 3300037466 Bacteria 616
123 Ga0395898_1554679 3300037466 Bacteria 586
124 Ga0395905_0063674 3300037471 Bacteria 3450
125 Ga0395905_0144826 3300037471 Bacteria 2235
126 Ga0395905_0277986 3300037471 Bacteria 1560
127 Ga0395905_0341564 3300037471 Bacteria 1388
128 Ga0395905_1018153 3300037471 Bacteria 731
129 Ga0395905_1041359 3300037471 Bacteria 721
130 Ga0395905_1163544 3300037471 Bacteria 675
131 Ga0395905_1380814 3300037471 Bacteria 608
132 Ga0395901_0000191 3300038443 Bacteria 78454
133 Ga0395901_0022134 3300038443 Bacteria 6512
134 Ga0395901_0219529 3300038443 Bacteria 1987
135 Ga0395901_0259851 3300038443 Bacteria 1807
136 Ga0395901_0714387 3300038443 Bacteria 998
137 Ga0395901_0788608 3300038443 Bacteria 940
138 Ga0395901_1755899 3300038443 Bacteria 570
139 Ga0439465_0093817 3300041413 Bacteria 1030
140 Ga0439433_0034034 3300041999 Bacteria 1172
141 Ga0439448_0000186 3300042005 Bacteria 12766
142 Ga0439448_0019632 3300042005 Bacteria 2083
143 Ga0439448_0184581 3300042005 Bacteria 729
144 Ga0439449_0054322 3300042007 Bacteria 1480
145 Ga0439449_0141226 3300042007 Bacteria 896
146 Ga0439450_004176 3300042008 Bacteria 2449
147 Ga0439450_004316 3300042008 Bacteria 2419
148 Ga0439450_011518 3300042008 Bacteria 1734
149 Ga0439455_0001253 3300042012 Bacteria 4163
150 Ga0439455_0012610 3300042012 Bacteria 1902
151 Ga0450904_002779 3300042139 Bacteria 1999
152 Ga0439458_0015566 3300042157 Bacteria 1724
153 Ga0439458_0060439 3300042157 Bacteria 945
154 Ga0439458_0074181 3300042157 Bacteria 862
155 Ga0439464_0198643 3300042439 Bacteria 639
156 Ga0451577_0038734 3300042876 Bacteria 4286
157 Ga0466969_0060006 3300044656 Bacteria 1849
158 Ga0466969_0169923 3300044656 Bacteria 1000
159 Ga0466969_0281839 3300044656 Bacteria 752
160 Ga0466972_0009118 3300044658 Bacteria 4982
161 Ga0466972_0100353 3300044658 Bacteria 1370
162 Ga0466972_0283026 3300044658 Bacteria 775
163 Ga0466965_0001489 3300044683 Bacteria 9480
164 Ga0466965_0037013 3300044683 Bacteria 2395
165 Ga0466965_0038557 3300044683 Bacteria 2347
166 Ga0466965_0134162 3300044683 Bacteria 1285
167 Ga0466965_0158341 3300044683 Bacteria 1186
168 Ga0466966_0021307 3300044684 Bacteria 4256
169 Ga0466966_0087627 3300044684 Bacteria 1934
170 Ga0466966_0236949 3300044684 Bacteria 1100
171 Ga0466961_0095437 3300044693 Bacteria 1875
172 Ga0466961_0228824 3300044693 Bacteria 1144
173 Ga0466963_0531514 3300044694 Bacteria 830
174 Ga0466963_0828084 3300044694 Bacteria 653
175 Ga0466964_0000184 3300044706 Bacteria 17322
176 Ga0466964_0002194 3300044706 Bacteria 6906
177 Ga0466964_0111350 3300044706 Bacteria 1221
178 Ga0466964_0565148 3300044706 Bacteria 619
179 Ga0453684_0128088 3300044712 Bacteria 3051
180 Ga0466971_0125281 3300044719 Bacteria 1190
181 Ga0466971_0218704 3300044719 Bacteria 902
182 Ga0466971_0236287 3300044719 Bacteria 868
183 Ga0466968_0004442 3300044735 Bacteria 5247
184 Ga0466968_0635161 3300044735 Bacteria 541
185 Ga0466970_0127095 3300044765 Bacteria 1398
186 Ga0466970_0580313 3300044765 Bacteria 649
187 Ga0466957_0000008 3300044842 Bacteria 80479
188 Ga0466957_0044716 3300044842 Bacteria 2684
189 Ga0466957_0299367 3300044842 Bacteria 1080
190 Ga0466957_0565656 3300044842 Bacteria 793
191 Ga0466957_0668751 3300044842 Bacteria 731
192 Ga0466957_1210777 3300044842 Bacteria 546
193 Ga0466960_0537418 3300044901 Bacteria 688
194 Ga0466959_0069731 3300045049 Bacteria 2546
195 Ga0466959_0210965 3300045049 Bacteria 1349
196 Ga0466959_0258773 3300045049 Bacteria 1198
197 Ga0466959_0311289 3300045049 Bacteria 1077
198 Ga0466959_0332376 3300045049 Bacteria 1037
199 Ga0451576_0239777 3300045051 Bacteria 1894
200 Ga0451576_0660295 3300045051 Bacteria 1099
201 Ga0466958_0007091 3300045836 Bacteria 6137
202 Ga0466958_0183129 3300045836 Bacteria 1329
203 Ga0466958_0287642 3300045836 Bacteria 1054
204 Ga0466958_0331948 3300045836 Bacteria 978
205 Ga0466958_0369253 3300045836 Bacteria 924
206 Ga0466967_0022249 3300045976 Bacteria 5168
207 Ga0466967_0139320 3300045976 Bacteria 2258
208 Ga0466967_0444013 3300045976 Bacteria 1267
209 Ga0495617_000001 3300046452 Bacteria 877032
210 Ga0495617_008419 3300046452 Bacteria 3554
211 Ga0495627_000035 3300046453 Bacteria 213698
212 Ga0495627_025272 3300046453 Bacteria 1927
213 Ga0495627_076288 3300046453 Bacteria 975
214 Ga0495603_0016847 3300046455 Bacteria 4422
215 Ga0495603_0039719 3300046455 Bacteria 2818
216 Ga0495603_0253304 3300046455 Bacteria 1013
217 Ga0495590_0000029 3300046457 Bacteria 146662
218 Ga0495590_0000794 3300046457 Bacteria 14382
219 Ga0495590_0000886 3300046457 Bacteria 13425
220 Ga0495590_0003598 3300046457 Bacteria 6306
221 Ga0495590_0119052 3300046457 Bacteria 946
222 Ga0495590_0173022 3300046457 Bacteria 787
223 Ga0495590_0223533 3300046457 Bacteria 696
224 Ga0495591_000359 3300046458 Bacteria 39622
225 Ga0495591_099776 3300046458 Bacteria 721
226 Ga0495629_0011614 3300046459 Bacteria 6394
227 Ga0495629_0138582 3300046459 Bacteria 1693
228 Ga0495629_0175154 3300046459 Bacteria 1488
229 Ga0495629_0188599 3300046459 Bacteria 1427
230 Ga0495638_0005949 3300046460 Bacteria 8954
231 Ga0495638_0023751 3300046460 Bacteria 4005
232 Ga0495638_0026384 3300046460 Bacteria 3764
233 Ga0495638_0047389 3300046460 Bacteria 2694
234 Ga0495638_0221213 3300046460 Bacteria 1058
235 Ga0495653_0182734 3300046463 Bacteria 1437
236 Ga0495650_0013452 3300046471 Bacteria 4324
237 Ga0495650_0057271 3300046471 Bacteria 1578
238 Ga0495580_0026281 3300046472 Bacteria 4245
239 Ga0495580_0727967 3300046472 Bacteria 647
240 Ga0495582_0008008 3300046473 Bacteria 5833
241 Ga0495582_0050892 3300046473 Bacteria 2283
242 Ga0495605_0000138 3300046474 Bacteria 94241
243 Ga0495605_0000304 3300046474 Bacteria 52709
244 Ga0495605_0013483 3300046474 Bacteria 4500
245 Ga0495605_0018512 3300046474 Bacteria 3732
246 Ga0495605_0022570 3300046474 Bacteria 3321
247 Ga0495605_0031571 3300046474 Bacteria 2705
248 Ga0495605_0032507 3300046474 Bacteria 2656
249 Ga0495605_0041338 3300046474 Bacteria 2296
250 Ga0495605_0072236 3300046474 Bacteria 1627
251 Ga0495605_0175226 3300046474 Bacteria 946
252 Ga0495605_0197745 3300046474 Bacteria 877
253 Ga0495605_0223409 3300046474 Bacteria 813
254 Ga0495605_0429156 3300046474 Bacteria 546
255 Ga0495639_0184090 3300046475 Bacteria 1018
256 Ga0495584_0000637 3300046491 Bacteria 23364
257 Ga0495584_0001166 3300046491 Bacteria 16163
258 Ga0495584_0001464 3300046491 Bacteria 14181
259 Ga0495584_0005183 3300046491 Bacteria 6920
260 Ga0495584_0010783 3300046491 Bacteria 4692
261 Ga0495584_0011336 3300046491 Bacteria 4565
262 Ga0495584_0014262 3300046491 Bacteria 4048
263 Ga0495584_0021529 3300046491 Bacteria 3274
264 Ga0495584_0068816 3300046491 Bacteria 1778
265 Ga0495584_0097820 3300046491 Bacteria 1482
266 Ga0495584_0112579 3300046491 Bacteria 1377
267 Ga0495584_0154619 3300046491 Bacteria 1165
268 Ga0495584_0155384 3300046491 Bacteria 1162
269 Ga0495584_0186036 3300046491 Bacteria 1055
270 Ga0495584_0214559 3300046491 Bacteria 978
271 Ga0495584_0303552 3300046491 Bacteria 811
272 Ga0495585_0001218 3300046492 Bacteria 20845
273 Ga0495585_0001766 3300046492 Bacteria 16412
274 Ga0495585_0003751 3300046492 Bacteria 10141
275 Ga0495585_0005220 3300046492 Bacteria 8233
276 Ga0495585_0014341 3300046492 Bacteria 4619
277 Ga0495585_0015018 3300046492 Bacteria 4502
278 Ga0495585_0035228 3300046492 Bacteria 2830
279 Ga0495585_0059062 3300046492 Bacteria 2114
280 Ga0495585_0070727 3300046492 Bacteria 1903
281 Ga0495585_0142506 3300046492 Bacteria 1254
282 Ga0495585_0193290 3300046492 Bacteria 1040
283 Ga0495594_0023243 3300046499 Bacteria 3320
284 Ga0495594_0023269 3300046499 Bacteria 3318
285 Ga0495594_0027973 3300046499 Bacteria 3040
286 Ga0495594_0045645 3300046499 Bacteria 2405
287 Ga0495594_0051030 3300046499 Bacteria 2276
288 Ga0495594_0064737 3300046499 Bacteria 2027
289 Ga0495594_0068935 3300046499 Bacteria 1964
290 Ga0495594_0086923 3300046499 Bacteria 1749
291 Ga0495594_0230591 3300046499 Bacteria 1055
292 Ga0495596_0001476 3300046500 Bacteria 13448
293 Ga0495596_0003276 3300046500 Bacteria 8269
294 Ga0495596_0005692 3300046500 Bacteria 5850
295 Ga0495596_0005906 3300046500 Bacteria 5712
296 Ga0495596_0013804 3300046500 Bacteria 3416
297 Ga0495596_0015723 3300046500 Bacteria 3160
298 Ga0495596_0018289 3300046500 Bacteria 2889
299 Ga0495596_0021565 3300046500 Bacteria 2628
300 Ga0495596_0031264 3300046500 Bacteria 2127
301 Ga0495596_0089397 3300046500 Bacteria 1195
302 Ga0495596_0210226 3300046500 Bacteria 755
303 Ga0495607_0002300 3300046501 Bacteria 15698
304 Ga0495607_0007345 3300046501 Bacteria 7634
305 Ga0495607_0007423 3300046501 Bacteria 7588
306 Ga0495607_0012432 3300046501 Bacteria 5618
307 Ga0495607_0029774 3300046501 Bacteria 3358
308 Ga0495607_0096180 3300046501 Bacteria 1595
309 Ga0495607_0107124 3300046501 Bacteria 1487
310 Ga0495607_0192027 3300046501 Bacteria 1016
311 Ga0495607_0222739 3300046501 Bacteria 921
312 Ga0495607_0266160 3300046501 Bacteria 819
313 Ga0495607_0273898 3300046501 Bacteria 803
314 Ga0495607_0461671 3300046501 Bacteria 568
315 Ga0495583_0000274 3300046506 Bacteria 83322
316 Ga0495583_0000438 3300046506 Bacteria 62697
317 Ga0495583_0000647 3300046506 Bacteria 45977
318 Ga0495583_0000712 3300046506 Bacteria 42668
319 Ga0495583_0002574 3300046506 Bacteria 15237
320 Ga0495583_0003058 3300046506 Bacteria 13285
321 Ga0495583_0013015 3300046506 Bacteria 4670
322 Ga0495583_0016746 3300046506 Bacteria 3925
323 Ga0495583_0024876 3300046506 Bacteria 3000
324 Ga0495583_0035838 3300046506 Bacteria 2364
325 Ga0495583_0053760 3300046506 Bacteria 1826
326 Ga0495583_0077301 3300046506 Bacteria 1452
327 Ga0495583_0174621 3300046506 Bacteria 881
328 Ga0495583_0178386 3300046506 Bacteria 870
329 Ga0495606_0018070 3300046507 Bacteria 5302
330 Ga0495606_0018807 3300046507 Bacteria 5168
331 Ga0495606_0046052 3300046507 Bacteria 2885
332 Ga0495606_0070020 3300046507 Bacteria 2214
333 Ga0495606_0100279 3300046507 Bacteria 1764
334 Ga0495606_0174451 3300046507 Bacteria 1244
335 Ga0495606_0246401 3300046507 Bacteria 993
336 Ga0495610_0001514 3300046512 Bacteria 20445
337 Ga0495610_0388553 3300046512 Bacteria 517
338 Ga0495616_0000037 3300046513 Bacteria 123624
339 Ga0495616_0000494 3300046513 Bacteria 30040
340 Ga0495616_0000550 3300046513 Bacteria 28322
341 Ga0495616_0004947 3300046513 Bacteria 8321
342 Ga0495616_0020073 3300046513 Bacteria 3640
343 Ga0495616_0024924 3300046513 Bacteria 3202
344 Ga0495616_0029300 3300046513 Bacteria 2908
345 Ga0495616_0033927 3300046513 Bacteria 2654
346 Ga0495616_0048252 3300046513 Bacteria 2140
347 Ga0495616_0056202 3300046513 Bacteria 1944
348 Ga0495616_0069724 3300046513 Bacteria 1703
349 Ga0495616_0073397 3300046513 Bacteria 1651
350 Ga0495616_0093742 3300046513 Bacteria 1418
351 Ga0495616_0180203 3300046513 Bacteria 939
352 Ga0495620_0040971 3300046515 Bacteria 2034
353 Ga0495630_0102234 3300046517 Bacteria 2168
354 Ga0495631_0000220 3300046518 Bacteria 39150
355 Ga0495631_0003343 3300046518 Bacteria 8800
356 Ga0495631_0003934 3300046518 Bacteria 8026
357 Ga0495631_0010003 3300046518 Bacteria 4713
358 Ga0495631_0010449 3300046518 Bacteria 4590
359 Ga0495631_0073698 3300046518 Bacteria 1474
360 Ga0495631_0080393 3300046518 Bacteria 1406
361 Ga0495631_0117366 3300046518 Bacteria 1144
362 Ga0495631_0155978 3300046518 Bacteria 979
363 Ga0495631_0157434 3300046518 Bacteria 974
364 Ga0495631_0165201 3300046518 Bacteria 950
365 Ga0495631_0309068 3300046518 Bacteria 672
366 Ga0495631_0446703 3300046518 Bacteria 550
367 Ga0495632_0000126 3300046519 Bacteria 77591
368 Ga0495632_0000133 3300046519 Bacteria 75692
369 Ga0495632_0000462 3300046519 Bacteria 38625
370 Ga0495632_0000589 3300046519 Bacteria 33727
371 Ga0495632_0006635 3300046519 Bacteria 7404
372 Ga0495632_0008147 3300046519 Bacteria 6479
373 Ga0495632_0025836 3300046519 Bacteria 3100
374 Ga0495632_0494490 3300046519 Bacteria 528
375 Ga0495637_0000002 3300046520 Bacteria 629280
376 Ga0495637_0037223 3300046520 Bacteria 2114
377 Ga0495643_0000096 3300046522 Bacteria 146041
378 Ga0495643_0000441 3300046522 Bacteria 53599
379 Ga0495643_0003747 3300046522 Bacteria 10995
380 Ga0495643_0010783 3300046522 Bacteria 5606
381 Ga0495643_0015130 3300046522 Bacteria 4571
382 Ga0495643_0042916 3300046522 Bacteria 2462
383 Ga0495643_0077750 3300046522 Bacteria 1733
384 Ga0495643_0113673 3300046522 Bacteria 1374
385 Ga0495643_0222455 3300046522 Bacteria 894
386 Ga0495643_0239145 3300046522 Bacteria 852
387 Ga0495643_0366748 3300046522 Bacteria 641
388 Ga0495644_0002535 3300046523 Bacteria 7276
389 Ga0495644_0004349 3300046523 Bacteria 5566
390 Ga0495644_0005835 3300046523 Bacteria 4809
391 Ga0495644_0007208 3300046523 Bacteria 4296
392 Ga0495644_0020592 3300046523 Bacteria 2516
393 Ga0495644_0031789 3300046523 Bacteria 1995
394 Ga0495644_0041370 3300046523 Bacteria 1735
395 Ga0495644_0042582 3300046523 Bacteria 1710
396 Ga0495644_0172165 3300046523 Bacteria 831
397 Ga0495648_0000252 3300046524 Bacteria 60717
398 Ga0495648_0003183 3300046524 Bacteria 14608
399 Ga0495648_0004850 3300046524 Bacteria 11355
400 Ga0495648_0019199 3300046524 Bacteria 4816
401 Ga0495648_0032963 3300046524 Bacteria 3391
402 Ga0495648_0063586 3300046524 Bacteria 2178
403 Ga0495648_0197353 3300046524 Bacteria 1010
404 Ga0495663_0009179 3300046525 Bacteria 2742
405 Ga0495663_0022331 3300046525 Bacteria 1827
406 Ga0495663_0039356 3300046525 Bacteria 1432
407 Ga0495663_0259179 3300046525 Bacteria 619
408 Ga0495666_0001103 3300046526 Bacteria 12904
409 Ga0495666_0006315 3300046526 Bacteria 5969
410 Ga0495666_0007475 3300046526 Bacteria 5471
411 Ga0495666_0011864 3300046526 Bacteria 4347
412 Ga0495666_0172920 3300046526 Bacteria 998
413 Ga0495666_0491965 3300046526 Bacteria 548
414 Ga0495642_0000009 3300046528 Bacteria 152645
415 Ga0495642_0000274 3300046528 Bacteria 29118
416 Ga0495642_0001508 3300046528 Bacteria 10362
417 Ga0495642_0003767 3300046528 Bacteria 5935
418 Ga0495642_0009018 3300046528 Bacteria 3816
419 Ga0495642_0011068 3300046528 Bacteria 3460
420 Ga0495642_0020071 3300046528 Bacteria 2621
421 Ga0495642_0033717 3300046528 Bacteria 2059
422 Ga0495642_0063696 3300046528 Bacteria 1533
423 Ga0495642_0080264 3300046528 Bacteria 1373
424 Ga0495642_0093537 3300046528 Bacteria 1274
425 Ga0495642_0117536 3300046528 Bacteria 1139
426 Ga0495642_0168068 3300046528 Bacteria 952
427 Ga0495642_0172700 3300046528 Bacteria 939
428 Ga0495642_0196418 3300046528 Bacteria 879
429 Ga0495642_0288882 3300046528 Bacteria 718
430 Ga0495642_0333216 3300046528 Bacteria 666
431 Ga0495652_0049112 3300046529 Bacteria 3613
432 Ga0495654_0003261 3300046530 Bacteria 10010
433 Ga0495654_0008701 3300046530 Bacteria 5596
434 Ga0495654_0089601 3300046530 Bacteria 1429
435 Ga0495654_0123433 3300046530 Bacteria 1170
436 Ga0495665_0013081 3300046531 Bacteria 4493
437 Ga0495665_0022112 3300046531 Bacteria 3419
438 Ga0495665_0026917 3300046531 Bacteria 3087
439 Ga0495665_0209764 3300046531 Bacteria 1008
440 Ga0495586_0019756 3300046535 Bacteria 3587
441 Ga0495586_0034639 3300046535 Bacteria 2712
442 Ga0495586_0039029 3300046535 Bacteria 2552
443 Ga0495586_0107520 3300046535 Bacteria 1551
444 Ga0495586_0125601 3300046535 Bacteria 1435
445 Ga0495587_0014374 3300046536 Bacteria 4967
446 Ga0495587_0256683 3300046536 Bacteria 982
447 Ga0495587_0304147 3300046536 Bacteria 891
448 Ga0495609_0000001 3300046538 Bacteria 1060094
449 Ga0495609_0000848 3300046538 Bacteria 22555
450 Ga0495609_0004021 3300046538 Bacteria 8209
451 Ga0495609_0004505 3300046538 Bacteria 7598
452 Ga0495609_0009953 3300046538 Bacteria 4579
453 Ga0495609_0095372 3300046538 Bacteria 1291
454 Ga0495609_0133378 3300046538 Bacteria 1062
455 Ga0495609_0186265 3300046538 Bacteria 872
456 Ga0495597_0000145 3300046542 Bacteria 63472
457 Ga0495597_0001301 3300046542 Bacteria 18331
458 Ga0495597_0001490 3300046542 Bacteria 16756
459 Ga0495597_0004896 3300046542 Bacteria 7203
460 Ga0495597_0022312 3300046542 Bacteria 2937
461 Ga0495597_0026189 3300046542 Bacteria 2680
462 Ga0495597_0056415 3300046542 Bacteria 1720
463 Ga0495597_0107304 3300046542 Bacteria 1173
464 Ga0495597_0118250 3300046542 Bacteria 1106
465 Ga0495597_0137192 3300046542 Bacteria 1011
466 Ga0495597_0226728 3300046542 Bacteria 740
467 Ga0495597_0227259 3300046542 Bacteria 739
468 Ga0495597_0394580 3300046542 Bacteria 527
469 Ga0495622_0007211 3300046557 Bacteria 5163
470 Ga0495622_0029359 3300046557 Bacteria 2569
471 Ga0495622_0033944 3300046557 Bacteria 2381
472 Ga0495622_0078918 3300046557 Bacteria 1515
473 Ga0495622_0127395 3300046557 Bacteria 1160
474 Ga0495622_0148465 3300046557 Bacteria 1061
475 Ga0495633_0004643 3300046558 Bacteria 8653
476 Ga0495633_0012570 3300046558 Bacteria 4493
477 Ga0495633_0026725 3300046558 Bacteria 2828
478 Ga0495633_0058572 3300046558 Bacteria 1807
479 Ga0495633_0060591 3300046558 Bacteria 1773
480 Ga0495633_0131624 3300046558 Bacteria 1157
481 Ga0495633_0194349 3300046558 Bacteria 932
482 Ga0495633_0398909 3300046558 Bacteria 622
483 Ga0495667_0933971 3300046559 Bacteria 531
484 Ga0495656_0001830 3300046615 Bacteria 6994
485 Ga0495656_0032636 3300046615 Bacteria 2120
486 Ga0495656_0032929 3300046615 Bacteria 2112
487 Ga0495656_0093500 3300046615 Bacteria 1379
488 Ga0495656_0209631 3300046615 Bacteria 970
489 Ga0495656_0299261 3300046615 Bacteria 824
490 Ga0495668_0000052 3300046616 Bacteria 212864
491 Ga0495668_0000555 3300046616 Bacteria 46198
492 Ga0495668_0002738 3300046616 Bacteria 14108
493 Ga0495668_0003177 3300046616 Bacteria 12617
494 Ga0495668_0035034 3300046616 Bacteria 2813
495 Ga0495668_0055876 3300046616 Bacteria 2179
496 Ga0495668_0056637 3300046616 Bacteria 2163
497 Ga0495668_0126925 3300046616 Bacteria 1396
498 Ga0495668_0710499 3300046616 Bacteria 556
499 Ga0495634_0145785 3300046642 Bacteria 1500
500 Ga0495611_0000132 3300046648 Bacteria 52191
501 Ga0495611_0004043 3300046648 Bacteria 6382
502 Ga0495611_0019938 3300046648 Bacteria 2883
503 Ga0495611_0020126 3300046648 Bacteria 2870
504 Ga0495611_0024063 3300046648 Bacteria 2647
505 Ga0495611_0108148 3300046648 Bacteria 1293
506 Ga0495611_0124341 3300046648 Bacteria 1203
507 Ga0495611_0502860 3300046648 Bacteria 550
508 Ga0495625_0013292 3300046660 Bacteria 6620
509 Ga0495625_0018354 3300046660 Bacteria 5464
510 Ga0495625_0032581 3300046660 Bacteria 3862
511 Ga0495625_0058042 3300046660 Bacteria 2750
512 Ga0495625_0087102 3300046660 Bacteria 2165
513 Ga0495625_0091639 3300046660 Bacteria 2101
514 Ga0495625_0116728 3300046660 Bacteria 1820
515 Ga0495625_0214665 3300046660 Bacteria 1263
516 Ga0495625_0568549 3300046660 Bacteria 684
517 Ga0495635_0012836 3300046663 Bacteria 5868
518 Ga0495635_0525586 3300046663 Bacteria 777
519 Ga0495659_0009819 3300046664 Bacteria 3062
520 Ga0495659_0085647 3300046664 Bacteria 1202
521 Ga0495661_0000090 3300046665 Bacteria 110201
522 Ga0495661_0000238 3300046665 Bacteria 63454
523 Ga0495661_0000659 3300046665 Bacteria 34605
524 Ga0495661_0001722 3300046665 Bacteria 17709
525 Ga0495661_0006126 3300046665 Bacteria 8468
526 Ga0495661_0015425 3300046665 Bacteria 5099
527 Ga0495661_0015852 3300046665 Bacteria 5017
528 Ga0495661_0024805 3300046665 Bacteria 3880
529 Ga0495661_0031177 3300046665 Bacteria 3386
530 Ga0495661_0038468 3300046665 Bacteria 2979
531 Ga0495661_0046547 3300046665 Bacteria 2647
532 Ga0495661_0101064 3300046665 Bacteria 1623
533 Ga0495661_0107749 3300046665 Bacteria 1557
534 Ga0495661_0114666 3300046665 Bacteria 1497
535 Ga0495661_0119746 3300046665 Bacteria 1455
536 Ga0495661_0190431 3300046665 Bacteria 1080
537 Ga0495661_0192147 3300046665 Bacteria 1074
538 Ga0495661_0234172 3300046665 Bacteria 945
539 Ga0495661_0266876 3300046665 Bacteria 867
540 Ga0495661_0292192 3300046665 Bacteria 818
541 Ga0495661_0321778 3300046665 Bacteria 768
542 Ga0495661_0329501 3300046665 Bacteria 757
543 Ga0495588_0000095 3300046674 Bacteria 175627
544 Ga0495588_0005558 3300046674 Bacteria 5616
545 Ga0495588_0014176 3300046674 Bacteria 3811
546 Ga0495588_0016820 3300046674 Bacteria 3539
547 Ga0495588_0018574 3300046674 Bacteria 3392
548 Ga0495588_0037047 3300046674 Bacteria 2477
549 Ga0495588_0047477 3300046674 Bacteria 2204
550 Ga0495588_0084012 3300046674 Bacteria 1663
551 Ga0495588_0107368 3300046674 Bacteria 1469
552 Ga0495588_0164145 3300046674 Bacteria 1174
553 Ga0495588_0732617 3300046674 Bacteria 517
554 Ga0495623_0045995 3300046679 Bacteria 2770
555 Ga0495623_0162198 3300046679 Bacteria 1313
556 Ga0495646_0055408 3300046680 Bacteria 2381
557 Ga0495669_0000040 3300046684 Bacteria 90851
558 Ga0495669_0000455 3300046684 Bacteria 19161
559 Ga0495669_0005288 3300046684 Bacteria 5377
560 Ga0495669_0024931 3300046684 Bacteria 2606
561 Ga0495669_0034771 3300046684 Bacteria 2222
562 Ga0495669_0117964 3300046684 Bacteria 1242
563 Ga0495613_0073804 3300046689 Bacteria 2485
564 Ga0495613_0121968 3300046689 Bacteria 1871
565 Ga0495624_0003630 3300046690 Bacteria 11410
566 Ga0495670_0009691 3300046691 Bacteria 4734
567 Ga0495670_0014390 3300046691 Bacteria 3888
568 Ga0495670_0017005 3300046691 Bacteria 3576
569 Ga0495670_0019637 3300046691 Bacteria 3329
570 Ga0495670_0027528 3300046691 Bacteria 2817
571 Ga0495670_0039411 3300046691 Bacteria 2356
572 Ga0495670_0046835 3300046691 Bacteria 2160
573 Ga0495670_0275451 3300046691 Bacteria 899
574 Ga0495671_0000047 3300046692 Bacteria 156459
575 Ga0495671_0014119 3300046692 Bacteria 4306
576 Ga0495671_0058403 3300046692 Bacteria 1908
577 Ga0495671_0250338 3300046692 Bacteria 855
578 Ga0495671_0369487 3300046692 Bacteria 687
579 Ga0495649_0000174 3300046694 Bacteria 56050
580 Ga0495649_0000967 3300046694 Bacteria 22674
581 Ga0495649_0001231 3300046694 Bacteria 19717
582 Ga0495649_0035460 3300046694 Bacteria 2744
583 Ga0495649_0043922 3300046694 Bacteria 2439
584 Ga0495649_0059933 3300046694 Bacteria 2048
585 Ga0495649_0083568 3300046694 Bacteria 1706
586 Ga0495649_0135312 3300046694 Bacteria 1299
587 Ga0495649_0294316 3300046694 Bacteria 827
588 Ga0495649_0576937 3300046694 Bacteria 556
589 Ga0495649_0663660 3300046694 Bacteria 512
590 Ga0495589_0000029 3300046794 Bacteria 173640
591 Ga0495589_0000301 3300046794 Bacteria 39328
592 Ga0495589_0000304 3300046794 Bacteria 39263
593 Ga0495589_0009270 3300046794 Bacteria 5119
594 Ga0495589_0014301 3300046794 Bacteria 4089
595 Ga0495589_0020283 3300046794 Bacteria 3400
596 Ga0495589_0029633 3300046794 Bacteria 2759
597 Ga0495589_0040774 3300046794 Bacteria 2317
598 Ga0495589_0051593 3300046794 Bacteria 2033
599 Ga0495589_0075839 3300046794 Bacteria 1639
600 Ga0495589_0353768 3300046794 Bacteria 676
601 Ga0495600_0012572 3300046809 Bacteria 5297
602 Ga0495600_0042305 3300046809 Bacteria 2970
603 Ga0495600_0318329 3300046809 Bacteria 979
604 Ga0495660_0000033 3300046810 Bacteria 212425
605 Ga0495660_0013473 3300046810 Bacteria 4738
606 Ga0495660_0025758 3300046810 Bacteria 3338
607 Ga0495660_0036080 3300046810 Bacteria 2759
608 Ga0495660_0101624 3300046810 Bacteria 1479
609 Ga0495660_0130091 3300046810 Bacteria 1263
610 Ga0495660_0130803 3300046810 Bacteria 1259
611 Ga0495581_0004022 3300047315 Bacteria 8464
612 Ga0495581_0089387 3300047315 Bacteria 1786
613 Ga0495581_0751714 3300047315 Bacteria 561
614 Ga0495581_0758634 3300047315 Bacteria 558
615 Ga0495604_0022852 3300047317 Bacteria 4991
616 Ga0495604_0107568 3300047317 Bacteria 2038
617 Ga0495604_0203356 3300047317 Bacteria 1372
618 Ga0495604_0232123 3300047317 Bacteria 1265
619 Ga0495604_0787372 3300047317 Bacteria 599
620 Ga0495604_0941589 3300047317 Bacteria 537
621 Ga0495636_0006935 3300047318 Bacteria 4455
622 Ga0495636_0011307 3300047318 Bacteria 3532
623 Ga0495636_0018843 3300047318 Bacteria 2770
624 Ga0495636_0515681 3300047318 Bacteria 579
625 Ga0495636_0668743 3300047318 Bacteria 511
626 Ga0495674_0011313 3300047319 Bacteria 8424
627 Ga0495674_1065826 3300047319 Bacteria 617
628 Ga0495672_0000056 3300047320 Bacteria 223740
629 Ga0495672_0000430 3300047320 Bacteria 50227
630 Ga0495672_0000445 3300047320 Bacteria 49224
631 Ga0495672_0020997 3300047320 Bacteria 4266
632 Ga0495672_0090357 3300047320 Bacteria 1683
633 Ga0495672_0099651 3300047320 Bacteria 1579
634 Ga0495676_0000007 3300047321 Bacteria 276148
635 Ga0495676_0063289 3300047321 Bacteria 2884
636 Ga0495676_0102245 3300047321 Bacteria 2118
637 Ga0495676_0186013 3300047321 Bacteria 1452
638 Ga0495680_0028170 3300047322 Bacteria 4608
639 Ga0495680_0388751 3300047322 Bacteria 965
640 Ga0495680_0416448 3300047322 Bacteria 925
641 Ga0495680_0724277 3300047322 Bacteria 655
642 Ga0495683_0000017 3300047323 Bacteria 189599
643 Ga0495683_0015398 3300047323 Bacteria 3980
644 Ga0495683_0052397 3300047323 Bacteria 2037
645 Ga0495683_0134522 3300047323 Bacteria 1163
646 Ga0495683_0151685 3300047323 Bacteria 1078
647 Ga0495683_0179324 3300047323 Bacteria 968
648 Ga0495683_0194149 3300047323 Bacteria 919
649 Ga0495683_0343348 3300047323 Bacteria 631
650 Ga0495683_0400965 3300047323 Bacteria 570
651 Ga0495687_000003 3300047443 Bacteria 859509
652 Ga0495687_000092 3300047443 Bacteria 140313
653 Ga0495687_000150 3300047443 Bacteria 105759
654 Ga0495687_000486 3300047443 Bacteria 48072
655 Ga0495687_001901 3300047443 Bacteria 17963
656 Ga0495675_0025745 3300047444 Bacteria 3749
657 Ga0495675_0026183 3300047444 Bacteria 3718
658 Ga0495675_0094011 3300047444 Bacteria 1880
659 Ga0495675_0212882 3300047444 Bacteria 1172
660 Ga0495675_0332687 3300047444 Bacteria 896
661 Ga0495677_0000001 3300047445 Bacteria 715000
662 Ga0495677_0000587 3300047445 Bacteria 14912
663 Ga0495677_0000625 3300047445 Bacteria 14244
664 Ga0495677_0000627 3300047445 Bacteria 14243
665 Ga0495677_0006239 3300047445 Bacteria 4501
666 Ga0495677_0007115 3300047445 Bacteria 4189
667 Ga0495677_0009529 3300047445 Bacteria 3585
668 Ga0495677_0009698 3300047445 Bacteria 3550
669 Ga0495677_0014337 3300047445 Bacteria 2887
670 Ga0495677_0017547 3300047445 Bacteria 2594
671 Ga0495677_0037585 3300047445 Bacteria 1768
672 Ga0495677_0139513 3300047445 Bacteria 930
673 Ga0495677_0216708 3300047445 Bacteria 745
674 Ga0495677_0226879 3300047445 Bacteria 728
675 Ga0495677_0317961 3300047445 Bacteria 613
676 Ga0495677_0348849 3300047445 Bacteria 584
677 Ga0495679_002314 3300047446 Bacteria 9799
678 Ga0495679_038989 3300047446 Bacteria 1484
679 Ga0495679_110372 3300047446 Bacteria 757
680 Ga0495679_150082 3300047446 Bacteria 626
681 Ga0495685_000557 3300047447 Bacteria 11550
682 Ga0495685_000751 3300047447 Bacteria 9938
683 Ga0495685_022602 3300047447 Bacteria 2164
684 Ga0495685_024552 3300047447 Bacteria 2075
685 Ga0495685_066711 3300047447 Bacteria 1209
686 Ga0495681_0000054 3300047470 Bacteria 106578
687 Ga0495681_0000080 3300047470 Bacteria 84770
688 Ga0495681_0001856 3300047470 Bacteria 15509
689 Ga0495681_0004546 3300047470 Bacteria 9459
690 Ga0495681_0017857 3300047470 Bacteria 3927
691 Ga0495681_0022659 3300047470 Bacteria 3356
692 Ga0495681_0030902 3300047470 Bacteria 2720
693 Ga0495681_0066130 3300047470 Bacteria 1651
694 Ga0495681_0075103 3300047470 Bacteria 1522
695 Ga0495681_0080279 3300047470 Bacteria 1457
696 Ga0495681_0102830 3300047470 Bacteria 1246
697 Ga0495686_0000235 3300047472 Bacteria 101102
698 Ga0495686_0000379 3300047472 Bacteria 71434
699 Ga0495686_0010909 3300047472 Bacteria 6434
700 Ga0495686_0022934 3300047472 Bacteria 4124
701 Ga0495686_0148160 3300047472 Bacteria 1380
702 Ga0495593_0003479 3300047673 Bacteria 9431
703 Ga0495593_0004899 3300047673 Bacteria 7939
704 Ga0495593_0233922 3300047673 Bacteria 921
705 Ga0495593_0350823 3300047673 Bacteria 737
706 Ga0495602_0085738 3300048088 Bacteria 2631
707 Ga0495602_0091336 3300048088 Bacteria 2526
708 Ga0495602_0793568 3300048088 Bacteria 636
709 Ga0495614_0009386 3300048089 Bacteria 4326
710 Ga0495614_0015146 3300048089 Bacteria 3364
711 Ga0495614_0026416 3300048089 Bacteria 2502
712 Ga0495615_0021975 3300048090 Bacteria 1445
713 Ga0495615_0120860 3300048090 Bacteria 757
714 Ga0495626_0000018 3300048091 Bacteria 230153
715 Ga0495626_0000159 3300048091 Bacteria 83571
716 Ga0495626_0001482 3300048091 Bacteria 18513
717 Ga0495626_0001668 3300048091 Bacteria 17140
718 Ga0495626_0006333 3300048091 Bacteria 6749
719 Ga0495626_0006510 3300048091 Bacteria 6640
720 Ga0495626_0010665 3300048091 Bacteria 4886
721 Ga0495626_0017336 3300048091 Bacteria 3638
722 Ga0495626_0018254 3300048091 Bacteria 3526
723 Ga0495626_0018279 3300048091 Bacteria 3523
724 Ga0495626_0027183 3300048091 Bacteria 2783
725 Ga0495626_0048931 3300048091 Bacteria 1959
726 Ga0495626_0049677 3300048091 Bacteria 1941
727 Ga0495626_0088640 3300048091 Bacteria 1363
728 Ga0495626_0097541 3300048091 Bacteria 1285
729 Ga0495626_0138234 3300048091 Bacteria 1034
730 Ga0495626_0163330 3300048091 Bacteria 932
731 Ga0495626_0382166 3300048091 Bacteria 546
732 Ga0496100_0107382 3300048903 Bacteria 1933
733 Ga0496101_0022528 3300048904 Bacteria 4337
734 Ga0496102_0000176 3300048905 Bacteria 86747
735 Ga0496102_0000323 3300048905 Bacteria 59717
736 Ga0496102_0027488 3300048905 Bacteria 5080
737 Ga0496102_0039918 3300048905 Bacteria 4243
738 Ga0496102_0069184 3300048905 Bacteria 3240
739 Ga0496102_0295605 3300048905 Bacteria 1526
740 Ga0496102_0427793 3300048905 Bacteria 1243
741 Ga0496103_0007567 3300048906 Bacteria 6472
742 Ga0496103_0020276 3300048906 Bacteria 3993
743 Ga0496103_0165919 3300048906 Bacteria 1417
744 Ga0496103_0778305 3300048906 Bacteria 604
745 Ga0496104_0698306 3300048907 Bacteria 922
746 Ga0496104_0885527 3300048907 Bacteria 798
747 Ga0496105_0076559 3300048908 Bacteria 2763
748 Ga0496105_0419372 3300048908 Bacteria 1060
749 Ga0496106_0010178 3300048909 Bacteria 6948
750 Ga0496106_0660486 3300048909 Bacteria 835
751 Ga0496106_0688783 3300048909 Bacteria 815
752 Ga0496107_0142399 3300048910 Bacteria 1772
753 Ga0496108_0091304 3300048911 Bacteria 2589
754 Ga0496108_0701238 3300048911 Bacteria 878
755 Ga0496109_0006989 3300048912 Bacteria 9526
756 Ga0496109_0207287 3300048912 Bacteria 1843
757 Ga0496109_1510193 3300048912 Bacteria 607
758 Ga0496110_0000002 3300048913 Bacteria 166613
759 Ga0496110_0481475 3300048913 Bacteria 1130
760 Ga0496110_1160352 3300048913 Bacteria 681
761 Ga0496110_1529012 3300048913 Bacteria 577
762 Ga0496110_1683018 3300048913 Bacteria 544
763 Ga0496111_0114257 3300048914 Bacteria 1990
764 Ga0496111_0361038 3300048914 Bacteria 1075
765 Ga0496112_0090323 3300048915 Bacteria 3032
766 Ga0496112_0946775 3300048915 Bacteria 782
767 Ga0496113_0008610 3300048916 Bacteria 6654
768 Ga0496113_0022590 3300048916 Bacteria 4452
769 Ga0496113_0817167 3300048916 Bacteria 740
770 Ga0496113_1005320 3300048916 Bacteria 657
771 Ga0496114_0449565 3300048917 Bacteria 1141
772 Ga0496115_0000708 3300048918 Bacteria 24708
773 Ga0496115_0090803 3300048918 Bacteria 2495
774 Ga0496115_0092509 3300048918 Bacteria 2472
775 Ga0496115_0116460 3300048918 Bacteria 2198
776 Ga0496115_0175241 3300048918 Bacteria 1773
777 Ga0496115_0715214 3300048918 Bacteria 786
778 Ga0496121_0226586 3300048924 Bacteria 1312
779 Ga0496122_0000299 3300048925 Bacteria 109780
780 Ga0496122_0008202 3300048925 Bacteria 11345
781 Ga0496122_0026288 3300048925 Bacteria 5022
782 Ga0496122_0372410 3300048925 Bacteria 736
783 Ga0496123_0000783 3300048926 Bacteria 51354
784 Ga0496123_0004032 3300048926 Bacteria 15844
785 Ga0496123_0499482 3300048926 Bacteria 532
786 Ga0496124_0004757 3300048927 Bacteria 15634
787 Ga0496124_0046616 3300048927 Bacteria 3711
788 Ga0496124_0089253 3300048927 Bacteria 2517
789 Ga0496124_0103257 3300048927 Bacteria 2306
790 Ga0496124_0112070 3300048927 Bacteria 2194
791 Ga0496124_0140982 3300048927 Bacteria 1902
792 Ga0496124_0471383 3300048927 Bacteria 850
793 Ga0496125_0004760 3300048928 Bacteria 15465
794 Ga0496125_0036084 3300048928 Bacteria 4324
795 Ga0496126_0177411 3300048929 Bacteria 1812
796 Ga0501308_000151 3300049128 Bacteria 3653
797 Ga0501304_002999 3300049160 Bacteria 1211
798 Ga0495678_000048 3300049459 Bacteria 165744
799 Ga0495678_000050 3300049459 Bacteria 160887
800 Ga0495678_000122 3300049459 Bacteria 91100
801 Ga0495678_000257 3300049459 Bacteria 59306
802 Ga0495682_0000144 3300049460 Bacteria 61914
803 Ga0495682_0001333 3300049460 Bacteria 13680
804 Ga0495682_0008506 3300049460 Bacteria 4039
805 Ga0495682_0021606 3300049460 Bacteria 2410
806 Ga0501297_039683 3300049520 Bacteria 658
807 Ga0501313_000568 3300049529 Bacteria 2639
808 Ga0501315_000954 3300049531 Bacteria 2278
809 Ga0501315_026364 3300049531 Bacteria 814
810 Ga0501034_0168575 3300049571 Bacteria 2158
811 Ga0501034_1195480 3300049571 Bacteria 639
812 Ga0501036_0215315 3300049572 Bacteria 1614
813 Ga0501047_0560030 3300049581 Bacteria 967
814 Ga0501206_012442 3300049653 Bacteria 1155
815 Ga0501217_235619 3300049661 Bacteria 584
816 Ga0501222_005723 3300049662 Bacteria 1672
817 Ga0501230_042323 3300049667 Bacteria 885
818 Ga0501236_069521 3300049670 Bacteria 641
819 Ga0501257_197828 3300049686 Bacteria 576
820 Ga0501221_083214 3300049704 Bacteria 773
821 Ga0501279_077020 3300049775 Bacteria 570
822 Ga0501035_0000613 3300049822 Bacteria 39265
823 Ga0501204_040648 3300049850 Bacteria 680
824 Ga0501226_035316 3300049853 Bacteria 573
825 Ga0587084_014879 3300059477 Bacteria 1091
826 Ga0587066_022117 3300059490 Bacteria 1061
827 Ga0587070_031612 3300059491 Bacteria 963
828 Ga0587070_044477 3300059491 Bacteria 863
829 Ga0587080_008070 3300059503 Bacteria 1497
830 Ga0587082_001204 3300059504 Bacteria 2594
831 Ga0587082_035639 3300059504 Bacteria 889
832 Ga0587083_0008376 3300059505 Bacteria 1616
833 Ga0587088_002006 3300059508 Bacteria 2235
834 Ga0587090_020398 3300059510 Bacteria 1031
835 Ga0587090_023613 3300059510 Bacteria 981
836 Ga0587098_005248 3300059604 Bacteria 1262
837 Ga0587106_000728 3300059605 Bacteria 2538
838 Ga0587125_004684 3300059607 Bacteria 1228
839 Ga0587101_006472 3300059623 Bacteria 1345
840 Ga0587067_011005 3300059640 Bacteria 1385
841 Ga0587068_000200 3300059641 Bacteria 4613
842 Ga0587069_001016 3300059642 Bacteria 2423
843 Ga0587072_001324 3300059643 Bacteria 3018
844 Ga0587076_018910 3300059645 Bacteria 1115
845 Ga0587079_000185 3300059647 Bacteria 4462
846 Ga0587079_039651 3300059647 Bacteria 946
847 Ga0587105_004475 3300059651 Bacteria 895
848 Ga0587107_004301 3300059652 Bacteria 1441
849 Ga0587071_007542 3300060344 Bacteria 1738
850 Ga0587111_0029589 3300060346 Bacteria 1110
851 Ga0466962_0029931 3300061719 Bacteria 2606
852 Ga0466962_0261738 3300061719 Bacteria 851
853 Ga0466962_0406063 3300061719 Bacteria 682
854 Ga0466962_0500924 3300061719 Bacteria 615
855 Ga0495687_000411
856 rootH2_10189217
857 rootL2_10011198
858 Ga0007410J51695_1017414
859 Ga0055525_1000008
860 Ga0055542_1007860
861 Ga0065165_1002057
862 Ga0065165_1021713
863 Ga0065714_10132036
864 Ga0070658_10091401
865 Ga0070658_10173858
866 Ga0070658_10959788
867 Ga0070658_11081712
868 Ga0070670_101336589
869 Ga0070682_100568529
870 Ga0070660_100265035
871 Ga0070660_101290600
872 Ga0070660_101572380
873 Ga0070661_100103074
874 Ga0070659_100343872
875 Ga0070667_100774409
876 Ga0070663_100593245
877 Ga0070662_100130144
878 Ga0070662_100627296
879 Ga0068867_100791149
880 Ga0068853_100228345
881 Ga0070672_100128483
882 Ga0068855_100071413
883 Ga0068855_100556760
884 Ga0070664_100916519
885 Ga0070664_101155930
886 Ga0068852_100046601
887 Ga0068866_10224569
888 Ga0105244_10376530
889 Ga0105245_10192652
890 Ga0105243_10050716
891 Ga0105241_10057928
892 Ga0105242_10009383
893 Ga0105237_10052079
894 Ga0105238_10525231
895 Ga0105239_10399324
896 Ga0105239_12887261
897 Ga0105246_10919948
898 Ga0157371_10000149
899 Ga0157370_10464208
900 Ga0157369_11008966
901 Ga0157369_11210192
902 Ga0157374_10475745
903 Ga0157374_12019076
904 Ga0157372_10135257
905 Ga0157372_11023564
906 Ga0157372_11069717
907 Ga0157372_11831313
908 Ga0182006_1073772
909 Ga0182007_10068111
910 Ga0182007_10206179
911 Ga0163161_10759428
912 Ga0209563_100003
913 Ga0209677_106012
914 Ga0209148_1000403
915 Ga0207642_10989157
916 Ga0207705_10005671
917 Ga0207705_10079021
918 Ga0207654_10116350
919 Ga0207671_10164551
920 Ga0207657_10028684
921 Ga0207657_10187015
922 Ga0207657_10331810
923 Ga0207649_10077342
924 Ga0207649_10289115
925 Ga0207694_10223810
926 Ga0207687_10412997
927 Ga0207690_10109813
928 Ga0207690_10595403
929 Ga0207690_11564661
930 Ga0207706_10113901
931 Ga0207706_10121471
932 Ga0207686_10057523
933 Ga0207709_10080665
934 Ga0207704_10203948
935 Ga0207661_10819702
936 Ga0207679_10074584
937 Ga0207679_10305288
938 Ga0207667_10012297
939 Ga0207667_11853012
940 Ga0207640_12096901
941 Ga0207658_10610504
942 Ga0207639_10741030
943 Ga0207678_10058990
944 Ga0207702_10299780
945 Ga0207648_10124022
946 Ga0207674_11593918
947 Ga0207698_10395425
948 Ga0316177_1087656
949 Ga0316180_1076152
950 Ga0316182_1045793
951 Ga0316182_1068880
952 Ga0316182_1395676
953 Ga0307408_100749939
954 Ga0307414_10038809
955 Ga0373934_0031476
956 Ga0395899_0000012
957 Ga0395899_0044141
958 Ga0395899_0071787
959 Ga0395899_0236117
960 Ga0395899_0248109
961 Ga0395899_0471143
962 Ga0395900_0000028
963 Ga0395900_0177724
964 Ga0395900_0192545
965 Ga0395900_0206530
966 Ga0395900_0249315
967 Ga0395900_0315765
968 Ga0395900_0392115
969 Ga0395900_0526281
970 Ga0395900_0745766
971 Ga0395900_0995271
972 Ga0395898_0037410
973 Ga0395898_0052983
974 Ga0395898_0150061
975 Ga0395898_0620310
976 Ga0395898_1437851
977 Ga0395898_1554679
978 Ga0395905_0063674
979 Ga0395905_0144826
980 Ga0395905_0277986
981 Ga0395905_0341564
982 Ga0395905_1018153
983 Ga0395905_1041359
984 Ga0395905_1163544
985 Ga0395905_1380814
986 Ga0395901_0000191
987 Ga0395901_0022134
988 Ga0395901_0219529
989 Ga0395901_0259851
990 Ga0395901_0714387
991 Ga0395901_0788608
992 Ga0395901_1755899
993 Ga0439465_0093817
994 Ga0439433_0034034
995 Ga0439448_0000186
996 Ga0439448_0019632
997 Ga0439448_0184581
998 Ga0439449_0054322
999 Ga0439449_0141226
1000 Ga0439450_004176
1001 Ga0439450_004316
1002 Ga0439450_011518
1003 Ga0439455_0001253
1004 Ga0439455_0012610
1005 Ga0450904_002779
1006 Ga0439458_0015566
1007 Ga0439458_0060439
1008 Ga0439458_0074181
1009 Ga0439464_0198643
1010 Ga0451577_0038734
1011 Ga0466969_0060006
1012 Ga0466969_0169923
1013 Ga0466969_0281839
1014 Ga0466972_0009118
1015 Ga0466972_0100353
1016 Ga0466972_0283026
1017 Ga0466965_0001489
1018 Ga0466965_0037013
1019 Ga0466965_0038557
1020 Ga0466965_0134162
1021 Ga0466965_0158341
1022 Ga0466966_0021307
1023 Ga0466966_0087627
1024 Ga0466966_0236949
1025 Ga0466961_0095437
1026 Ga0466961_0228824
1027 Ga0466963_0531514
1028 Ga0466963_0828084
1029 Ga0466964_0000184
1030 Ga0466964_0002194
1031 Ga0466964_0111350
1032 Ga0466964_0565148
1033 Ga0453684_0128088
1034 Ga0466971_0125281
1035 Ga0466971_0218704
1036 Ga0466971_0236287
1037 Ga0466968_0004442
1038 Ga0466968_0635161
1039 Ga0466970_0127095
1040 Ga0466970_0580313
1041 Ga0466957_0000008
1042 Ga0466957_0044716
1043 Ga0466957_0299367
1044 Ga0466957_0565656
1045 Ga0466957_0668751
1046 Ga0466957_1210777
1047 Ga0466960_0537418
1048 Ga0466959_0069731
1049 Ga0466959_0210965
1050 Ga0466959_0258773
1051 Ga0466959_0311289
1052 Ga0466959_0332376
1053 Ga0451576_0239777
1054 Ga0451576_0660295
1055 Ga0466958_0007091
1056 Ga0466958_0183129
1057 Ga0466958_0287642
1058 Ga0466958_0331948
1059 Ga0466958_0369253
1060 Ga0466967_0022249
1061 Ga0466967_0139320
1062 Ga0466967_0444013
1063 Ga0495617_000001
1064 Ga0495617_008419
1065 Ga0495627_000035
1066 Ga0495627_025272
1067 Ga0495627_076288
1068 Ga0495603_0016847
1069 Ga0495603_0039719
1070 Ga0495603_0253304
1071 Ga0495590_0000029
1072 Ga0495590_0000794
1073 Ga0495590_0000886
1074 Ga0495590_0003598
1075 Ga0495590_0119052
1076 Ga0495590_0173022
1077 Ga0495590_0223533
1078 Ga0495591_000359
1079 Ga0495591_099776
1080 Ga0495629_0011614
1081 Ga0495629_0138582
1082 Ga0495629_0175154
1083 Ga0495629_0188599
1084 Ga0495638_0005949
1085 Ga0495638_0023751
1086 Ga0495638_0026384
1087 Ga0495638_0047389
1088 Ga0495638_0221213
1089 Ga0495653_0182734
1090 Ga0495650_0013452
1091 Ga0495650_0057271
1092 Ga0495580_0026281
1093 Ga0495580_0727967
1094 Ga0495582_0008008
1095 Ga0495582_0050892
1096 Ga0495605_0000138
1097 Ga0495605_0000304
1098 Ga0495605_0013483
1099 Ga0495605_0018512
1100 Ga0495605_0022570
1101 Ga0495605_0031571
1102 Ga0495605_0032507
1103 Ga0495605_0041338
1104 Ga0495605_0072236
1105 Ga0495605_0175226
1106 Ga0495605_0197745
1107 Ga0495605_0223409
1108 Ga0495605_0429156
1109 Ga0495639_0184090
1110 Ga0495584_0000637
1111 Ga0495584_0001166
1112 Ga0495584_0001464
1113 Ga0495584_0005183
1114 Ga0495584_0010783
1115 Ga0495584_0011336
1116 Ga0495584_0014262
1117 Ga0495584_0021529
1118 Ga0495584_0068816
1119 Ga0495584_0097820
1120 Ga0495584_0112579
1121 Ga0495584_0154619
1122 Ga0495584_0155384
1123 Ga0495584_0186036
1124 Ga0495584_0214559
1125 Ga0495584_0303552
1126 Ga0495585_0001218
1127 Ga0495585_0001766
1128 Ga0495585_0003751
1129 Ga0495585_0005220
1130 Ga0495585_0014341
1131 Ga0495585_0015018
1132 Ga0495585_0035228
1133 Ga0495585_0059062
1134 Ga0495585_0070727
1135 Ga0495585_0142506
1136 Ga0495585_0193290
1137 Ga0495594_0023243
1138 Ga0495594_0023269
1139 Ga0495594_0027973
1140 Ga0495594_0045645
1141 Ga0495594_0051030
1142 Ga0495594_0064737
1143 Ga0495594_0068935
1144 Ga0495594_0086923
1145 Ga0495594_0230591
1146 Ga0495596_0001476
1147 Ga0495596_0003276
1148 Ga0495596_0005692
1149 Ga0495596_0005906
1150 Ga0495596_0013804
1151 Ga0495596_0015723
1152 Ga0495596_0018289
1153 Ga0495596_0021565
1154 Ga0495596_0031264
1155 Ga0495596_0089397
1156 Ga0495596_0210226
1157 Ga0495607_0002300
1158 Ga0495607_0007345
1159 Ga0495607_0007423
1160 Ga0495607_0012432
1161 Ga0495607_0029774
1162 Ga0495607_0096180
1163 Ga0495607_0107124
1164 Ga0495607_0192027
1165 Ga0495607_0222739
1166 Ga0495607_0266160
1167 Ga0495607_0273898
1168 Ga0495607_0461671
1169 Ga0495583_0000274
1170 Ga0495583_0000438
1171 Ga0495583_0000647
1172 Ga0495583_0000712
1173 Ga0495583_0002574
1174 Ga0495583_0003058
1175 Ga0495583_0013015
1176 Ga0495583_0016746
1177 Ga0495583_0024876
1178 Ga0495583_0035838
1179 Ga0495583_0053760
1180 Ga0495583_0077301
1181 Ga0495583_0174621
1182 Ga0495583_0178386
1183 Ga0495606_0018070
1184 Ga0495606_0018807
1185 Ga0495606_0046052
1186 Ga0495606_0070020
1187 Ga0495606_0100279
1188 Ga0495606_0174451
1189 Ga0495606_0246401
1190 Ga0495610_0001514
1191 Ga0495610_0388553
1192 Ga0495616_0000037
1193 Ga0495616_0000494
1194 Ga0495616_0000550
1195 Ga0495616_0004947
1196 Ga0495616_0020073
1197 Ga0495616_0024924
1198 Ga0495616_0029300
1199 Ga0495616_0033927
1200 Ga0495616_0048252
1201 Ga0495616_0056202
1202 Ga0495616_0069724
1203 Ga0495616_0073397
1204 Ga0495616_0093742
1205 Ga0495616_0180203
1206 Ga0495620_0040971
1207 Ga0495630_0102234
1208 Ga0495631_0000220
1209 Ga0495631_0003343
1210 Ga0495631_0003934
1211 Ga0495631_0010003
1212 Ga0495631_0010449
1213 Ga0495631_0073698
1214 Ga0495631_0080393
1215 Ga0495631_0117366
1216 Ga0495631_0155978
1217 Ga0495631_0157434
1218 Ga0495631_0165201
1219 Ga0495631_0309068
1220 Ga0495631_0446703
1221 Ga0495632_0000126
1222 Ga0495632_0000133
1223 Ga0495632_0000462
1224 Ga0495632_0000589
1225 Ga0495632_0006635
1226 Ga0495632_0008147
1227 Ga0495632_0025836
1228 Ga0495632_0494490
1229 Ga0495637_0000002
1230 Ga0495637_0037223
1231 Ga0495643_0000096
1232 Ga0495643_0000441
1233 Ga0495643_0003747
1234 Ga0495643_0010783
1235 Ga0495643_0015130
1236 Ga0495643_0042916
1237 Ga0495643_0077750
1238 Ga0495643_0113673
1239 Ga0495643_0222455
1240 Ga0495643_0239145
1241 Ga0495643_0366748
1242 Ga0495644_0002535
1243 Ga0495644_0004349
1244 Ga0495644_0005835
1245 Ga0495644_0007208
1246 Ga0495644_0020592
1247 Ga0495644_0031789
1248 Ga0495644_0041370
1249 Ga0495644_0042582
1250 Ga0495644_0172165
1251 Ga0495648_0000252
1252 Ga0495648_0003183
1253 Ga0495648_0004850
1254 Ga0495648_0019199
1255 Ga0495648_0032963
1256 Ga0495648_0063586
1257 Ga0495648_0197353
1258 Ga0495663_0009179
1259 Ga0495663_0022331
1260 Ga0495663_0039356
1261 Ga0495663_0259179
1262 Ga0495666_0001103
1263 Ga0495666_0006315
1264 Ga0495666_0007475
1265 Ga0495666_0011864
1266 Ga0495666_0172920
1267 Ga0495666_0491965
1268 Ga0495642_0000009
1269 Ga0495642_0000274
1270 Ga0495642_0001508
1271 Ga0495642_0003767
1272 Ga0495642_0009018
1273 Ga0495642_0011068
1274 Ga0495642_0020071
1275 Ga0495642_0033717
1276 Ga0495642_0063696
1277 Ga0495642_0080264
1278 Ga0495642_0093537
1279 Ga0495642_0117536
1280 Ga0495642_0168068
1281 Ga0495642_0172700
1282 Ga0495642_0196418
1283 Ga0495642_0288882
1284 Ga0495642_0333216
1285 Ga0495652_0049112
1286 Ga0495654_0003261
1287 Ga0495654_0008701
1288 Ga0495654_0089601
1289 Ga0495654_0123433
1290 Ga0495665_0013081
1291 Ga0495665_0022112
1292 Ga0495665_0026917
1293 Ga0495665_0209764
1294 Ga0495586_0019756
1295 Ga0495586_0034639
1296 Ga0495586_0039029
1297 Ga0495586_0107520
1298 Ga0495586_0125601
1299 Ga0495587_0014374
1300 Ga0495587_0256683
1301 Ga0495587_0304147
1302 Ga0495609_0000001
1303 Ga0495609_0000848
1304 Ga0495609_0004021
1305 Ga0495609_0004505
1306 Ga0495609_0009953
1307 Ga0495609_0095372
1308 Ga0495609_0133378
1309 Ga0495609_0186265
1310 Ga0495597_0000145
1311 Ga0495597_0001301
1312 Ga0495597_0001490
1313 Ga0495597_0004896
1314 Ga0495597_0022312
1315 Ga0495597_0026189
1316 Ga0495597_0056415
1317 Ga0495597_0107304
1318 Ga0495597_0118250
1319 Ga0495597_0137192
1320 Ga0495597_0226728
1321 Ga0495597_0227259
1322 Ga0495597_0394580
1323 Ga0495622_0007211
1324 Ga0495622_0029359
1325 Ga0495622_0033944
1326 Ga0495622_0078918
1327 Ga0495622_0127395
1328 Ga0495622_0148465
1329 Ga0495633_0004643
1330 Ga0495633_0012570
1331 Ga0495633_0026725
1332 Ga0495633_0058572
1333 Ga0495633_0060591
1334 Ga0495633_0131624
1335 Ga0495633_0194349
1336 Ga0495633_0398909
1337 Ga0495667_0933971
1338 Ga0495656_0001830
1339 Ga0495656_0032636
1340 Ga0495656_0032929
1341 Ga0495656_0093500
1342 Ga0495656_0209631
1343 Ga0495656_0299261
1344 Ga0495668_0000052
1345 Ga0495668_0000555
1346 Ga0495668_0002738
1347 Ga0495668_0003177
1348 Ga0495668_0035034
1349 Ga0495668_0055876
1350 Ga0495668_0056637
1351 Ga0495668_0126925
1352 Ga0495668_0710499
1353 Ga0495634_0145785
1354 Ga0495611_0000132
1355 Ga0495611_0004043
1356 Ga0495611_0019938
1357 Ga0495611_0020126
1358 Ga0495611_0024063
1359 Ga0495611_0108148
1360 Ga0495611_0124341
1361 Ga0495611_0502860
1362 Ga0495625_0013292
1363 Ga0495625_0018354
1364 Ga0495625_0032581
1365 Ga0495625_0058042
1366 Ga0495625_0087102
1367 Ga0495625_0091639
1368 Ga0495625_0116728
1369 Ga0495625_0214665
1370 Ga0495625_0568549
1371 Ga0495635_0012836
1372 Ga0495635_0525586
1373 Ga0495659_0009819
1374 Ga0495659_0085647
1375 Ga0495661_0000090
1376 Ga0495661_0000238
1377 Ga0495661_0000659
1378 Ga0495661_0001722
1379 Ga0495661_0006126
1380 Ga0495661_0015425
1381 Ga0495661_0015852
1382 Ga0495661_0024805
1383 Ga0495661_0031177
1384 Ga0495661_0038468
1385 Ga0495661_0046547
1386 Ga0495661_0101064
1387 Ga0495661_0107749
1388 Ga0495661_0114666
1389 Ga0495661_0119746
1390 Ga0495661_0190431
1391 Ga0495661_0192147
1392 Ga0495661_0234172
1393 Ga0495661_0266876
1394 Ga0495661_0292192
1395 Ga0495661_0321778
1396 Ga0495661_0329501
1397 Ga0495588_0000095
1398 Ga0495588_0005558
1399 Ga0495588_0014176
1400 Ga0495588_0016820
1401 Ga0495588_0018574
1402 Ga0495588_0037047
1403 Ga0495588_0047477
1404 Ga0495588_0084012
1405 Ga0495588_0107368
1406 Ga0495588_0164145
1407 Ga0495588_0732617
1408 Ga0495623_0045995
1409 Ga0495623_0162198
1410 Ga0495646_0055408
1411 Ga0495669_0000040
1412 Ga0495669_0000455
1413 Ga0495669_0005288
1414 Ga0495669_0024931
1415 Ga0495669_0034771
1416 Ga0495669_0117964
1417 Ga0495613_0073804
1418 Ga0495613_0121968
1419 Ga0495624_0003630
1420 Ga0495670_0009691
1421 Ga0495670_0014390
1422 Ga0495670_0017005
1423 Ga0495670_0019637
1424 Ga0495670_0027528
1425 Ga0495670_0039411
1426 Ga0495670_0046835
1427 Ga0495670_0275451
1428 Ga0495671_0000047
1429 Ga0495671_0014119
1430 Ga0495671_0058403
1431 Ga0495671_0250338
1432 Ga0495671_0369487
1433 Ga0495649_0000174
1434 Ga0495649_0000967
1435 Ga0495649_0001231
1436 Ga0495649_0035460
1437 Ga0495649_0043922
1438 Ga0495649_0059933
1439 Ga0495649_0083568
1440 Ga0495649_0135312
1441 Ga0495649_0294316
1442 Ga0495649_0576937
1443 Ga0495649_0663660
1444 Ga0495589_0000029
1445 Ga0495589_0000301
1446 Ga0495589_0000304
1447 Ga0495589_0009270
1448 Ga0495589_0014301
1449 Ga0495589_0020283
1450 Ga0495589_0029633
1451 Ga0495589_0040774
1452 Ga0495589_0051593
1453 Ga0495589_0075839
1454 Ga0495589_0353768
1455 Ga0495600_0012572
1456 Ga0495600_0042305
1457 Ga0495600_0318329
1458 Ga0495660_0000033
1459 Ga0495660_0013473
1460 Ga0495660_0025758
1461 Ga0495660_0036080
1462 Ga0495660_0101624
1463 Ga0495660_0130091
1464 Ga0495660_0130803
1465 Ga0495581_0004022
1466 Ga0495581_0089387
1467 Ga0495581_0751714
1468 Ga0495581_0758634
1469 Ga0495604_0022852
1470 Ga0495604_0107568
1471 Ga0495604_0203356
1472 Ga0495604_0232123
1473 Ga0495604_0787372
1474 Ga0495604_0941589
1475 Ga0495636_0006935
1476 Ga0495636_0011307
1477 Ga0495636_0018843
1478 Ga0495636_0515681
1479 Ga0495636_0668743
1480 Ga0495674_0011313
1481 Ga0495674_1065826
1482 Ga0495672_0000056
1483 Ga0495672_0000430
1484 Ga0495672_0000445
1485 Ga0495672_0020997
1486 Ga0495672_0090357
1487 Ga0495672_0099651
1488 Ga0495676_0000007
1489 Ga0495676_0063289
1490 Ga0495676_0102245
1491 Ga0495676_0186013
1492 Ga0495680_0028170
1493 Ga0495680_0388751
1494 Ga0495680_0416448
1495 Ga0495680_0724277
1496 Ga0495683_0000017
1497 Ga0495683_0015398
1498 Ga0495683_0052397
1499 Ga0495683_0134522
1500 Ga0495683_0151685
1501 Ga0495683_0179324
1502 Ga0495683_0194149
1503 Ga0495683_0343348
1504 Ga0495683_0400965
1505 Ga0495687_000003
1506 Ga0495687_000092
1507 Ga0495687_000150
1508 Ga0495687_000486
1509 Ga0495687_001901
1510 Ga0495675_0025745
1511 Ga0495675_0026183
1512 Ga0495675_0094011
1513 Ga0495675_0212882
1514 Ga0495675_0332687
1515 Ga0495677_0000001
1516 Ga0495677_0000587
1517 Ga0495677_0000625
1518 Ga0495677_0000627
1519 Ga0495677_0006239
1520 Ga0495677_0007115
1521 Ga0495677_0009529
1522 Ga0495677_0009698
1523 Ga0495677_0014337
1524 Ga0495677_0017547
1525 Ga0495677_0037585
1526 Ga0495677_0139513
1527 Ga0495677_0216708
1528 Ga0495677_0226879
1529 Ga0495677_0317961
1530 Ga0495677_0348849
1531 Ga0495679_002314
1532 Ga0495679_038989
1533 Ga0495679_110372
1534 Ga0495679_150082
1535 Ga0495685_000557
1536 Ga0495685_000751
1537 Ga0495685_022602
1538 Ga0495685_024552
1539 Ga0495685_066711
1540 Ga0495681_0000054
1541 Ga0495681_0000080
1542 Ga0495681_0001856
1543 Ga0495681_0004546
1544 Ga0495681_0017857
1545 Ga0495681_0022659
1546 Ga0495681_0030902
1547 Ga0495681_0066130
1548 Ga0495681_0075103
1549 Ga0495681_0080279
1550 Ga0495681_0102830
1551 Ga0495686_0000235
1552 Ga0495686_0000379
1553 Ga0495686_0010909
1554 Ga0495686_0022934
1555 Ga0495686_0148160
1556 Ga0495593_0003479
1557 Ga0495593_0004899
1558 Ga0495593_0233922
1559 Ga0495593_0350823
1560 Ga0495602_0085738
1561 Ga0495602_0091336
1562 Ga0495602_0793568
1563 Ga0495614_0009386
1564 Ga0495614_0015146
1565 Ga0495614_0026416
1566 Ga0495615_0021975
1567 Ga0495615_0120860
1568 Ga0495626_0000018
1569 Ga0495626_0000159
1570 Ga0495626_0001482
1571 Ga0495626_0001668
1572 Ga0495626_0006333
1573 Ga0495626_0006510
1574 Ga0495626_0010665
1575 Ga0495626_0017336
1576 Ga0495626_0018254
1577 Ga0495626_0018279
1578 Ga0495626_0027183
1579 Ga0495626_0048931
1580 Ga0495626_0049677
1581 Ga0495626_0088640
1582 Ga0495626_0097541
1583 Ga0495626_0138234
1584 Ga0495626_0163330
1585 Ga0495626_0382166
1586 Ga0496100_0107382
1587 Ga0496101_0022528
1588 Ga0496102_0000176
1589 Ga0496102_0000323
1590 Ga0496102_0027488
1591 Ga0496102_0039918
1592 Ga0496102_0069184
1593 Ga0496102_0295605
1594 Ga0496102_0427793
1595 Ga0496103_0007567
1596 Ga0496103_0020276
1597 Ga0496103_0165919
1598 Ga0496103_0778305
1599 Ga0496104_0698306
1600 Ga0496104_0885527
1601 Ga0496105_0076559
1602 Ga0496105_0419372
1603 Ga0496106_0010178
1604 Ga0496106_0660486
1605 Ga0496106_0688783
1606 Ga0496107_0142399
1607 Ga0496108_0091304
1608 Ga0496108_0701238
1609 Ga0496109_0006989
1610 Ga0496109_0207287
1611 Ga0496109_1510193
1612 Ga0496110_0000002
1613 Ga0496110_0481475
1614 Ga0496110_1160352
1615 Ga0496110_1529012
1616 Ga0496110_1683018
1617 Ga0496111_0114257
1618 Ga0496111_0361038
1619 Ga0496112_0090323
1620 Ga0496112_0946775
1621 Ga0496113_0008610
1622 Ga0496113_0022590
1623 Ga0496113_0817167
1624 Ga0496113_1005320
1625 Ga0496114_0449565
1626 Ga0496115_0000708
1627 Ga0496115_0090803
1628 Ga0496115_0092509
1629 Ga0496115_0116460
1630 Ga0496115_0175241
1631 Ga0496115_0715214
1632 Ga0496121_0226586
1633 Ga0496122_0000299
1634 Ga0496122_0008202
1635 Ga0496122_0026288
1636 Ga0496122_0372410
1637 Ga0496123_0000783
1638 Ga0496123_0004032
1639 Ga0496123_0499482
1640 Ga0496124_0004757
1641 Ga0496124_0046616
1642 Ga0496124_0089253
1643 Ga0496124_0103257
1644 Ga0496124_0112070
1645 Ga0496124_0140982
1646 Ga0496124_0471383
1647 Ga0496125_0004760
1648 Ga0496125_0036084
1649 Ga0496126_0177411
1650 Ga0501308_000151
1651 Ga0501304_002999
1652 Ga0495678_000048
1653 Ga0495678_000050
1654 Ga0495678_000122
1655 Ga0495678_000257
1656 Ga0495682_0000144
1657 Ga0495682_0001333
1658 Ga0495682_0008506
1659 Ga0495682_0021606
1660 Ga0501297_039683
1661 Ga0501313_000568
1662 Ga0501315_000954
1663 Ga0501315_026364
1664 Ga0501034_0168575
1665 Ga0501034_1195480
1666 Ga0501036_0215315
1667 Ga0501047_0560030
1668 Ga0501206_012442
1669 Ga0501217_235619
1670 Ga0501222_005723
1671 Ga0501230_042323
1672 Ga0501236_069521
1673 Ga0501257_197828
1674 Ga0501221_083214
1675 Ga0501279_077020
1676 Ga0501035_0000613
1677 Ga0501204_040648
1678 Ga0501226_035316
1679 Ga0587084_014879
1680 Ga0587066_022117
1681 Ga0587070_031612
1682 Ga0587070_044477
1683 Ga0587080_008070
1684 Ga0587082_001204
1685 Ga0587082_035639
1686 Ga0587083_0008376
1687 Ga0587088_002006
1688 Ga0587090_020398
1689 Ga0587090_023613
1690 Ga0587098_005248
1691 Ga0587106_000728
1692 Ga0587125_004684
1693 Ga0587101_006472
1694 Ga0587067_011005
1695 Ga0587068_000200
1696 Ga0587069_001016
1697 Ga0587072_001324
1698 Ga0587076_018910
1699 Ga0587079_000185
1700 Ga0587079_039651
1701 Ga0587105_004475
1702 Ga0587107_004301
1703 Ga0587071_007542
1704 Ga0587111_0029589
1705 Ga0466962_0029931
1706 Ga0466962_0261738
1707 Ga0466962_0406063
1708 Ga0466962_0500924

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

22

98

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.9413 11 94
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.9338 10 95
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.9263 10 95
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.9212 10 96
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8866 11 93
ID Description Score Start End Superfamily
3o2eA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9413 11 94 3.30.300.90
af_Q3E793_13_109_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9319 12 94 3.30.300.90
af_Q5AKW1_24_116_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9317 9 95 3.30.300.90
4puiA01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9273 9 95 3.30.300.90
af_B6SIB6_2_91_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.921 12 96 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A6A5LGT2-F1-model_v4 deleted 0.9992 9 96
AF-A0A7Z2W095-F1-model_v4 BolA family transcriptional regulator 0.9986 7 96 GO:0016226
AF-A0A3M1AK59-F1-model_v4 BolA family transcriptional regulator 0.9929 8 90 GO:0005829
GO:0006351
AF-A0A346N0Y8-F1-model_v4 BolA family transcriptional regulator 0.9889 10 94 GO:0016226
AF-B5JWN7-F1-model_v4 Morphogene BolA protein 0.9888 9 94 GO:0016226

Map