F483598

General Info

Members Datasets Scaffolds Average Seq Length
854 443 784 317

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0094171|Ga0496122_0094171_675_1820
Length 381
Sequence MAWPKEWHCNHRYVGLYVLARNFVARYSGLGLPTLCGPKINPPGNDPGTAMMTGSATMNRPSVKRRVLALCTAAGFGIGLGFAALPAQAEAFITVLTGGTSGVYYPLGVALSNVYGKALPGAKVTAQATKASVENLNLLQAGRGEIGFTLGDSLSDAWKGNEEVGFKQKLDKLRTIAAIYPNYIQVVAAKESGIKTLADLKGKRVSVGAPKSGTELNARAIFGAAGLTYKDFAKTEYLPFGESVDLIKNRQLDATLISAGLGVAAIKDLSSSQEITVVSIPAELVQKVGDAAYITETIPAGTYPGQTEAVPTAAVRNLLVSHSGVSDDAAYAMTKTLFENLDALAAAHVAAKQIKLDQTATQSPVPLHPGAIKYFKEKGLM

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
3 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
4 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
5 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
6 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
7 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
8 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
9 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
10 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
11 2643221580 Devosia sp. Root635 Isolate Unclassified
12 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
13 2643221674 Devosia sp. Root436 Isolate Unclassified
14 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
15 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
16 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
17 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
18 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
19 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
20 2818991436 Collimonas arenae 515 Isolate Unclassified
21 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
22 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
23 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
24 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
25 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
26 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
27 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
28 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
29 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
30 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
31 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
32 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
33 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
34 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
35 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
36 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
37 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
38 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
39 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
40 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
41 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
42 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
43 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
44 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
45 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
46 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
47 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
48 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
49 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
50 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
51 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
52 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
53 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
54 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
55 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
56 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
60 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
61 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
62 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
67 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
71 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
74 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
75 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
76 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
77 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
81 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
82 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
83 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
86 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
87 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
88 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
91 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
94 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
95 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
96 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
97 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
98 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
99 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
100 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
101 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
102 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
103 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
104 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
105 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
106 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
107 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
108 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
109 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
110 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
111 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
112 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
113 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
114 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
115 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
116 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
117 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
118 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
119 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
120 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
121 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
122 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
123 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
124 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
125 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
126 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
127 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
128 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
129 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
130 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
131 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
132 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
133 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
134 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
135 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
136 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
137 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
138 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
139 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
140 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
141 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
142 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
169 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
170 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
171 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
184 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
186 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
188 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
249 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
255 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
259 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
260 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
261 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
262 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
263 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
264 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
265 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
266 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
267 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
268 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
271 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
274 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
275 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
276 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
277 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
278 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
279 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
280 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
281 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
283 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
284 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
285 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
286 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
287 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
289 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
290 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
291 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
292 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
293 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
294 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
295 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
296 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
297 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
298 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
299 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
300 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
301 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
302 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
303 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
304 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
305 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
306 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
307 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
308 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
309 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
310 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
311 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
312 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
313 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
314 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
315 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
316 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
317 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
318 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
319 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
320 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
321 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
322 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
323 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
324 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
328 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
329 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
330 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
331 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
332 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
333 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
334 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
335 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
336 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
337 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
338 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
339 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
340 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
341 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
342 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
343 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
346 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
356 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
357 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
360 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
361 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
362 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
363 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
364 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
365 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
368 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
369 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
383 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
384 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
385 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
386 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
387 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
388 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
402 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
403 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
404 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
405 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
406 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
407 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
408 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
409 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
410 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
411 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
412 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
413 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
414 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
416 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
419 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
422 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
423 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
424 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
425 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
426 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
435 639633007 Azoarcus olearius BH72 Isolate Unclassified
436 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
437 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
438 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
439 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
440 8052494512 Pseudomonas putida LD6 Isolate Unclassified
441 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
442 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
443 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.75
Metatranscriptomes 1.05
Isolates 8.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.75
Nodule 1.76
Rhizoplane 4.68
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 4.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25164J39214_1002902 3300002772 Bacteria 2366
2 JGI25406J46586_10043756 3300003203 Bacteria 1556
3 JGI25165J46597_1000030 3300003214 Bacteria 305254
4 rootH1_10090803 3300003323 Bacteria 1292
5 Ga0055538_1000017 3300003751 Bacteria 305254
6 Ga0055539_1000022 3300003752 Bacteria 305254
7 Ga0055533_1000030 3300003756 Bacteria 305254
8 Ga0055525_1000034 3300003759 Bacteria 305254
9 Ga0055536_1018774 3300003781 Bacteria 2201
10 Ga0055540_1003328 3300003792 Bacteria 7828
11 Ga0055531_10006103 3300003794 Bacteria 6899
12 Ga0055541_1000015 3300003841 Bacteria 305254
13 Ga0065714_10089262 3300005288 Bacteria 1986
14 Ga0070658_10017819 3300005327 Bacteria 5679
15 Ga0070676_10061476 3300005328 Bacteria 2233
16 Ga0070683_100013010 3300005329 Bacteria 7244
17 Ga0070683_100015845 3300005329 Bacteria 6630
18 Ga0070690_100001596 3300005330 Bacteria 11908
19 Ga0070690_100002584 3300005330 Bacteria 9748
20 Ga0070670_100006044 3300005331 Bacteria 10237
21 Ga0070670_100006491 3300005331 Bacteria 9901
22 Ga0070670_100030761 3300005331 Bacteria 4623
23 Ga0070670_100036804 3300005331 Bacteria 4211
24 Ga0070677_10087592 3300005333 Bacteria 1347
25 Ga0068869_100093136 3300005334 Bacteria 2269
26 Ga0070666_10029252 3300005335 Bacteria 3620
27 Ga0070666_10058733 3300005335 Bacteria 2601
28 Ga0070680_100027929 3300005336 Bacteria 4522
29 Ga0070680_100084024 3300005336 Bacteria 2629
30 Ga0070680_100145415 3300005336 Bacteria 1989
31 Ga0070682_100028485 3300005337 Bacteria 3360
32 Ga0068868_100008529 3300005338 Bacteria 7338
33 Ga0068868_100013751 3300005338 Bacteria 5946
34 Ga0068868_100068700 3300005338 Bacteria 2822
35 Ga0068868_100081917 3300005338 Bacteria 2588
36 Ga0070660_100004672 3300005339 Bacteria 9482
37 Ga0070660_100053054 3300005339 Bacteria 3126
38 Ga0070660_100099632 3300005339 Bacteria 2301
39 Ga0070660_100106735 3300005339 Bacteria 2224
40 Ga0070689_100021008 3300005340 Bacteria 4853
41 Ga0070687_100004394 3300005343 Bacteria 5616
42 Ga0070661_100002328 3300005344 Bacteria 13044
43 Ga0070661_100006323 3300005344 Bacteria 8170
44 Ga0070661_100054951 3300005344 Bacteria 2916
45 Ga0070661_100057040 3300005344 Bacteria 2862
46 Ga0070661_100058717 3300005344 Bacteria 2819
47 Ga0070661_100058950 3300005344 Bacteria 2814
48 Ga0070661_100134542 3300005344 Bacteria 1859
49 Ga0070692_10003709 3300005345 Bacteria 6264
50 Ga0070692_10113971 3300005345 Bacteria 1499
51 Ga0070692_10162336 3300005345 Bacteria 1281
52 Ga0070668_100029719 3300005347 Bacteria 4152
53 Ga0070669_100019131 3300005353 Bacteria 4895
54 Ga0070669_100195615 3300005353 Bacteria 1588
55 Ga0070675_100014162 3300005354 Bacteria 6286
56 Ga0070671_100040743 3300005355 Bacteria 3859
57 Ga0070671_100156319 3300005355 Bacteria 1926
58 Ga0070674_100090010 3300005356 Bacteria 2212
59 Ga0070674_100364470 3300005356 Bacteria 1171
60 Ga0070673_100004297 3300005364 Bacteria 8997
61 Ga0070673_100033870 3300005364 Bacteria 3860
62 Ga0070673_100096708 3300005364 Bacteria 2423
63 Ga0070688_100013185 3300005365 Bacteria 4654
64 Ga0070659_100008372 3300005366 Bacteria 7554
65 Ga0070659_100009606 3300005366 Bacteria 7110
66 Ga0070659_100013641 3300005366 Bacteria 6053
67 Ga0070659_100036790 3300005366 Bacteria 3816
68 Ga0070659_100079405 3300005366 Bacteria 2619
69 Ga0070659_100202068 3300005366 Bacteria 1636
70 Ga0070659_100384191 3300005366 Bacteria 1183
71 Ga0070667_100042899 3300005367 Bacteria 3795
72 Ga0070667_100140265 3300005367 Bacteria 2116
73 Ga0070709_10012700 3300005434 Bacteria 4717
74 Ga0070709_10021508 3300005434 Bacteria 3757
75 Ga0070709_10121651 3300005434 Bacteria 1770
76 Ga0070714_100000958 3300005435 Bacteria 20590
77 Ga0070714_100013339 3300005435 Bacteria 6585
78 Ga0070714_100185687 3300005435 Bacteria 1894
79 Ga0070713_100018721 3300005436 Bacteria 5267
80 Ga0070713_100130489 3300005436 Bacteria 2215
81 Ga0070710_10010103 3300005437 Bacteria 4631
82 Ga0070710_10046000 3300005437 Bacteria 2428
83 Ga0070701_10022204 3300005438 Bacteria 3040
84 Ga0070711_100002652 3300005439 Bacteria 10249
85 Ga0070705_100134515 3300005440 Bacteria 1618
86 Ga0070705_100188828 3300005440 Bacteria 1402
87 Ga0070694_100030783 3300005444 Bacteria 3513
88 Ga0070708_100023923 3300005445 Bacteria 5199
89 Ga0070663_100011218 3300005455 Bacteria 5614
90 Ga0070663_100027174 3300005455 Bacteria 3882
91 Ga0070663_100085494 3300005455 Bacteria 2328
92 Ga0070678_100002448 3300005456 Bacteria 10167
93 Ga0070678_100015132 3300005456 Bacteria 4893
94 Ga0070678_100203924 3300005456 Bacteria 1634
95 Ga0070662_100062593 3300005457 Bacteria 2719
96 Ga0070662_100199514 3300005457 Bacteria 1587
97 Ga0070662_100213688 3300005457 Bacteria 1536
98 Ga0070662_100267372 3300005457 Bacteria 1379
99 Ga0068867_100016181 3300005459 Bacteria 5298
100 Ga0068867_100303364 3300005459 Bacteria 1317
101 Ga0070685_10000875 3300005466 Bacteria 16309
102 Ga0070685_10004917 3300005466 Bacteria 6759
103 Ga0070706_100074933 3300005467 Bacteria 3132
104 Ga0070707_100048222 3300005468 Bacteria 4080
105 Ga0070698_100083905 3300005471 Bacteria 3175
106 Ga0070699_100007695 3300005518 Bacteria 9367
107 Ga0070679_100019673 3300005530 Bacteria 6570
108 Ga0070679_100053494 3300005530 Bacteria 4019
109 Ga0070679_100057106 3300005530 Bacteria 3890
110 Ga0070679_100062132 3300005530 Bacteria 3723
111 Ga0070679_100354092 3300005530 Bacteria 1415
112 Ga0070679_100540150 3300005530 Bacteria 1109
113 Ga0070684_100008174 3300005535 Bacteria 8172
114 Ga0070684_100019953 3300005535 Bacteria 5556
115 Ga0070684_100058203 3300005535 Bacteria 3377
116 Ga0070684_100112794 3300005535 Bacteria 2439
117 Ga0070697_100051730 3300005536 Bacteria 3338
118 Ga0068853_100037502 3300005539 Bacteria 4124
119 Ga0068853_100071377 3300005539 Bacteria 3024
120 Ga0068853_100088708 3300005539 Bacteria 2715
121 Ga0068853_100120104 3300005539 Bacteria 2343
122 Ga0070672_100034117 3300005543 Bacteria 3860
123 Ga0070672_100265956 3300005543 Bacteria 1447
124 Ga0070686_100079205 3300005544 Bacteria 2171
125 Ga0070695_100001413 3300005545 Bacteria 13309
126 Ga0070696_100038761 3300005546 Bacteria 3290
127 Ga0070693_100000736 3300005547 Bacteria 14434
128 Ga0070693_100016720 3300005547 Bacteria 3801
129 Ga0070693_100326110 3300005547 Bacteria 1043
130 Ga0070665_100002011 3300005548 Bacteria 22862
131 Ga0070665_100046504 3300005548 Bacteria 4359
132 Ga0070665_100284678 3300005548 Bacteria 1655
133 Ga0070704_100025569 3300005549 Bacteria 3888
134 Ga0068855_100004494 3300005563 Bacteria 17044
135 Ga0068855_100199948 3300005563 Bacteria 2250
136 Ga0070664_100000225 3300005564 Bacteria 40336
137 Ga0070664_100006637 3300005564 Bacteria 9333
138 Ga0070664_100010013 3300005564 Bacteria 7682
139 Ga0070664_100015585 3300005564 Bacteria 6219
140 Ga0070664_100033629 3300005564 Bacteria 4296
141 Ga0068857_100001492 3300005577 Bacteria 18627
142 Ga0068857_100014731 3300005577 Bacteria 6822
143 Ga0068857_100113712 3300005577 Bacteria 2434
144 Ga0068857_100124095 3300005577 Bacteria 2326
145 Ga0068857_100142569 3300005577 Bacteria 2166
146 Ga0068854_100002211 3300005578 Bacteria 11975
147 Ga0068854_100004576 3300005578 Bacteria 8721
148 Ga0068854_100016831 3300005578 Bacteria 4881
149 Ga0068854_100024525 3300005578 Bacteria 4130
150 Ga0068854_100042449 3300005578 Bacteria 3219
151 Ga0068854_100206615 3300005578 Bacteria 1547
152 Ga0068854_100334977 3300005578 Bacteria 1234
153 Ga0068856_100005098 3300005614 Bacteria 12982
154 Ga0068856_100017037 3300005614 Bacteria 7042
155 Ga0068856_100093545 3300005614 Bacteria 2991
156 Ga0068856_100114069 3300005614 Bacteria 2701
157 Ga0070702_100037966 3300005615 Bacteria 2678
158 Ga0068852_100001351 3300005616 Bacteria 16461
159 Ga0068852_100002563 3300005616 Bacteria 12518
160 Ga0068852_100006471 3300005616 Bacteria 8462
161 Ga0068852_100008012 3300005616 Bacteria 7748
162 Ga0068852_100018561 3300005616 Bacteria 5482
163 Ga0068852_100051932 3300005616 Bacteria 3521
164 Ga0068852_100110836 3300005616 Bacteria 2495
165 Ga0068852_100183356 3300005616 Bacteria 1970
166 Ga0068859_100005232 3300005617 Bacteria 13183
167 Ga0068859_100009836 3300005617 Bacteria 9653
168 Ga0068864_100004349 3300005618 Bacteria 11626
169 Ga0068864_100043697 3300005618 Bacteria 3837
170 Ga0068866_10003938 3300005718 Bacteria 6096
171 Ga0068851_10015469 3300005834 Bacteria 3635
172 Ga0068851_10016929 3300005834 Bacteria 3495
173 Ga0068851_10036048 3300005834 Bacteria 2476
174 Ga0068851_10037090 3300005834 Bacteria 2443
175 Ga0068851_10053657 3300005834 Bacteria 2053
176 Ga0068851_10069635 3300005834 Bacteria 1817
177 Ga0068851_10074997 3300005834 Bacteria 1757
178 Ga0068870_10000991 3300005840 Bacteria 11207
179 Ga0068863_100001667 3300005841 Bacteria 21948
180 Ga0068863_100048655 3300005841 Bacteria 4020
181 Ga0068858_100001809 3300005842 Bacteria 21766
182 Ga0068858_100050217 3300005842 Bacteria 3860
183 Ga0068860_100047590 3300005843 Bacteria 4087
184 Ga0068860_100223075 3300005843 Bacteria 1830
185 Ga0068860_100330497 3300005843 Bacteria 1497
186 Ga0068862_100004412 3300005844 Bacteria 11874
187 Ga0081455_10000438 3300005937 Bacteria 54690
188 Ga0081539_10001093 3300005985 Bacteria 49316
189 Ga0075365_10006849 3300006038 Bacteria 6320
190 Ga0070712_100016226 3300006175 Bacteria 4809
191 Ga0097621_100058781 3300006237 Bacteria 3146
192 Ga0097621_100066150 3300006237 Bacteria 2976
193 Ga0068871_100123984 3300006358 Bacteria 2185
194 Ga0068871_100142733 3300006358 Bacteria 2037
195 Ga0068871_100154363 3300006358 Bacteria 1959
196 Ga0068871_100226863 3300006358 Bacteria 1620
197 Ga0068865_100019122 3300006881 Bacteria 4430
198 Ga0068865_100052693 3300006881 Bacteria 2821
199 Ga0097620_100005232 3300006931 Bacteria 13183
200 Ga0097620_100009836 3300006931 Bacteria 9653
201 Ga0075435_100175954 3300007076 Bacteria 1807
202 Ga0105240_10002216 3300009093 Bacteria 31667
203 Ga0105240_10066377 3300009093 Bacteria 4476
204 Ga0105245_10162659 3300009098 Bacteria 2119
205 Ga0105247_10045703 3300009101 Bacteria 2687
206 Ga0105243_10057920 3300009148 Bacteria 3087
207 Ga0105243_10119272 3300009148 Bacteria 2221
208 Ga0105241_10001246 3300009174 Bacteria 19419
209 Ga0105241_10009600 3300009174 Bacteria 7113
210 Ga0105241_10041482 3300009174 Bacteria 3477
211 Ga0105242_10050907 3300009176 Bacteria 3374
212 Ga0105248_10002109 3300009177 Bacteria 22030
213 Ga0105248_10071495 3300009177 Bacteria 3898
214 Ga0105248_10120824 3300009177 Bacteria 2955
215 Ga0105237_10146314 3300009545 Bacteria 2358
216 Ga0105237_10188418 3300009545 Bacteria 2063
217 Ga0105238_10002109 3300009551 Bacteria 20087
218 Ga0105238_10086374 3300009551 Bacteria 3125
219 Ga0105238_10095199 3300009551 Bacteria 2965
220 Ga0105238_10120972 3300009551 Bacteria 2597
221 Ga0105249_10073643 3300009553 Bacteria 3160
222 Ga0105239_10168648 3300010375 Bacteria 2448
223 Ga0105239_10177751 3300010375 Bacteria 2381
224 Ga0105239_10208964 3300010375 Bacteria 2187
225 Ga0105246_10039608 3300011119 Bacteria 3176
226 Ga0105246_10093886 3300011119 Bacteria 2168
227 Ga0157373_10001504 3300013100 Bacteria 17780
228 Ga0157373_10026641 3300013100 Bacteria 4173
229 Ga0157373_10070413 3300013100 Bacteria 2471
230 Ga0157373_10096769 3300013100 Bacteria 2078
231 Ga0157371_10032051 3300013102 Bacteria 3784
232 Ga0157371_10038271 3300013102 Bacteria 3432
233 Ga0157371_10134147 3300013102 Bacteria 1763
234 Ga0157370_10010238 3300013104 Bacteria 9901
235 Ga0157370_10103891 3300013104 Bacteria 2659
236 Ga0157370_10117932 3300013104 Bacteria 2480
237 Ga0157370_10129658 3300013104 Bacteria 2353
238 Ga0157370_10137663 3300013104 Bacteria 2275
239 Ga0157370_10205073 3300013104 Bacteria 1828
240 Ga0157369_10001055 3300013105 Bacteria 34811
241 Ga0157369_10002700 3300013105 Bacteria 21159
242 Ga0157369_10004550 3300013105 Bacteria 16308
243 Ga0157369_10059854 3300013105 Bacteria 4108
244 Ga0157369_10130905 3300013105 Bacteria 2659
245 Ga0157369_10583568 3300013105 Bacteria 1154
246 Ga0157374_10001520 3300013296 Bacteria 19535
247 Ga0157374_10014729 3300013296 Bacteria 6848
248 Ga0157374_10016719 3300013296 Bacteria 6454
249 Ga0157374_10037164 3300013296 Bacteria 4467
250 Ga0157374_10170283 3300013296 Bacteria 2124
251 Ga0157378_10184572 3300013297 Bacteria 1964
252 Ga0163162_10051253 3300013306 Bacteria 4141
253 Ga0163162_10178027 3300013306 Bacteria 2252
254 Ga0157372_10003646 3300013307 Bacteria 16572
255 Ga0157372_10052848 3300013307 Bacteria 4526
256 Ga0157372_10143694 3300013307 Bacteria 2751
257 Ga0157372_10433971 3300013307 Bacteria 1531
258 Ga0157375_10043153 3300013308 Bacteria 4371
259 Ga0157375_10064445 3300013308 Bacteria 3648
260 Ga0157375_10149243 3300013308 Bacteria 2472
261 Ga0163163_10011448 3300014325 Bacteria 8047
262 Ga0163163_10019812 3300014325 Bacteria 6326
263 Ga0163163_10057467 3300014325 Bacteria 3847
264 Ga0182008_10034769 3300014497 Bacteria 2526
265 Ga0157377_10004960 3300014745 Bacteria 6204
266 Ga0157379_10063612 3300014968 Bacteria 3298
267 Ga0157379_10412934 3300014968 Bacteria 1242
268 Ga0157376_10197097 3300014969 Bacteria 1850
269 Ga0182006_1000143 3300015261 Bacteria 76634
270 Ga0182006_1003224 3300015261 Bacteria 8474
271 Ga0182006_1052987 3300015261 Bacteria 1557
272 Ga0182007_10004074 3300015262 Bacteria 6724
273 Ga0182005_1001051 3300015265 Bacteria 11687
274 Ga0163161_10035214 3300017792 Bacteria 3583
275 Ga0163161_10075531 3300017792 Bacteria 2473
276 Ga0209760_100791 3300025207 Bacteria 4385
277 Ga0209784_100034 3300025224 Bacteria 305504
278 Ga0209566_100038 3300025225 Bacteria 305504
279 Ga0209674_100056 3300025226 Bacteria 305504
280 Ga0209563_100057 3300025230 Bacteria 305604
281 Ga0207427_100288 3300025231 Bacteria 35935
282 Ga0209437_100071 3300025233 Bacteria 305604
283 Ga0209677_100035 3300025253 Bacteria 305504
284 Ga0209233_1000094 3300025261 Bacteria 305604
285 Ga0209676_1000590 3300025292 Bacteria 54164
286 Ga0209676_1004595 3300025292 Bacteria 7621
287 Ga0209758_1000191 3300025297 Bacteria 136984
288 Ga0209050_1014575 3300025298 Bacteria 3373
289 Ga0209051_1002129 3300025303 Bacteria 14756
290 Ga0209257_1002628 3300025304 Bacteria 17336
291 Ga0207697_10000014 3300025315 Bacteria 59917
292 Ga0207656_10006475 3300025321 Bacteria 4213
293 Ga0207656_10007607 3300025321 Bacteria 3955
294 Ga0207656_10049306 3300025321 Bacteria 1815
295 Ga0207656_10087064 3300025321 Bacteria 1412
296 Ga0207642_10025710 3300025899 Bacteria 2386
297 Ga0207710_10025741 3300025900 Bacteria 2540
298 Ga0207688_10021352 3300025901 Bacteria 3537
299 Ga0207688_10025126 3300025901 Bacteria 3269
300 Ga0207680_10032849 3300025903 Bacteria 2954
301 Ga0207680_10142655 3300025903 Bacteria 1589
302 Ga0207699_10066657 3300025906 Bacteria 2186
303 Ga0207645_10000272 3300025907 Bacteria 42718
304 Ga0207645_10043526 3300025907 Bacteria 2874
305 Ga0207643_10070437 3300025908 Bacteria 2011
306 Ga0207705_10038517 3300025909 Bacteria 3423
307 Ga0207705_10071543 3300025909 Bacteria 2514
308 Ga0207705_10157297 3300025909 Bacteria 1705
309 Ga0207684_10061717 3300025910 Bacteria 3183
310 Ga0207654_10021926 3300025911 Bacteria 3402
311 Ga0207654_10097868 3300025911 Bacteria 1802
312 Ga0207707_10003509 3300025912 Bacteria 13888
313 Ga0207707_10067275 3300025912 Bacteria 3120
314 Ga0207695_10005581 3300025913 Bacteria 16617
315 Ga0207695_10040873 3300025913 Bacteria 4967
316 Ga0207695_10054390 3300025913 Bacteria 4181
317 Ga0207671_10059136 3300025914 Bacteria 2841
318 Ga0207671_10227918 3300025914 Bacteria 1461
319 Ga0207693_10000153 3300025915 Bacteria 63886
320 Ga0207693_10009237 3300025915 Bacteria 8050
321 Ga0207663_10129265 3300025916 Bacteria 1743
322 Ga0207660_10098777 3300025917 Bacteria 2178
323 Ga0207660_10178621 3300025917 Bacteria 1647
324 Ga0207660_10296229 3300025917 Bacteria 1287
325 Ga0207657_10001195 3300025919 Bacteria 27622
326 Ga0207657_10004564 3300025919 Bacteria 14645
327 Ga0207657_10009458 3300025919 Bacteria 9793
328 Ga0207657_10054883 3300025919 Bacteria 3444
329 Ga0207657_10082316 3300025919 Bacteria 2702
330 Ga0207649_10007496 3300025920 Bacteria 5931
331 Ga0207649_10007682 3300025920 Bacteria 5865
332 Ga0207652_10002018 3300025921 Bacteria 17506
333 Ga0207652_10012436 3300025921 Bacteria 6879
334 Ga0207652_10205620 3300025921 Bacteria 1772
335 Ga0207646_10049291 3300025922 Bacteria 3773
336 Ga0207681_10014887 3300025923 Bacteria 4844
337 Ga0207681_10258143 3300025923 Bacteria 1363
338 Ga0207694_10017958 3300025924 Bacteria 5347
339 Ga0207694_10030434 3300025924 Bacteria 4122
340 Ga0207694_10205905 3300025924 Bacteria 1602
341 Ga0207650_10009121 3300025925 Bacteria 6779
342 Ga0207650_10020730 3300025925 Bacteria 4640
343 Ga0207650_10056502 3300025925 Bacteria 2916
344 Ga0207650_10312102 3300025925 Bacteria 1286
345 Ga0207659_10001243 3300025926 Bacteria 15264
346 Ga0207687_10041564 3300025927 Bacteria 3158
347 Ga0207700_10000031 3300025928 Bacteria 130086
348 Ga0207700_10077734 3300025928 Bacteria 2579
349 Ga0207664_10001923 3300025929 Bacteria 13641
350 Ga0207664_10002222 3300025929 Bacteria 12783
351 Ga0207664_10018572 3300025929 Bacteria 5123
352 Ga0207644_10014925 3300025931 Bacteria 5208
353 Ga0207644_10164857 3300025931 Bacteria 1725
354 Ga0207690_10010564 3300025932 Bacteria 5493
355 Ga0207690_10020114 3300025932 Bacteria 4120
356 Ga0207690_10032000 3300025932 Bacteria 3372
357 Ga0207690_10159178 3300025932 Bacteria 1682
358 Ga0207690_10238108 3300025932 Bacteria 1400
359 Ga0207706_10008764 3300025933 Bacteria 9310
360 Ga0207706_10045511 3300025933 Bacteria 3888
361 Ga0207706_10185248 3300025933 Bacteria 1828
362 Ga0207706_10252130 3300025933 Bacteria 1541
363 Ga0207686_10009489 3300025934 Bacteria 5280
364 Ga0207670_10011774 3300025936 Bacteria 5091
365 Ga0207669_10086145 3300025937 Bacteria 2030
366 Ga0207669_10250525 3300025937 Bacteria 1318
367 Ga0207704_10099245 3300025938 Bacteria 1936
368 Ga0207704_10250977 3300025938 Bacteria 1328
369 Ga0207665_10014257 3300025939 Bacteria 5232
370 Ga0207691_10028863 3300025940 Bacteria 5192
371 Ga0207691_10050250 3300025940 Bacteria 3818
372 Ga0207691_10275850 3300025940 Bacteria 1447
373 Ga0207711_10000677 3300025941 Bacteria 33809
374 Ga0207711_10002413 3300025941 Bacteria 16687
375 Ga0207711_10017384 3300025941 Bacteria 5974
376 Ga0207689_10000559 3300025942 Bacteria 35553
377 Ga0207689_10026713 3300025942 Bacteria 4836
378 Ga0207661_10050422 3300025944 Bacteria 3316
379 Ga0207661_10173745 3300025944 Bacteria 1877
380 Ga0207679_10002983 3300025945 Bacteria 10498
381 Ga0207679_10006832 3300025945 Bacteria 7235
382 Ga0207679_10022583 3300025945 Bacteria 4287
383 Ga0207679_10026584 3300025945 Bacteria 3992
384 Ga0207679_10074374 3300025945 Bacteria 2574
385 Ga0207667_10003655 3300025949 Bacteria 18970
386 Ga0207667_10013313 3300025949 Bacteria 9421
387 Ga0207667_10092686 3300025949 Bacteria 3120
388 Ga0207651_10001519 3300025960 Bacteria 10592
389 Ga0207651_10081577 3300025960 Bacteria 2331
390 Ga0207640_10010405 3300025981 Bacteria 5241
391 Ga0207640_10018156 3300025981 Bacteria 4128
392 Ga0207640_10057922 3300025981 Bacteria 2550
393 Ga0207640_10125451 3300025981 Bacteria 1847
394 Ga0207640_10166494 3300025981 Bacteria 1637
395 Ga0207640_10182996 3300025981 Bacteria 1573
396 Ga0207658_10030065 3300025986 Bacteria 3842
397 Ga0207658_10112669 3300025986 Bacteria 2153
398 Ga0207677_10000568 3300026023 Bacteria 23256
399 Ga0207677_10012228 3300026023 Bacteria 4925
400 Ga0207677_10095431 3300026023 Bacteria 2173
401 Ga0207703_10004124 3300026035 Bacteria 11994
402 Ga0207703_10042796 3300026035 Bacteria 3633
403 Ga0207639_10170261 3300026041 Bacteria 1844
404 Ga0207678_10050199 3300026067 Bacteria 3604
405 Ga0207678_10091146 3300026067 Bacteria 2605
406 Ga0207702_10023904 3300026078 Bacteria 5070
407 Ga0207702_10031508 3300026078 Bacteria 4419
408 Ga0207702_10047420 3300026078 Bacteria 3621
409 Ga0207702_10068761 3300026078 Bacteria 3043
410 Ga0207702_10082465 3300026078 Bacteria 2796
411 Ga0207702_10172822 3300026078 Bacteria 1983
412 Ga0207641_10015245 3300026088 Bacteria 6298
413 Ga0207641_10023943 3300026088 Bacteria 5033
414 Ga0207641_10386225 3300026088 Bacteria 1342
415 Ga0207648_10089654 3300026089 Bacteria 2687
416 Ga0207676_10000487 3300026095 Bacteria 33269
417 Ga0207676_10031852 3300026095 Bacteria 3967
418 Ga0207674_10000045 3300026116 Bacteria 122251
419 Ga0207674_10003080 3300026116 Bacteria 20626
420 Ga0207674_10005204 3300026116 Bacteria 15486
421 Ga0207674_10009680 3300026116 Bacteria 10984
422 Ga0207674_10110851 3300026116 Bacteria 2719
423 Ga0207683_10003159 3300026121 Bacteria 14381
424 Ga0207683_10045996 3300026121 Bacteria 3818
425 Ga0207683_10226824 3300026121 Bacteria 1703
426 Ga0207698_10001195 3300026142 Bacteria 15126
427 Ga0207698_10006291 3300026142 Bacteria 7389
428 Ga0207698_10029519 3300026142 Bacteria 3929
429 Ga0207698_10068341 3300026142 Bacteria 2805
430 Ga0207698_10076484 3300026142 Bacteria 2679
431 Ga0207698_10091066 3300026142 Bacteria 2495
432 Ga0209281_1002608 3300027111 Bacteria 6946
433 Ga0209371_1000073 3300027312 Bacteria 199474
434 Ga0209983_1022159 3300027665 Bacteria 1330
435 Ga0209971_1000590 3300027682 Bacteria 9450
436 Ga0209998_10000663 3300027717 Bacteria 9181
437 Ga0209974_10005077 3300027876 Bacteria 4650
438 Ga0207428_10138618 3300027907 Bacteria 1859
439 Ga0268266_10033065 3300028379 Bacteria 4397
440 Ga0268266_10092168 3300028379 Bacteria 2658
441 Ga0268266_10444116 3300028379 Bacteria 1232
442 Ga0268265_10180398 3300028380 Bacteria 1813
443 Ga0268264_10020012 3300028381 Bacteria 5467
444 Ga0268264_10112465 3300028381 Bacteria 2387
445 Ga0268256_1000125 3300030500 Bacteria 110255
446 Ga0316178_1001888 3300030735 Bacteria 10576
447 Ga0265332_10021705 3300031238 Bacteria 2835
448 Ga0265320_10001181 3300031240 Bacteria 19237
449 Ga0265325_10143663 3300031241 Bacteria 1133
450 Ga0265329_10014464 3300031242 Bacteria 2784
451 Ga0265331_10001334 3300031250 Bacteria 18265
452 Ga0307408_100000028 3300031548 Bacteria 233440
453 Ga0307408_100000042 3300031548 Bacteria 172505
454 Ga0307408_100194915 3300031548 Bacteria 1635
455 Ga0265314_10027078 3300031711 Bacteria 4297
456 Ga0307412_10099164 3300031911 Bacteria 2056
457 Ga0307409_100024624 3300031995 Bacteria 4202
458 Ga0307414_10001280 3300032004 Bacteria 12981
459 Ga0307414_10027440 3300032004 Bacteria 3680
460 Ga0307414_10411827 3300032004 Bacteria 1177
461 Ga0373934_0007016 3300035086 Bacteria 4178
462 Ga0373944_0039817 3300035089 Bacteria 1448
463 Ga0373923_0020146 3300035111 Bacteria 2588
464 Ga0373945_0010434 3300035116 Bacteria 3059
465 Ga0373953_0031632 3300035117 Bacteria 2059
466 Ga0373954_0023088 3300035118 Bacteria 2825
467 Ga0373956_0025875 3300035119 Bacteria 2538
468 Ga0373943_0043051 3300035170 Bacteria 2191
469 Ga0373946_0100662 3300035171 Bacteria 1295
470 Ga0373955_0016513 3300035172 Bacteria 3635
471 Ga0373955_0078201 3300035172 Bacteria 1864
472 Ga0373931_0118704 3300035691 Bacteria 1509
473 Ga0373935_0042472 3300035692 Bacteria 2859
474 Ga0373935_0072438 3300035692 Bacteria 2224
475 Ga0373927_0002553 3300035695 Bacteria 13269
476 Ga0373927_0120725 3300035695 Bacteria 1710
477 Ga0373933_0140652 3300035724 Bacteria 1524
478 Ga0373947_0105605 3300035725 Bacteria 1774
479 Ga0373937_0001059 3300036401 Bacteria 23216
480 Ga0373937_0037600 3300036401 Bacteria 4412
481 Ga0373937_0356820 3300036401 Bacteria 1385
482 Ga0373937_0406399 3300036401 Bacteria 1292
483 Ga0316584_0022046 3300036712 Bacteria 4641
484 Ga0373925_0032093 3300037068 Bacteria 3864
485 Ga0373925_0053454 3300037068 Bacteria 3019
486 Ga0373925_0102579 3300037068 Bacteria 2201
487 Ga0373925_0278705 3300037068 Bacteria 1346
488 Ga0395899_0000590 3300037312 Bacteria 38255
489 Ga0395899_0009384 3300037312 Bacteria 7513
490 Ga0395899_0010616 3300037312 Bacteria 7056
491 Ga0395899_0028074 3300037312 Bacteria 4238
492 Ga0395899_0040209 3300037312 Bacteria 3498
493 Ga0395900_0008216 3300037418 Bacteria 10745
494 Ga0395900_0018519 3300037418 Bacteria 7102
495 Ga0395900_0019772 3300037418 Bacteria 6863
496 Ga0395900_0336795 3300037418 Bacteria 1485
497 Ga0395898_0007300 3300037466 Bacteria 11732
498 Ga0395898_0059593 3300037466 Bacteria 3712
499 Ga0395898_0191471 3300037466 Bacteria 1954
500 Ga0395905_0163994 3300037471 Bacteria 2088
501 Ga0395901_0016591 3300038443 Bacteria 7505
502 Ga0395901_0298915 3300038443 Bacteria 1669
503 Ga0395901_0363899 3300038443 Bacteria 1491
504 Ga0439438_000325 3300041405 Bacteria 21449
505 Ga0439438_000523 3300041405 Bacteria 17389
506 Ga0439438_000560 3300041405 Bacteria 16976
507 Ga0439447_011363 3300041407 Bacteria 2602
508 Ga0439466_0006481 3300041411 Bacteria 4447
509 Ga0439466_0025101 3300041411 Bacteria 2083
510 Ga0439465_0014168 3300041413 Bacteria 2485
511 Ga0451853_1178748 3300041512 Bacteria 2133
512 Ga0439432_042769 3300042006 Bacteria 1431
513 Ga0439452_000107 3300042010 Bacteria 67397
514 Ga0439452_001101 3300042010 Bacteria 11897
515 Ga0439452_040282 3300042010 Bacteria 1102
516 Ga0439456_001944 3300042013 Bacteria 4163
517 Ga0450911_000010 3300042115 Bacteria 149605
518 Ga0450911_001859 3300042115 Bacteria 4471
519 Ga0450900_002531 3300042136 Bacteria 1948
520 Ga0450903_001468 3300042138 Bacteria 4395
521 Ga0450905_002036 3300042142 Bacteria 2580
522 Ga0450905_015374 3300042142 Bacteria 1097
523 Ga0450906_000096 3300042145 Bacteria 14819
524 Ga0450907_000858 3300042146 Bacteria 7357
525 Ga0439446_0002538 3300042156 Bacteria 4392
526 Ga0439464_0000304 3300042439 Bacteria 9337
527 Ga0439464_0001499 3300042439 Bacteria 5518
528 Ga0439464_0037521 3300042439 Bacteria 1374
529 Ga0439460_0004134 3300042461 Bacteria 3529
530 Ga0450918_015227 3300042531 Bacteria 1337
531 Ga0451577_0018682 3300042876 Bacteria 6380
532 Ga0451577_0038802 3300042876 Bacteria 4282
533 Ga0451577_0053265 3300042876 Bacteria 3612
534 Ga0451577_0110661 3300042876 Bacteria 2457
535 Ga0451577_0507799 3300042876 Bacteria 1095
536 Ga0466969_0082984 3300044656 Bacteria 1526
537 Ga0466972_0000162 3300044658 Bacteria 53301
538 Ga0466972_0065018 3300044658 Bacteria 1745
539 Ga0466963_0017345 3300044694 Bacteria 4487
540 Ga0466964_0039023 3300044706 Bacteria 1911
541 Ga0453684_0000006 3300044712 Bacteria 1364191
542 Ga0453684_0000410 3300044712 Bacteria 175627
543 Ga0453684_0190847 3300044712 Bacteria 2397
544 Ga0453684_0406506 3300044712 Bacteria 1524
545 Ga0466971_0128214 3300044719 Bacteria 1176
546 Ga0466970_0001930 3300044765 Bacteria 10024
547 Ga0466959_0000159 3300045049 Bacteria 44154
548 Ga0466959_0001957 3300045049 Bacteria 12981
549 Ga0451576_0000108 3300045051 Bacteria 211233
550 Ga0451576_0000695 3300045051 Bacteria 68253
551 Ga0451576_0393260 3300045051 Bacteria 1453
552 Ga0466967_0034676 3300045976 Bacteria 4286
553 Ga0495592_0124457 3300046454 Bacteria 1810
554 Ga0495591_001322 3300046458 Bacteria 15588
555 Ga0495638_0017612 3300046460 Bacteria 4758
556 Ga0495638_0156393 3300046460 Bacteria 1318
557 Ga0495651_0032726 3300046462 Bacteria 4054
558 Ga0495651_0072865 3300046462 Bacteria 2607
559 Ga0495580_0029333 3300046472 Bacteria 3994
560 Ga0495580_0110591 3300046472 Bacteria 1908
561 Ga0495605_0000128 3300046474 Bacteria 100439
562 Ga0495639_0012593 3300046475 Bacteria 3649
563 Ga0495662_0021664 3300046476 Bacteria 3105
564 Ga0495596_0041378 3300046500 Bacteria 1817
565 Ga0495607_0000197 3300046501 Bacteria 63955
566 Ga0495607_0005748 3300046501 Bacteria 8826
567 Ga0495607_0006748 3300046501 Bacteria 8026
568 Ga0495607_0118131 3300046501 Bacteria 1396
569 Ga0495583_0008522 3300046506 Bacteria 6256
570 Ga0495608_0005231 3300046511 Bacteria 9271
571 Ga0495610_0004661 3300046512 Bacteria 10029
572 Ga0495620_0000030 3300046515 Bacteria 122177
573 Ga0495620_0000148 3300046515 Bacteria 57242
574 Ga0495628_0006680 3300046516 Bacteria 10058
575 Ga0495628_0032233 3300046516 Bacteria 4232
576 Ga0495628_0087313 3300046516 Bacteria 2418
577 Ga0495632_0000553 3300046519 Bacteria 34975
578 Ga0495632_0017233 3300046519 Bacteria 3993
579 Ga0495632_0070201 3300046519 Bacteria 1685
580 Ga0495637_0000099 3300046520 Bacteria 66214
581 Ga0495637_0002768 3300046520 Bacteria 9514
582 Ga0495637_0013134 3300046520 Bacteria 3938
583 Ga0495637_0050308 3300046520 Bacteria 1748
584 Ga0495643_0000295 3300046522 Bacteria 70296
585 Ga0495643_0119682 3300046522 Bacteria 1331
586 Ga0495648_0001090 3300046524 Bacteria 27610
587 Ga0495648_0001324 3300046524 Bacteria 24557
588 Ga0495640_0106515 3300046533 Bacteria 1836
589 Ga0495609_0007997 3300046538 Bacteria 5221
590 Ga0495621_0010043 3300046539 Bacteria 2889
591 Ga0495645_0008700 3300046543 Bacteria 7088
592 Ga0495667_0145282 3300046559 Bacteria 1528
593 Ga0495668_0010420 3300046616 Bacteria 5624
594 Ga0495635_0175223 3300046663 Bacteria 1458
595 Ga0495661_0001554 3300046665 Bacteria 18936
596 Ga0495599_0012955 3300046678 Bacteria 5147
597 Ga0495623_0029623 3300046679 Bacteria 3522
598 Ga0495646_0011091 3300046680 Bacteria 5721
599 Ga0495647_0001415 3300046681 Bacteria 7411
600 Ga0495658_0117547 3300046683 Bacteria 1605
601 Ga0495613_0029582 3300046689 Bacteria 4072
602 Ga0495613_0248220 3300046689 Bacteria 1243
603 Ga0495671_0020446 3300046692 Bacteria 3487
604 Ga0495671_0058908 3300046692 Bacteria 1899
605 Ga0495649_0160278 3300046694 Bacteria 1179
606 Ga0495589_0014569 3300046794 Bacteria 4046
607 Ga0495600_0021968 3300046809 Bacteria 4093
608 Ga0495660_0006828 3300046810 Bacteria 6729
609 Ga0495604_0036323 3300047317 Bacteria 3884
610 Ga0495674_0062526 3300047319 Bacteria 3241
611 Ga0495676_0010575 3300047321 Bacteria 8358
612 Ga0495673_0002221 3300047469 Bacteria 13969
613 Ga0495684_0039446 3300047471 Bacteria 3620
614 Ga0495686_0012347 3300047472 Bacteria 5979
615 Ga0495686_0057459 3300047472 Bacteria 2428
616 Ga0495602_0079418 3300048088 Bacteria 2767
617 Ga0496100_0040251 3300048903 Bacteria 2972
618 Ga0496101_0282066 3300048904 Bacteria 1298
619 Ga0496102_0235332 3300048905 Bacteria 1727
620 Ga0496102_0405963 3300048905 Bacteria 1280
621 Ga0496104_0015271 3300048907 Bacteria 6954
622 Ga0496104_0016794 3300048907 Bacteria 6653
623 Ga0496104_0026147 3300048907 Bacteria 5385
624 Ga0496104_0039327 3300048907 Bacteria 4429
625 Ga0496105_0043714 3300048908 Bacteria 3695
626 Ga0496105_0052983 3300048908 Bacteria 3351
627 Ga0496105_0078221 3300048908 Bacteria 2731
628 Ga0496106_0186580 3300048909 Bacteria 1647
629 Ga0496107_0038750 3300048910 Bacteria 3418
630 Ga0496107_0163089 3300048910 Bacteria 1652
631 Ga0496108_0003315 3300048911 Bacteria 12939
632 Ga0496108_0132199 3300048911 Bacteria 2145
633 Ga0496108_0204446 3300048911 Unclassified 1714
634 Ga0496108_0267431 3300048911 Bacteria 1488
635 Ga0496109_0007561 3300048912 Bacteria 9209
636 Ga0496109_0106658 3300048912 Bacteria 2602
637 Ga0496110_0010533 3300048913 Bacteria 7527
638 Ga0496110_0075640 3300048913 Bacteria 2992
639 Ga0496110_0075816 3300048913 Bacteria 2989
640 Ga0496110_0095689 3300048913 Bacteria 2660
641 Ga0496111_0030170 3300048914 Bacteria 3856
642 Ga0496111_0065817 3300048914 Bacteria 2631
643 Ga0496112_0000710 3300048915 Bacteria 23117
644 Ga0496112_0082927 3300048915 Bacteria 3170
645 Ga0496112_0553231 3300048915 Unclassified 1084
646 Ga0496113_0022096 3300048916 Bacteria 4495
647 Ga0496113_0030699 3300048916 Bacteria 3892
648 Ga0496114_0017697 3300048917 Bacteria 5757
649 Ga0496114_0048145 3300048917 Bacteria 3546
650 Ga0496115_0099480 3300048918 Bacteria 2383
651 Ga0496117_0039805 3300048920 Bacteria 3465
652 Ga0496121_0029834 3300048924 Bacteria 5027
653 Ga0496122_0094171 3300048925 Bacteria 2029
654 Ga0496123_0109275 3300048926 Bacteria 1585
655 Ga0495678_000394 3300049459 Bacteria 44121
656 Ga0495682_0000014 3300049460 Bacteria 249706
657 Ga0501031_0000006 3300049568 Bacteria 176019
658 Ga0501031_0020152 3300049568 Bacteria 4346
659 Ga0501031_0021358 3300049568 Bacteria 4220
660 Ga0501031_0121797 3300049568 Bacteria 1704
661 Ga0501031_0129724 3300049568 Bacteria 1647
662 Ga0501032_0000016 3300049569 Bacteria 174688
663 Ga0501032_0000019 3300049569 Bacteria 155168
664 Ga0501032_0000663 3300049569 Bacteria 27949
665 Ga0501032_0049323 3300049569 Bacteria 2840
666 Ga0501032_0054646 3300049569 Bacteria 2687
667 Ga0501033_0000247 3300049570 Bacteria 52148
668 Ga0501033_0000304 3300049570 Bacteria 46485
669 Ga0501033_0001170 3300049570 Bacteria 23691
670 Ga0501033_0021429 3300049570 Bacteria 4875
671 Ga0501033_0028092 3300049570 Bacteria 4228
672 Ga0501033_0046990 3300049570 Bacteria 3210
673 Ga0501034_0000130 3300049571 Bacteria 139568
674 Ga0501034_0000243 3300049571 Bacteria 100637
675 Ga0501034_0000668 3300049571 Bacteria 52166
676 Ga0501034_0009787 3300049571 Bacteria 10025
677 Ga0501034_0043629 3300049571 Bacteria 4537
678 Ga0501034_0103352 3300049571 Bacteria 2842
679 Ga0501034_0131833 3300049571 Bacteria 2482
680 Ga0501034_0304326 3300049571 Bacteria 1530
681 Ga0501036_0000126 3300049572 Bacteria 48725
682 Ga0501036_0008112 3300049572 Bacteria 8606
683 Ga0501036_0020797 3300049572 Bacteria 5511
684 Ga0501036_0099308 3300049572 Bacteria 2462
685 Ga0501037_0000013 3300049573 Bacteria 174688
686 Ga0501037_0000154 3300049573 Bacteria 64077
687 Ga0501037_0000218 3300049573 Bacteria 50780
688 Ga0501037_0256063 3300049573 Bacteria 1224
689 Ga0501038_0000012 3300049574 Bacteria 174688
690 Ga0501038_0001991 3300049574 Bacteria 18870
691 Ga0501038_0014331 3300049574 Bacteria 7224
692 Ga0501038_0036570 3300049574 Bacteria 4308
693 Ga0501038_0046399 3300049574 Bacteria 3767
694 Ga0501039_0000019 3300049575 Bacteria 174688
695 Ga0501039_0000028 3300049575 Bacteria 139568
696 Ga0501039_0025670 3300049575 Bacteria 4528
697 Ga0501039_0035936 3300049575 Bacteria 3822
698 Ga0501040_0004900 3300049576 Bacteria 8661
699 Ga0501042_0100113 3300049578 Bacteria 2084
700 Ga0501042_0277663 3300049578 Bacteria 1210
701 Ga0501043_0000007 3300049579 Bacteria 224595
702 Ga0501043_0000113 3300049579 Bacteria 76112
703 Ga0501043_0000410 3300049579 Bacteria 38554
704 Ga0501043_0012683 3300049579 Bacteria 6591
705 Ga0501043_0020805 3300049579 Bacteria 5145
706 Ga0501043_0111469 3300049579 Bacteria 2148
707 Ga0501043_0269161 3300049579 Bacteria 1308
708 Ga0501046_0012937 3300049580 Bacteria 7092
709 Ga0501046_0014482 3300049580 Bacteria 6653
710 Ga0501046_0107510 3300049580 Bacteria 2134
711 Ga0501047_0001728 3300049581 Bacteria 21212
712 Ga0501047_0003138 3300049581 Bacteria 15680
713 Ga0501047_0053161 3300049581 Bacteria 3915
714 Ga0501047_0056141 3300049581 Bacteria 3807
715 Ga0501047_0082812 3300049581 Bacteria 3084
716 Ga0501067_0006027 3300049583 Bacteria 6721
717 Ga0501068_0011521 3300049584 Bacteria 4993
718 Ga0501069_0000027 3300049585 Bacteria 106217
719 Ga0501070_0000231 3300049586 Bacteria 52768
720 Ga0501070_0001716 3300049586 Bacteria 19386
721 Ga0501070_0009169 3300049586 Bacteria 8366
722 Ga0501070_0029060 3300049586 Bacteria 4636
723 Ga0501070_0039405 3300049586 Bacteria 3942
724 Ga0501070_0076266 3300049586 Bacteria 2775
725 Ga0501070_0132097 3300049586 Bacteria 2062
726 Ga0501071_0012648 3300049587 Bacteria 5733
727 Ga0501071_0394920 3300049587 Bacteria 1056
728 Ga0501072_0153380 3300049588 Bacteria 1837
729 Ga0501073_0011007 3300049589 Bacteria 6616
730 Ga0501073_0058680 3300049589 Bacteria 2689
731 Ga0501073_0181501 3300049589 Bacteria 1456
732 Ga0501073_0249726 3300049589 Bacteria 1225
733 Ga0501074_0000066 3300049590 Bacteria 50258
734 Ga0501074_0186541 3300049590 Bacteria 1479
735 Ga0501074_0250824 3300049590 Bacteria 1259
736 Ga0501238_008399 3300049671 Bacteria 1358
737 Ga0501080_0000667 3300049742 Bacteria 27300
738 Ga0501080_0028031 3300049742 Bacteria 5237
739 Ga0501080_0110001 3300049742 Bacteria 2554
740 Ga0501083_0000012 3300049744 Bacteria 178668
741 Ga0501083_0023679 3300049744 Bacteria 4258
742 Ga0501083_0087148 3300049744 Bacteria 2065
743 Ga0501269_002980 3300049766 Bacteria 2056
744 Ga0501280_003094 3300049776 Bacteria 2615
745 Ga0501035_0000073 3300049822 Bacteria 122603
746 Ga0501035_0000201 3300049822 Bacteria 72627
747 Ga0501035_0000409 3300049822 Bacteria 48705
748 Ga0501035_0012174 3300049822 Bacteria 7956
749 Ga0501035_0030611 3300049822 Bacteria 4905
750 Ga0501035_0059132 3300049822 Bacteria 3413
751 Ga0501035_0122870 3300049822 Bacteria 2268
752 Ga0501035_0127521 3300049822 Bacteria 2221
753 Ga0501044_0000029 3300049823 Bacteria 176024
754 Ga0501044_0000118 3300049823 Bacteria 95218
755 Ga0501044_0015872 3300049823 Bacteria 8105
756 Ga0501044_0038514 3300049823 Bacteria 4992
757 Ga0501044_0055127 3300049823 Bacteria 4083
758 Ga0501044_0098424 3300049823 Bacteria 2945
759 Ga0501044_0103501 3300049823 Bacteria 2861
760 Ga0501044_0142949 3300049823 Bacteria 2380
761 Ga0501044_0156620 3300049823 Bacteria 2257
762 nmdc:mga0yw44_441_c1 3300050492 Bacteria 14578
763 nmdc:mga0rr50_171112_c1 3300050513 Bacteria 1770
764 Ga0495601_0099729 3300053077 Bacteria 1875
765 Ga0495601_0105990 3300053077 Bacteria 1818
766 Ga0495595_0095717 3300053084 Bacteria 1429
767 Ga0495619_0019668 3300053085 Bacteria 4294
768 Ga0495619_0112421 3300053085 Bacteria 1862
769 Ga0500595_000447 3300053119 Bacteria 25711
770 Ga0500618_001639 3300053125 Bacteria 9634
771 Ga0500574_002511 3300053141 Bacteria 3038
772 Ga0500616_0000777 3300053153 Bacteria 36725
773 Ga0500619_000959 3300053154 Bacteria 4950
774 Ga0587080_015249 3300059503 Bacteria 1198
775 Ga0587082_005260 3300059504 Bacteria 1675
776 Ga0587082_015131 3300059504 Bacteria 1186
777 Ga0587083_0018239 3300059505 Bacteria 1266
778 Ga0587067_007907 3300059640 Bacteria 1537
779 Ga0587069_004016 3300059642 Bacteria 1631
780 Ga0587075_013315 3300059644 Bacteria 1130
781 Ga0587079_004637 3300059647 Bacteria 1886
782 Ga0587111_0004670 3300060346 Bacteria 2059
783 Ga0501082_0015316 3300060353 Bacteria 6601
784 Ga0501082_0080083 3300060353 Bacteria 2818

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003794 Ga0055531_10006103 Ga0055531_100061035 263
2 3300048908 Ga0496105_0078221 Ga0496105_0078221_135_962 275
3 3300048915 Ga0496112_0553231 Ga0496112_0553231_173_1000 275
4 3300044712 Ga0453684_0000410 Ga0453684_0000410_7421_8362 287
5 3300025949 Ga0207667_10092686 Ga0207667_100926862 297
6 3300015261 Ga0182006_1000143 Ga0182006_100014343 301
7 3300009148 Ga0105243_10119272 Ga0105243_101192722 303
8 3300014325 Ga0163163_10019812 Ga0163163_100198125 303
9 3300025901 Ga0207688_10021352 Ga0207688_100213522 303
10 3300048907 Ga0496104_0039327 Ga0496104_0039327_1430_2371 303
11 3300048913 Ga0496110_0010533 Ga0496110_0010533_1070_2011 303
12 3300048916 Ga0496113_0030699 Ga0496113_0030699_2444_3385 303
13 3300005288 Ga0065714_10089262 Ga0065714_100892622 304
14 3300035695 Ga0373927_0002553 Ga0373927_0002553_10999_11946 304
15 3300037068 Ga0373925_0102579 Ga0373925_0102579_732_1679 304
16 3300049568 Ga0501031_0000006 Ga0501031_0000006_30222_31178 304
17 3300049569 Ga0501032_0000016 Ga0501032_0000016_30227_31183 304
18 3300049570 Ga0501033_0000247 Ga0501033_0000247_30227_31183 304
19 3300049571 Ga0501034_0000668 Ga0501034_0000668_20966_21922 304
20 3300049572 Ga0501036_0000126 Ga0501036_0000126_22815_23771 304
21 3300049573 Ga0501037_0000013 Ga0501037_0000013_143506_144462 304
22 3300049574 Ga0501038_0000012 Ga0501038_0000012_143506_144462 304
23 3300049575 Ga0501039_0000019 Ga0501039_0000019_143506_144462 304
24 3300049576 Ga0501040_0004900 Ga0501040_0004900_1091_2047 304
25 3300049579 Ga0501043_0000410 Ga0501043_0000410_25089_26045 304
26 3300049580 Ga0501046_0012937 Ga0501046_0012937_2260_3216 304
27 3300049581 Ga0501047_0001728 Ga0501047_0001728_1173_2129 304
28 3300049586 Ga0501070_0132097 Ga0501070_0132097_155_1111 304
29 3300049822 Ga0501035_0000409 Ga0501035_0000409_22822_23778 304
30 3300049823 Ga0501044_0000029 Ga0501044_0000029_30227_31183 304
31 3300046460 Ga0495638_0156393 Ga0495638_0156393_124_1062 305
32 3300049590 Ga0501074_0250824 Ga0501074_0250824_14_934 305
33 3300044658 Ga0466972_0065018 Ga0466972_0065018_224_1183 306
34 3300048904 Ga0496101_0282066 Ga0496101_0282066_267_1199 306
35 3300005530 Ga0070679_100019673 Ga0070679_1000196736 308
36 3300049587 Ga0501071_0394920 Ga0501071_0394920_91_1032 308
37 3300049588 Ga0501072_0153380 Ga0501072_0153380_76_1017 308
38 iso_pu_bacteria 2522572158 2523102674 308
39 iso_pu_bacteria 2597490356 2599101154 308
40 iso_pu_bacteria 2846952575 2846954126 308
41 iso_pu_bacteria 2848858292 2848859598 308
42 iso_pu_bacteria 2869162929 2869168262 308
43 iso_pu_bacteria 2897803580 2897805620 308
44 3300025908 Ga0207643_10070437 Ga0207643_100704373 309
45 3300041413 Ga0439465_0014168 Ga0439465_0014168_897_1829 309
46 iso_pu_bacteria 2998344455 2998345001 309
47 3300005344 Ga0070661_100134542 Ga0070661_1001345421 310
48 3300005457 Ga0070662_100213688 Ga0070662_1002136881 310
49 3300005539 Ga0068853_100071377 Ga0068853_1000713773 310
50 3300005578 Ga0068854_100042449 Ga0068854_1000424493 310
51 3300005616 Ga0068852_100008012 Ga0068852_1000080123 310
52 3300013105 Ga0157369_10583568 Ga0157369_105835681 310
53 3300025933 Ga0207706_10252130 Ga0207706_102521302 310
54 3300025981 Ga0207640_10010405 Ga0207640_100104054 310
55 3300032004 Ga0307414_10411827 Ga0307414_104118271 310
56 3300041512 Ga0451853_1178748 Ga0451853_1178748_1077_2024 310
57 3300044712 Ga0453684_0406506 Ga0453684_0406506_486_1421 310
58 3300045051 Ga0451576_0393260 Ga0451576_0393260_361_1305 310
59 3300048907 Ga0496104_0026147 Ga0496104_0026147_2557_3501 310
60 3300048911 Ga0496108_0204446 Ga0496108_0204446_421_1365 310
61 3300048913 Ga0496110_0095689 Ga0496110_0095689_1531_2475 310
62 3300048914 Ga0496111_0065817 Ga0496111_0065817_321_1265 310
63 3300048915 Ga0496112_0082927 Ga0496112_0082927_429_1373 310
64 3300048916 Ga0496113_0022096 Ga0496113_0022096_1739_2683 310
65 3300048924 Ga0496121_0029834 Ga0496121_0029834_1420_2382 310
66 3300049571 Ga0501034_0000243 Ga0501034_0000243_32567_33634 310
67 3300049571 Ga0501034_0131833 Ga0501034_0131833_103_1059 310
68 iso_pu_bacteria 2643221580 2643913046 310
69 iso_pu_bacteria 2643221674 2644411500 310
70 iso_pu_bacteria 2937843397 2937844901 310
71 iso_pu_bacteria 639633007 639787066 310
72 3300003781 Ga0055536_1018774 Ga0055536_10187742 311
73 3300005338 Ga0068868_100081917 Ga0068868_1000819171 311
74 3300005616 Ga0068852_100002563 Ga0068852_10000256311 311
75 3300005834 Ga0068851_10069635 Ga0068851_100696352 311
76 3300006237 Ga0097621_100058781 Ga0097621_1000587813 311
77 3300006358 Ga0068871_100142733 Ga0068871_1001427331 311
78 3300025292 Ga0209676_1000590 Ga0209676_100059019 311
79 3300025298 Ga0209050_1014575 Ga0209050_10145752 311
80 3300025321 Ga0207656_10006475 Ga0207656_100064754 311
81 3300026023 Ga0207677_10095431 Ga0207677_100954312 311
82 3300026142 Ga0207698_10006291 Ga0207698_100062912 311
83 3300031240 Ga0265320_10001181 Ga0265320_100011814 311
84 3300031711 Ga0265314_10027078 Ga0265314_100270783 311
85 3300042876 Ga0451577_0018682 Ga0451577_0018682_518_1465 311
86 3300042876 Ga0451577_0038802 Ga0451577_0038802_778_1725 311
87 3300042876 Ga0451577_0110661 Ga0451577_0110661_366_1316 311
88 3300042876 Ga0451577_0507799 Ga0451577_0507799_21_965 311
89 3300044712 Ga0453684_0190847 Ga0453684_0190847_1303_2250 311
90 3300045051 Ga0451576_0000108 Ga0451576_0000108_198112_199062 311
91 3300045051 Ga0451576_0000695 Ga0451576_0000695_44310_45257 311
92 3300048907 Ga0496104_0015271 Ga0496104_0015271_317_1369 311
93 3300048913 Ga0496110_0075640 Ga0496110_0075640_237_1289 311
94 3300048920 Ga0496117_0039805 Ga0496117_0039805_2302_3351 311
95 3300049671 Ga0501238_008399 Ga0501238_008399_297_1247 311
96 iso_pu_bacteria 2522572158 2523103098 311
97 iso_pu_bacteria 2775506901 2776262338 311
98 iso_pu_bacteria 2882456835 2882458904 311
99 iso_pu_bacteria 8045864390 8045868823 311
100 3300005937 Ga0081455_10000438 Ga0081455_100004386 312
101 3300027111 Ga0209281_1002608 Ga0209281_10026083 312
102 3300027907 Ga0207428_10138618 Ga0207428_101386182 312
103 3300030735 Ga0316178_1001888 Ga0316178_10018889 312
104 3300031548 Ga0307408_100194915 Ga0307408_1001949151 312
105 3300031911 Ga0307412_10099164 Ga0307412_100991641 312
106 3300031995 Ga0307409_100024624 Ga0307409_1000246244 312
107 3300037068 Ga0373925_0278705 Ga0373925_0278705_225_1163 312
108 3300041405 Ga0439438_000325 Ga0439438_000325_17048_17998 312
109 3300041405 Ga0439438_000560 Ga0439438_000560_2000_2950 312
110 3300041407 Ga0439447_011363 Ga0439447_011363_280_1230 312
111 3300042006 Ga0439432_042769 Ga0439432_042769_137_1087 312
112 3300042010 Ga0439452_000107 Ga0439452_000107_17708_18658 312
113 3300042010 Ga0439452_040282 Ga0439452_040282_77_1027 312
114 3300042013 Ga0439456_001944 Ga0439456_001944_1655_2605 312
115 3300042115 Ga0450911_000010 Ga0450911_000010_59170_60120 312
116 3300042136 Ga0450900_002531 Ga0450900_002531_697_1647 312
117 3300042142 Ga0450905_015374 Ga0450905_015374_100_1050 312
118 3300042145 Ga0450906_000096 Ga0450906_000096_891_1841 312
119 3300042531 Ga0450918_015227 Ga0450918_015227_312_1262 312
120 3300044712 Ga0453684_0000006 Ga0453684_0000006_31094_32035 312
121 3300046500 Ga0495596_0041378 Ga0495596_0041378_675_1625 312
122 3300046512 Ga0495610_0004661 Ga0495610_0004661_5110_6060 312
123 3300046515 Ga0495620_0000030 Ga0495620_0000030_60480_61430 312
124 3300046519 Ga0495632_0000553 Ga0495632_0000553_31008_31958 312
125 3300046519 Ga0495632_0070201 Ga0495632_0070201_336_1286 312
126 3300046520 Ga0495637_0002768 Ga0495637_0002768_5145_6095 312
127 3300046522 Ga0495643_0000295 Ga0495643_0000295_59523_60473 312
128 3300046524 Ga0495648_0001090 Ga0495648_0001090_3195_4145 312
129 3300046538 Ga0495609_0007997 Ga0495609_0007997_3220_4170 312
130 3300046689 Ga0495613_0248220 Ga0495613_0248220_173_1126 312
131 3300047472 Ga0495686_0012347 Ga0495686_0012347_4592_5542 312
132 3300049568 Ga0501031_0020152 Ga0501031_0020152_692_1648 312
133 3300049568 Ga0501031_0021358 Ga0501031_0021358_2702_3658 312
134 3300049568 Ga0501031_0129724 Ga0501031_0129724_673_1629 312
135 3300049569 Ga0501032_0049323 Ga0501032_0049323_266_1216 312
136 3300049569 Ga0501032_0054646 Ga0501032_0054646_1573_2529 312
137 3300049570 Ga0501033_0021429 Ga0501033_0021429_3682_4638 312
138 3300049570 Ga0501033_0028092 Ga0501033_0028092_3114_4070 312
139 3300049570 Ga0501033_0046990 Ga0501033_0046990_2016_2966 312
140 3300049571 Ga0501034_0043629 Ga0501034_0043629_2890_3846 312
141 3300049571 Ga0501034_0103352 Ga0501034_0103352_159_1115 312
142 3300049572 Ga0501036_0020797 Ga0501036_0020797_1853_2809 312
143 3300049574 Ga0501038_0036570 Ga0501038_0036570_691_1647 312
144 3300049574 Ga0501038_0046399 Ga0501038_0046399_2720_3670 312
145 3300049575 Ga0501039_0025670 Ga0501039_0025670_255_1211 312
146 3300049575 Ga0501039_0035936 Ga0501039_0035936_168_1124 312
147 3300049579 Ga0501043_0012683 Ga0501043_0012683_4944_5900 312
148 3300049579 Ga0501043_0020805 Ga0501043_0020805_691_1647 312
149 3300049580 Ga0501046_0014482 Ga0501046_0014482_661_1617 312
150 3300049581 Ga0501047_0003138 Ga0501047_0003138_11022_11972 312
151 3300049581 Ga0501047_0053161 Ga0501047_0053161_431_1387 312
152 3300049586 Ga0501070_0001716 Ga0501070_0001716_958_1908 312
153 3300049586 Ga0501070_0029060 Ga0501070_0029060_1204_2160 312
154 3300049586 Ga0501070_0039405 Ga0501070_0039405_446_1402 312
155 3300049589 Ga0501073_0011007 Ga0501073_0011007_1545_2495 312
156 3300049589 Ga0501073_0181501 Ga0501073_0181501_352_1308 312
157 3300049589 Ga0501073_0249726 Ga0501073_0249726_190_1146 312
158 3300049742 Ga0501080_0028031 Ga0501080_0028031_3861_4817 312
159 3300049744 Ga0501083_0087148 Ga0501083_0087148_356_1312 312
160 3300049766 Ga0501269_002980 Ga0501269_002980_897_1847 312
161 3300049776 Ga0501280_003094 Ga0501280_003094_1166_2161 312
162 3300049822 Ga0501035_0030611 Ga0501035_0030611_84_1034 312
163 3300049823 Ga0501044_0015872 Ga0501044_0015872_2830_3780 312
164 3300049823 Ga0501044_0055127 Ga0501044_0055127_238_1194 312
165 3300049823 Ga0501044_0098424 Ga0501044_0098424_1967_2923 312
166 3300049823 Ga0501044_0103501 Ga0501044_0103501_1747_2703 312
167 3300060353 Ga0501082_0080083 Ga0501082_0080083_1710_2666 312
168 iso_pu_bacteria 2808606382 2808958625 312
169 iso_pu_bacteria 2818991436 2819542107 312
170 iso_pu_bacteria 2842832357 2842835216 312
171 iso_pu_bacteria 2883354860 2883357200 312
172 iso_pu_bacteria 2891633521 2891637500 312
173 iso_pu_bacteria 2998139840 2998142314 312
174 iso_pu_bacteria 3007511990 3007512101 312
175 iso_pu_bacteria 8005658619 8005662407 312
176 iso_pu_bacteria 8029995093 8029998384 312
177 iso_pu_bacteria 8052494512 8052498081 312
178 iso_pu_bacteria 8056166840 8056168755 312
179 iso_pu_bacteria 8056875544 8056879284 312
180 3300003203 JGI25406J46586_10043756 JGI25406J46586_100437562 313
181 3300003323 rootH1_10090803 rootH1_100908031 313
182 3300003792 Ga0055540_1003328 Ga0055540_10033285 313
183 3300005336 Ga0070680_100145415 Ga0070680_1001454152 313
184 3300005345 Ga0070692_10113971 Ga0070692_101139711 313
185 3300005530 Ga0070679_100540150 Ga0070679_1005401501 313
186 3300005985 Ga0081539_10001093 Ga0081539_1000109342 313
187 3300006038 Ga0075365_10006849 Ga0075365_100068493 313
188 3300013105 Ga0157369_10001055 Ga0157369_1000105527 313
189 3300013307 Ga0157372_10433971 Ga0157372_104339712 313
190 3300025292 Ga0209676_1004595 Ga0209676_10045957 313
191 3300025297 Ga0209758_1000191 Ga0209758_100019149 313
192 3300025303 Ga0209051_1002129 Ga0209051_10021294 313
193 3300025304 Ga0209257_1002628 Ga0209257_10026288 313
194 3300025917 Ga0207660_10098777 Ga0207660_100987771 313
195 3300025928 Ga0207700_10077734 Ga0207700_100777343 313
196 3300026078 Ga0207702_10172822 Ga0207702_101728222 313
197 3300028379 Ga0268266_10092168 Ga0268266_100921682 313
198 3300031548 Ga0307408_100000028 Ga0307408_10000002896 313
199 3300032004 Ga0307414_10001280 Ga0307414_100012808 313
200 3300032004 Ga0307414_10027440 Ga0307414_100274402 313
201 3300036401 Ga0373937_0001059 Ga0373937_0001059_12228_13178 313
202 3300036401 Ga0373937_0356820 Ga0373937_0356820_82_1035 313
203 3300036401 Ga0373937_0406399 Ga0373937_0406399_76_1029 313
204 3300037312 Ga0395899_0000590 Ga0395899_0000590_5428_6387 313
205 3300037312 Ga0395899_0010616 Ga0395899_0010616_5943_6902 313
206 3300037312 Ga0395899_0028074 Ga0395899_0028074_2830_3783 313
207 3300037418 Ga0395900_0008216 Ga0395900_0008216_1092_2045 313
208 3300037418 Ga0395900_0018519 Ga0395900_0018519_1130_2089 313
209 3300037418 Ga0395900_0019772 Ga0395900_0019772_3492_4451 313
210 3300037466 Ga0395898_0007300 Ga0395898_0007300_5293_6246 313
211 3300037466 Ga0395898_0059593 Ga0395898_0059593_2713_3672 313
212 3300037471 Ga0395905_0163994 Ga0395905_0163994_741_1700 313
213 3300038443 Ga0395901_0016591 Ga0395901_0016591_1260_2213 313
214 3300038443 Ga0395901_0298915 Ga0395901_0298915_560_1519 313
215 3300041405 Ga0439438_000523 Ga0439438_000523_3083_4036 313
216 3300041411 Ga0439466_0006481 Ga0439466_0006481_415_1368 313
217 3300042010 Ga0439452_001101 Ga0439452_001101_10670_11623 313
218 3300042115 Ga0450911_001859 Ga0450911_001859_3355_4308 313
219 3300042138 Ga0450903_001468 Ga0450903_001468_1220_2173 313
220 3300042142 Ga0450905_002036 Ga0450905_002036_1083_2036 313
221 3300042146 Ga0450907_000858 Ga0450907_000858_3155_4108 313
222 3300042439 Ga0439464_0001499 Ga0439464_0001499_3939_4892 313
223 3300042461 Ga0439460_0004134 Ga0439460_0004134_312_1265 313
224 3300044658 Ga0466972_0000162 Ga0466972_0000162_5151_6125 313
225 3300044706 Ga0466964_0039023 Ga0466964_0039023_304_1278 313
226 3300044765 Ga0466970_0001930 Ga0466970_0001930_7433_8392 313
227 3300045049 Ga0466959_0001957 Ga0466959_0001957_2258_3217 313
228 3300046458 Ga0495591_001322 Ga0495591_001322_9350_10303 313
229 3300046460 Ga0495638_0017612 Ga0495638_0017612_1335_2294 313
230 3300046474 Ga0495605_0000128 Ga0495605_0000128_77517_78470 313
231 3300046501 Ga0495607_0000197 Ga0495607_0000197_58281_59234 313
232 3300046501 Ga0495607_0005748 Ga0495607_0005748_777_1730 313
233 3300046501 Ga0495607_0006748 Ga0495607_0006748_6102_7055 313
234 3300046501 Ga0495607_0118131 Ga0495607_0118131_236_1189 313
235 3300046506 Ga0495583_0008522 Ga0495583_0008522_4210_5163 313
236 3300046515 Ga0495620_0000148 Ga0495620_0000148_4115_5068 313
237 3300046519 Ga0495632_0017233 Ga0495632_0017233_244_1197 313
238 3300046520 Ga0495637_0000099 Ga0495637_0000099_12745_13698 313
239 3300046520 Ga0495637_0013134 Ga0495637_0013134_2768_3721 313
240 3300046520 Ga0495637_0050308 Ga0495637_0050308_586_1578 313
241 3300046522 Ga0495643_0119682 Ga0495643_0119682_101_1054 313
242 3300046524 Ga0495648_0001324 Ga0495648_0001324_949_1902 313
243 3300046616 Ga0495668_0010420 Ga0495668_0010420_2673_3626 313
244 3300046665 Ga0495661_0001554 Ga0495661_0001554_11274_12227 313
245 3300046683 Ga0495658_0117547 Ga0495658_0117547_253_1206 313
246 3300046692 Ga0495671_0020446 Ga0495671_0020446_1883_2836 313
247 3300046692 Ga0495671_0058908 Ga0495671_0058908_751_1743 313
248 3300046694 Ga0495649_0160278 Ga0495649_0160278_61_1014 313
249 3300046794 Ga0495589_0014569 Ga0495589_0014569_2863_3816 313
250 3300046810 Ga0495660_0006828 Ga0495660_0006828_996_1949 313
251 3300047321 Ga0495676_0010575 Ga0495676_0010575_1796_2788 313
252 3300047469 Ga0495673_0002221 Ga0495673_0002221_4922_5875 313
253 3300047472 Ga0495686_0057459 Ga0495686_0057459_1245_2198 313
254 3300048925 Ga0496122_0094171 Ga0496122_0094171_675_1820 313
255 3300049459 Ga0495678_000394 Ga0495678_000394_11725_12678 313
256 3300049460 Ga0495682_0000014 Ga0495682_0000014_244700_245653 313
257 3300049568 Ga0501031_0121797 Ga0501031_0121797_101_1060 313
258 3300049569 Ga0501032_0000019 Ga0501032_0000019_28913_29872 313
259 3300049569 Ga0501032_0000663 Ga0501032_0000663_2091_3044 313
260 3300049570 Ga0501033_0000304 Ga0501033_0000304_39241_40194 313
261 3300049570 Ga0501033_0001170 Ga0501033_0001170_103_1062 313
262 3300049571 Ga0501034_0000130 Ga0501034_0000130_13313_14272 313
263 3300049571 Ga0501034_0304326 Ga0501034_0304326_68_1027 313
264 3300049572 Ga0501036_0008112 Ga0501036_0008112_85_1044 313
265 3300049572 Ga0501036_0099308 Ga0501036_0099308_1075_2082 313
266 3300049573 Ga0501037_0000154 Ga0501037_0000154_31637_32590 313
267 3300049573 Ga0501037_0000218 Ga0501037_0000218_11284_12243 313
268 3300049573 Ga0501037_0256063 Ga0501037_0256063_81_1088 313
269 3300049574 Ga0501038_0001991 Ga0501038_0001991_13313_14272 313
270 3300049574 Ga0501038_0014331 Ga0501038_0014331_153_1106 313
271 3300049575 Ga0501039_0000028 Ga0501039_0000028_125297_126256 313
272 3300049578 Ga0501042_0100113 Ga0501042_0100113_370_1419 313
273 3300049578 Ga0501042_0277663 Ga0501042_0277663_149_1108 313
274 3300049579 Ga0501043_0000007 Ga0501043_0000007_49914_50867 313
275 3300049579 Ga0501043_0000113 Ga0501043_0000113_33175_34134 313
276 3300049579 Ga0501043_0111469 Ga0501043_0111469_399_1352 313
277 3300049579 Ga0501043_0269161 Ga0501043_0269161_279_1262 313
278 3300049580 Ga0501046_0107510 Ga0501046_0107510_1004_2011 313
279 3300049581 Ga0501047_0056141 Ga0501047_0056141_705_1712 313
280 3300049581 Ga0501047_0082812 Ga0501047_0082812_948_1901 313
281 3300049583 Ga0501067_0006027 Ga0501067_0006027_5568_6521 313
282 3300049584 Ga0501068_0011521 Ga0501068_0011521_3973_4926 313
283 3300049585 Ga0501069_0000027 Ga0501069_0000027_55346_56299 313
284 3300049586 Ga0501070_0000231 Ga0501070_0000231_5904_6857 313
285 3300049586 Ga0501070_0009169 Ga0501070_0009169_3743_4696 313
286 3300049586 Ga0501070_0076266 Ga0501070_0076266_284_1237 313
287 3300049587 Ga0501071_0012648 Ga0501071_0012648_1812_2765 313
288 3300049589 Ga0501073_0058680 Ga0501073_0058680_49_1002 313
289 3300049590 Ga0501074_0000066 Ga0501074_0000066_5647_6600 313
290 3300049590 Ga0501074_0186541 Ga0501074_0186541_150_1097 313
291 3300049742 Ga0501080_0000667 Ga0501080_0000667_8262_9215 313
292 3300049742 Ga0501080_0110001 Ga0501080_0110001_317_1324 313
293 3300049744 Ga0501083_0000012 Ga0501083_0000012_127645_128598 313
294 3300049822 Ga0501035_0000073 Ga0501035_0000073_77413_78366 313
295 3300049822 Ga0501035_0000201 Ga0501035_0000201_33173_34132 313
296 3300049822 Ga0501035_0012174 Ga0501035_0012174_5503_6456 313
297 3300049822 Ga0501035_0059132 Ga0501035_0059132_606_1613 313
298 3300049822 Ga0501035_0122870 Ga0501035_0122870_913_1866 313
299 3300049822 Ga0501035_0127521 Ga0501035_0127521_907_1860 313
300 3300049823 Ga0501044_0000118 Ga0501044_0000118_44324_45277 313
301 3300049823 Ga0501044_0038514 Ga0501044_0038514_1450_2403 313
302 3300049823 Ga0501044_0142949 Ga0501044_0142949_178_1137 313
303 3300049823 Ga0501044_0156620 Ga0501044_0156620_927_1880 313
304 3300050492 nmdc:mga0yw44_441_c1 nmdc:mga0yw44_441_c1_4432_5412 313
305 3300053125 Ga0500618_001639 Ga0500618_001639_8537_9490 313
306 3300053153 Ga0500616_0000777 Ga0500616_0000777_4822_5793 313
307 3300059503 Ga0587080_015249 Ga0587080_015249_163_1122 313
308 3300059504 Ga0587082_005260 Ga0587082_005260_86_1045 313
309 3300059504 Ga0587082_015131 Ga0587082_015131_142_1101 313
310 3300059505 Ga0587083_0018239 Ga0587083_0018239_225_1184 313
311 3300059640 Ga0587067_007907 Ga0587067_007907_127_1086 313
312 3300059642 Ga0587069_004016 Ga0587069_004016_626_1585 313
313 3300059644 Ga0587075_013315 Ga0587075_013315_62_1021 313
314 3300059647 Ga0587079_004637 Ga0587079_004637_625_1584 313
315 3300060346 Ga0587111_0004670 Ga0587111_0004670_355_1314 313
316 3300060353 Ga0501082_0015316 Ga0501082_0015316_5542_6495 313
317 iso_pu_bacteria 2510917026 2511170425 313
318 iso_pu_bacteria 2511231221 2512035008 313
319 iso_pu_bacteria 2585427633 2585994656 313
320 iso_pu_bacteria 2585427634 2585999140 313
321 iso_pu_bacteria 2597489875 2597810774 313
322 iso_pu_bacteria 2600254954 2600446194 313
323 iso_pu_bacteria 2600255389 2602008004 313
324 iso_pu_bacteria 2643221564 2643836933 313
325 iso_pu_bacteria 2643221603 2644031503 313
326 iso_pu_bacteria 2808606377 2808929751 313
327 iso_pu_bacteria 2808606381 2808951670 313
328 iso_pu_bacteria 2808606385 2808979853 313
329 iso_pu_bacteria 2808606388 2808995573 313
330 iso_pu_bacteria 2823421272 2823421344 313
331 iso_pu_bacteria 2839993093 2839994842 313
332 iso_pu_bacteria 2852612431 2852614633 313
333 iso_pu_bacteria 2852667396 2852667629 313
334 iso_pu_bacteria 2854896431 2854898452 313
335 iso_pu_bacteria 2854916844 2854917773 313
336 iso_pu_bacteria 2860339153 2860339346 313
337 iso_pu_bacteria 2888350351 2888353332 313
338 iso_pu_bacteria 2889010040 2889015049 313
339 iso_pu_bacteria 2889016732 2889019877 313
340 iso_pu_bacteria 2906354277 2906355693 313
341 iso_pu_bacteria 2919171160 2919171885 313
342 iso_pu_bacteria 2919501602 2919502964 313
343 iso_pu_bacteria 2922130491 2922130745 313
344 iso_pu_bacteria 2926063275 2926064637 313
345 iso_pu_bacteria 2958100919 2958102448 313
346 iso_pu_bacteria 2958172287 2958174004 313
347 iso_pu_bacteria 2965119406 2965127532 313
348 iso_pu_bacteria 2979710463 2979717310 313
349 iso_pu_bacteria 2979742915 2979751602 313
350 iso_pu_bacteria 2987652177 2987658953 313
351 iso_pu_bacteria 8034962539 8034965514 313
352 iso_pu_bacteria 8054002106 8054008971 313
353 3300005328 Ga0070676_10061476 Ga0070676_100614761 314
354 3300005330 Ga0070690_100001596 Ga0070690_1000015962 314
355 3300005331 Ga0070670_100036804 Ga0070670_1000368042 314
356 3300005333 Ga0070677_10087592 Ga0070677_100875921 314
357 3300005334 Ga0068869_100093136 Ga0068869_1000931362 314
358 3300005335 Ga0070666_10058733 Ga0070666_100587332 314
359 3300005336 Ga0070680_100027929 Ga0070680_1000279292 314
360 3300005337 Ga0070682_100028485 Ga0070682_1000284852 314
361 3300005338 Ga0068868_100008529 Ga0068868_1000085297 314
362 3300005338 Ga0068868_100068700 Ga0068868_1000687002 314
363 3300005339 Ga0070660_100099632 Ga0070660_1000996322 314
364 3300005344 Ga0070661_100057040 Ga0070661_1000570402 314
365 3300005345 Ga0070692_10003709 Ga0070692_100037094 314
366 3300005345 Ga0070692_10162336 Ga0070692_101623361 314
367 3300005353 Ga0070669_100195615 Ga0070669_1001956151 314
368 3300005355 Ga0070671_100156319 Ga0070671_1001563192 314
369 3300005356 Ga0070674_100090010 Ga0070674_1000900102 314
370 3300005364 Ga0070673_100004297 Ga0070673_1000042975 314
371 3300005366 Ga0070659_100009606 Ga0070659_1000096067 314
372 3300005366 Ga0070659_100202068 Ga0070659_1002020682 314
373 3300005366 Ga0070659_100384191 Ga0070659_1003841911 314
374 3300005367 Ga0070667_100140265 Ga0070667_1001402651 314
375 3300005434 Ga0070709_10012700 Ga0070709_100127005 314
376 3300005434 Ga0070709_10021508 Ga0070709_100215082 314
377 3300005435 Ga0070714_100185687 Ga0070714_1001856872 314
378 3300005436 Ga0070713_100018721 Ga0070713_1000187214 314
379 3300005436 Ga0070713_100130489 Ga0070713_1001304892 314
380 3300005437 Ga0070710_10010103 Ga0070710_100101033 314
381 3300005437 Ga0070710_10046000 Ga0070710_100460002 314
382 3300005438 Ga0070701_10022204 Ga0070701_100222042 314
383 3300005439 Ga0070711_100002652 Ga0070711_1000026522 314
384 3300005440 Ga0070705_100134515 Ga0070705_1001345152 314
385 3300005440 Ga0070705_100188828 Ga0070705_1001888282 314
386 3300005444 Ga0070694_100030783 Ga0070694_1000307832 314
387 3300005445 Ga0070708_100023923 Ga0070708_1000239233 314
388 3300005455 Ga0070663_100011218 Ga0070663_1000112184 314
389 3300005455 Ga0070663_100085494 Ga0070663_1000854943 314
390 3300005456 Ga0070678_100002448 Ga0070678_10000244810 314
391 3300005457 Ga0070662_100199514 Ga0070662_1001995142 314
392 3300005457 Ga0070662_100267372 Ga0070662_1002673722 314
393 3300005459 Ga0068867_100016181 Ga0068867_1000161814 314
394 3300005459 Ga0068867_100303364 Ga0068867_1003033641 314
395 3300005466 Ga0070685_10000875 Ga0070685_1000087512 314
396 3300005467 Ga0070706_100074933 Ga0070706_1000749332 314
397 3300005468 Ga0070707_100048222 Ga0070707_1000482225 314
398 3300005471 Ga0070698_100083905 Ga0070698_1000839054 314
399 3300005518 Ga0070699_100007695 Ga0070699_1000076953 314
400 3300005530 Ga0070679_100062132 Ga0070679_1000621324 314
401 3300005535 Ga0070684_100058203 Ga0070684_1000582034 314
402 3300005536 Ga0070697_100051730 Ga0070697_1000517304 314
403 3300005539 Ga0068853_100037502 Ga0068853_1000375024 314
404 3300005543 Ga0070672_100265956 Ga0070672_1002659562 314
405 3300005545 Ga0070695_100001413 Ga0070695_1000014133 314
406 3300005546 Ga0070696_100038761 Ga0070696_1000387612 314
407 3300005547 Ga0070693_100000736 Ga0070693_10000073615 314
408 3300005548 Ga0070665_100002011 Ga0070665_10000201111 314
409 3300005549 Ga0070704_100025569 Ga0070704_1000255693 314
410 3300005563 Ga0068855_100199948 Ga0068855_1001999483 314
411 3300005564 Ga0070664_100033629 Ga0070664_1000336294 314
412 3300005577 Ga0068857_100142569 Ga0068857_1001425692 314
413 3300005578 Ga0068854_100004576 Ga0068854_1000045762 314
414 3300005578 Ga0068854_100016831 Ga0068854_1000168315 314
415 3300005614 Ga0068856_100093545 Ga0068856_1000935452 314
416 3300005614 Ga0068856_100114069 Ga0068856_1001140694 314
417 3300005615 Ga0070702_100037966 Ga0070702_1000379662 314
418 3300005616 Ga0068852_100051932 Ga0068852_1000519324 314
419 3300005616 Ga0068852_100110836 Ga0068852_1001108362 314
420 3300005617 Ga0068859_100005232 Ga0068859_1000052327 314
421 3300005618 Ga0068864_100004349 Ga0068864_1000043493 314
422 3300005718 Ga0068866_10003938 Ga0068866_100039382 314
423 3300005834 Ga0068851_10037090 Ga0068851_100370902 314
424 3300005841 Ga0068863_100001667 Ga0068863_10000166713 314
425 3300005842 Ga0068858_100001809 Ga0068858_10000180910 314
426 3300005843 Ga0068860_100223075 Ga0068860_1002230752 314
427 3300006175 Ga0070712_100016226 Ga0070712_1000162264 314
428 3300006237 Ga0097621_100066150 Ga0097621_1000661502 314
429 3300006358 Ga0068871_100154363 Ga0068871_1001543631 314
430 3300006358 Ga0068871_100226863 Ga0068871_1002268631 314
431 3300006881 Ga0068865_100019122 Ga0068865_1000191222 314
432 3300006931 Ga0097620_100005232 Ga0097620_1000052327 314
433 3300007076 Ga0075435_100175954 Ga0075435_1001759542 314
434 3300009093 Ga0105240_10066377 Ga0105240_100663772 314
435 3300009098 Ga0105245_10162659 Ga0105245_101626592 314
436 3300009101 Ga0105247_10045703 Ga0105247_100457033 314
437 3300009148 Ga0105243_10057920 Ga0105243_100579202 314
438 3300009174 Ga0105241_10041482 Ga0105241_100414824 314
439 3300009176 Ga0105242_10050907 Ga0105242_100509073 314
440 3300009177 Ga0105248_10120824 Ga0105248_101208242 314
441 3300009545 Ga0105237_10146314 Ga0105237_101463143 314
442 3300009551 Ga0105238_10086374 Ga0105238_100863742 314
443 3300009551 Ga0105238_10095199 Ga0105238_100951994 314
444 3300009553 Ga0105249_10073643 Ga0105249_100736432 314
445 3300010375 Ga0105239_10168648 Ga0105239_101686482 314
446 3300010375 Ga0105239_10177751 Ga0105239_101777513 314
447 3300011119 Ga0105246_10039608 Ga0105246_100396082 314
448 3300011119 Ga0105246_10093886 Ga0105246_100938862 314
449 3300013100 Ga0157373_10026641 Ga0157373_100266414 314
450 3300013100 Ga0157373_10070413 Ga0157373_100704132 314
451 3300013102 Ga0157371_10032051 Ga0157371_100320513 314
452 3300013104 Ga0157370_10010238 Ga0157370_100102381 314
453 3300013104 Ga0157370_10117932 Ga0157370_101179322 314
454 3300013104 Ga0157370_10137663 Ga0157370_101376632 314
455 3300013296 Ga0157374_10001520 Ga0157374_1000152011 314
456 3300013296 Ga0157374_10170283 Ga0157374_101702832 314
457 3300013297 Ga0157378_10184572 Ga0157378_101845722 314
458 3300013306 Ga0163162_10178027 Ga0163162_101780272 314
459 3300013307 Ga0157372_10143694 Ga0157372_101436942 314
460 3300013308 Ga0157375_10149243 Ga0157375_101492432 314
461 3300014325 Ga0163163_10011448 Ga0163163_100114487 314
462 3300014968 Ga0157379_10063612 Ga0157379_100636122 314
463 3300014969 Ga0157376_10197097 Ga0157376_101970972 314
464 3300015261 Ga0182006_1052987 Ga0182006_10529872 314
465 3300017792 Ga0163161_10035214 Ga0163161_100352141 314
466 3300025321 Ga0207656_10007607 Ga0207656_100076072 314
467 3300025899 Ga0207642_10025710 Ga0207642_100257101 314
468 3300025900 Ga0207710_10025741 Ga0207710_100257413 314
469 3300025903 Ga0207680_10032849 Ga0207680_100328493 314
470 3300025906 Ga0207699_10066657 Ga0207699_100666572 314
471 3300025907 Ga0207645_10043526 Ga0207645_100435262 314
472 3300025910 Ga0207684_10061717 Ga0207684_100617172 314
473 3300025911 Ga0207654_10097868 Ga0207654_100978682 314
474 3300025912 Ga0207707_10067275 Ga0207707_100672752 314
475 3300025913 Ga0207695_10054390 Ga0207695_100543902 314
476 3300025915 Ga0207693_10000153 Ga0207693_1000015357 314
477 3300025915 Ga0207693_10009237 Ga0207693_100092376 314
478 3300025916 Ga0207663_10129265 Ga0207663_101292652 314
479 3300025919 Ga0207657_10001195 Ga0207657_100011955 314
480 3300025921 Ga0207652_10205620 Ga0207652_102056201 314
481 3300025922 Ga0207646_10049291 Ga0207646_100492912 314
482 3300025923 Ga0207681_10258143 Ga0207681_102581432 314
483 3300025924 Ga0207694_10205905 Ga0207694_102059052 314
484 3300025925 Ga0207650_10312102 Ga0207650_103121022 314
485 3300025927 Ga0207687_10041564 Ga0207687_100415641 314
486 3300025928 Ga0207700_10000031 Ga0207700_1000003172 314
487 3300025929 Ga0207664_10001923 Ga0207664_100019235 314
488 3300025931 Ga0207644_10164857 Ga0207644_101648571 314
489 3300025933 Ga0207706_10008764 Ga0207706_100087647 314
490 3300025933 Ga0207706_10045511 Ga0207706_100455113 314
491 3300025934 Ga0207686_10009489 Ga0207686_100094894 314
492 3300025937 Ga0207669_10086145 Ga0207669_100861452 314
493 3300025938 Ga0207704_10250977 Ga0207704_102509771 314
494 3300025939 Ga0207665_10014257 Ga0207665_100142574 314
495 3300025940 Ga0207691_10275850 Ga0207691_102758501 314
496 3300025941 Ga0207711_10000677 Ga0207711_100006777 314
497 3300025942 Ga0207689_10026713 Ga0207689_100267133 314
498 3300025944 Ga0207661_10173745 Ga0207661_101737453 314
499 3300025945 Ga0207679_10074374 Ga0207679_100743742 314
500 3300025960 Ga0207651_10081577 Ga0207651_100815772 314
501 3300025981 Ga0207640_10057922 Ga0207640_100579222 314
502 3300025981 Ga0207640_10125451 Ga0207640_101254512 314
503 3300025986 Ga0207658_10112669 Ga0207658_101126692 314
504 3300026023 Ga0207677_10000568 Ga0207677_1000056814 314
505 3300026035 Ga0207703_10004124 Ga0207703_100041246 314
506 3300026067 Ga0207678_10091146 Ga0207678_100911461 314
507 3300026078 Ga0207702_10047420 Ga0207702_100474202 314
508 3300026078 Ga0207702_10068761 Ga0207702_100687612 314
509 3300026088 Ga0207641_10015245 Ga0207641_100152452 314
510 3300026089 Ga0207648_10089654 Ga0207648_100896544 314
511 3300026095 Ga0207676_10000487 Ga0207676_1000048734 314
512 3300026116 Ga0207674_10009680 Ga0207674_100096807 314
513 3300026121 Ga0207683_10003159 Ga0207683_100031596 314
514 3300026142 Ga0207698_10076484 Ga0207698_100764842 314
515 3300027312 Ga0209371_1000073 Ga0209371_1000073167 314
516 3300028381 Ga0268264_10112465 Ga0268264_101124653 314
517 3300030500 Ga0268256_1000125 Ga0268256_100012581 314
518 3300031238 Ga0265332_10021705 Ga0265332_100217052 314
519 3300031241 Ga0265325_10143663 Ga0265325_101436632 314
520 3300031242 Ga0265329_10014464 Ga0265329_100144643 314
521 3300031250 Ga0265331_10001334 Ga0265331_100013345 314
522 3300031548 Ga0307408_100000042 Ga0307408_10000004215 314
523 3300035086 Ga0373934_0007016 Ga0373934_0007016_3127_4074 314
524 3300035089 Ga0373944_0039817 Ga0373944_0039817_465_1412 314
525 3300035111 Ga0373923_0020146 Ga0373923_0020146_1341_2288 314
526 3300035116 Ga0373945_0010434 Ga0373945_0010434_455_1402 314
527 3300035117 Ga0373953_0031632 Ga0373953_0031632_796_1743 314
528 3300035118 Ga0373954_0023088 Ga0373954_0023088_698_1645 314
529 3300035119 Ga0373956_0025875 Ga0373956_0025875_608_1555 314
530 3300035170 Ga0373943_0043051 Ga0373943_0043051_877_1824 314
531 3300035171 Ga0373946_0100662 Ga0373946_0100662_264_1211 314
532 3300035172 Ga0373955_0016513 Ga0373955_0016513_2380_3327 314
533 3300035172 Ga0373955_0078201 Ga0373955_0078201_407_1354 314
534 3300035691 Ga0373931_0118704 Ga0373931_0118704_500_1447 314
535 3300035692 Ga0373935_0042472 Ga0373935_0042472_86_1033 314
536 3300035692 Ga0373935_0072438 Ga0373935_0072438_1131_2078 314
537 3300035695 Ga0373927_0120725 Ga0373927_0120725_29_976 314
538 3300035724 Ga0373933_0140652 Ga0373933_0140652_167_1114 314
539 3300035725 Ga0373947_0105605 Ga0373947_0105605_195_1142 314
540 3300036401 Ga0373937_0037600 Ga0373937_0037600_2022_2969 314
541 3300036712 Ga0316584_0022046 Ga0316584_0022046_436_1392 314
542 3300037068 Ga0373925_0032093 Ga0373925_0032093_1092_2039 314
543 3300037068 Ga0373925_0053454 Ga0373925_0053454_1220_2167 314
544 3300037312 Ga0395899_0040209 Ga0395899_0040209_212_1168 314
545 3300037418 Ga0395900_0336795 Ga0395900_0336795_501_1457 314
546 3300037466 Ga0395898_0191471 Ga0395898_0191471_427_1383 314
547 3300041411 Ga0439466_0025101 Ga0439466_0025101_653_1609 314
548 3300042156 Ga0439446_0002538 Ga0439446_0002538_3159_4196 314
549 3300042439 Ga0439464_0000304 Ga0439464_0000304_2280_3236 314
550 3300042439 Ga0439464_0037521 Ga0439464_0037521_204_1160 314
551 3300042876 Ga0451577_0053265 Ga0451577_0053265_513_1469 314
552 3300044656 Ga0466969_0082984 Ga0466969_0082984_208_1158 314
553 3300044694 Ga0466963_0017345 Ga0466963_0017345_148_1098 314
554 3300044719 Ga0466971_0128214 Ga0466971_0128214_196_1146 314
555 3300045049 Ga0466959_0000159 Ga0466959_0000159_3615_4565 314
556 3300045976 Ga0466967_0034676 Ga0466967_0034676_2185_3135 314
557 3300046472 Ga0495580_0029333 Ga0495580_0029333_2642_3598 314
558 3300046472 Ga0495580_0110591 Ga0495580_0110591_522_1469 314
559 3300046475 Ga0495639_0012593 Ga0495639_0012593_1741_2688 314
560 3300046476 Ga0495662_0021664 Ga0495662_0021664_1582_2529 314
561 3300046516 Ga0495628_0032233 Ga0495628_0032233_3097_4044 314
562 3300046516 Ga0495628_0087313 Ga0495628_0087313_965_1912 314
563 3300046533 Ga0495640_0106515 Ga0495640_0106515_595_1542 314
564 3300046539 Ga0495621_0010043 Ga0495621_0010043_1162_2109 314
565 3300046543 Ga0495645_0008700 Ga0495645_0008700_1388_2335 314
566 3300046559 Ga0495667_0145282 Ga0495667_0145282_310_1257 314
567 3300046681 Ga0495647_0001415 Ga0495647_0001415_4832_5779 314
568 3300046689 Ga0495613_0029582 Ga0495613_0029582_1328_2275 314
569 3300047471 Ga0495684_0039446 Ga0495684_0039446_575_1522 314
570 3300048905 Ga0496102_0235332 Ga0496102_0235332_268_1215 314
571 3300048905 Ga0496102_0405963 Ga0496102_0405963_223_1170 314
572 3300048908 Ga0496105_0052983 Ga0496105_0052983_1088_2035 314
573 3300048910 Ga0496107_0038750 Ga0496107_0038750_544_1491 314
574 3300048911 Ga0496108_0132199 Ga0496108_0132199_931_1878 314
575 3300048912 Ga0496109_0007561 Ga0496109_0007561_3523_4470 314
576 3300048915 Ga0496112_0000710 Ga0496112_0000710_19147_20094 314
577 3300048917 Ga0496114_0048145 Ga0496114_0048145_967_1914 314
578 3300048918 Ga0496115_0099480 Ga0496115_0099480_329_1276 314
579 3300048926 Ga0496123_0109275 Ga0496123_0109275_139_1095 314
580 3300049571 Ga0501034_0009787 Ga0501034_0009787_605_1567 314
581 3300049744 Ga0501083_0023679 Ga0501083_0023679_3174_4133 314
582 3300050513 nmdc:mga0rr50_171112_c1 nmdc:mga0rr50_171112_c1_175_1122 314
583 3300053077 Ga0495601_0099729 Ga0495601_0099729_274_1221 314
584 3300053077 Ga0495601_0105990 Ga0495601_0105990_389_1345 314
585 3300053084 Ga0495595_0095717 Ga0495595_0095717_451_1398 314
586 3300053085 Ga0495619_0019668 Ga0495619_0019668_1469_2416 314
587 3300053085 Ga0495619_0112421 Ga0495619_0112421_687_1634 314
588 iso_pu_bacteria 2600254954 2600446396 314
589 iso_pu_bacteria 2600255389 2602010545 314
590 iso_pu_bacteria 2823421272 2823423081 314
591 iso_pu_bacteria 2919501602 2919505513 314
592 iso_pu_bacteria 2926063275 2926067190 314
593 iso_pu_bacteria 3007315729 3007316218 314
594 iso_pu_bacteria 8034962539 8034963993 314
595 3300005327 Ga0070658_10017819 Ga0070658_100178195 315
596 3300005329 Ga0070683_100013010 Ga0070683_1000130106 315
597 3300005329 Ga0070683_100015845 Ga0070683_1000158454 315
598 3300005330 Ga0070690_100002584 Ga0070690_1000025843 315
599 3300005331 Ga0070670_100006044 Ga0070670_1000060445 315
600 3300005331 Ga0070670_100006491 Ga0070670_1000064913 315
601 3300005331 Ga0070670_100030761 Ga0070670_1000307614 315
602 3300005335 Ga0070666_10029252 Ga0070666_100292523 315
603 3300005336 Ga0070680_100084024 Ga0070680_1000840242 315
604 3300005338 Ga0068868_100013751 Ga0068868_1000137514 315
605 3300005339 Ga0070660_100004672 Ga0070660_1000046722 315
606 3300005339 Ga0070660_100053054 Ga0070660_1000530542 315
607 3300005339 Ga0070660_100106735 Ga0070660_1001067352 315
608 3300005340 Ga0070689_100021008 Ga0070689_1000210085 315
609 3300005343 Ga0070687_100004394 Ga0070687_1000043944 315
610 3300005344 Ga0070661_100002328 Ga0070661_10000232811 315
611 3300005344 Ga0070661_100006323 Ga0070661_1000063239 315
612 3300005344 Ga0070661_100054951 Ga0070661_1000549512 315
613 3300005344 Ga0070661_100058717 Ga0070661_1000587172 315
614 3300005344 Ga0070661_100058950 Ga0070661_1000589502 315
615 3300005347 Ga0070668_100029719 Ga0070668_1000297194 315
616 3300005353 Ga0070669_100019131 Ga0070669_1000191312 315
617 3300005354 Ga0070675_100014162 Ga0070675_1000141624 315
618 3300005355 Ga0070671_100040743 Ga0070671_1000407434 315
619 3300005356 Ga0070674_100364470 Ga0070674_1003644701 315
620 3300005364 Ga0070673_100033870 Ga0070673_1000338704 315
621 3300005364 Ga0070673_100096708 Ga0070673_1000967082 315
622 3300005365 Ga0070688_100013185 Ga0070688_1000131853 315
623 3300005366 Ga0070659_100008372 Ga0070659_1000083729 315
624 3300005366 Ga0070659_100013641 Ga0070659_1000136414 315
625 3300005366 Ga0070659_100036790 Ga0070659_1000367903 315
626 3300005366 Ga0070659_100079405 Ga0070659_1000794052 315
627 3300005367 Ga0070667_100042899 Ga0070667_1000428994 315
628 3300005434 Ga0070709_10121651 Ga0070709_101216512 315
629 3300005435 Ga0070714_100000958 Ga0070714_1000009589 315
630 3300005435 Ga0070714_100013339 Ga0070714_1000133397 315
631 3300005455 Ga0070663_100027174 Ga0070663_1000271743 315
632 3300005456 Ga0070678_100015132 Ga0070678_1000151325 315
633 3300005456 Ga0070678_100203924 Ga0070678_1002039242 315
634 3300005457 Ga0070662_100062593 Ga0070662_1000625932 315
635 3300005466 Ga0070685_10004917 Ga0070685_100049177 315
636 3300005530 Ga0070679_100053494 Ga0070679_1000534942 315
637 3300005530 Ga0070679_100057106 Ga0070679_1000571064 315
638 3300005530 Ga0070679_100354092 Ga0070679_1003540922 315
639 3300005535 Ga0070684_100008174 Ga0070684_1000081745 315
640 3300005535 Ga0070684_100019953 Ga0070684_1000199535 315
641 3300005535 Ga0070684_100112794 Ga0070684_1001127942 315
642 3300005539 Ga0068853_100088708 Ga0068853_1000887082 315
643 3300005539 Ga0068853_100120104 Ga0068853_1001201042 315
644 3300005543 Ga0070672_100034117 Ga0070672_1000341174 315
645 3300005544 Ga0070686_100079205 Ga0070686_1000792052 315
646 3300005547 Ga0070693_100016720 Ga0070693_1000167205 315
647 3300005547 Ga0070693_100326110 Ga0070693_1003261101 315
648 3300005548 Ga0070665_100046504 Ga0070665_1000465044 315
649 3300005548 Ga0070665_100284678 Ga0070665_1002846782 315
650 3300005563 Ga0068855_100004494 Ga0068855_1000044945 315
651 3300005564 Ga0070664_100000225 Ga0070664_10000022517 315
652 3300005564 Ga0070664_100006637 Ga0070664_1000066374 315
653 3300005564 Ga0070664_100010013 Ga0070664_1000100133 315
654 3300005564 Ga0070664_100015585 Ga0070664_1000155852 315
655 3300005577 Ga0068857_100001492 Ga0068857_10000149213 315
656 3300005577 Ga0068857_100014731 Ga0068857_1000147314 315
657 3300005577 Ga0068857_100113712 Ga0068857_1001137122 315
658 3300005577 Ga0068857_100124095 Ga0068857_1001240952 315
659 3300005578 Ga0068854_100002211 Ga0068854_1000022112 315
660 3300005578 Ga0068854_100024525 Ga0068854_1000245252 315
661 3300005578 Ga0068854_100206615 Ga0068854_1002066152 315
662 3300005578 Ga0068854_100334977 Ga0068854_1003349772 315
663 3300005614 Ga0068856_100005098 Ga0068856_1000050989 315
664 3300005614 Ga0068856_100017037 Ga0068856_1000170373 315
665 3300005616 Ga0068852_100001351 Ga0068852_1000013514 315
666 3300005616 Ga0068852_100006471 Ga0068852_1000064713 315
667 3300005616 Ga0068852_100018561 Ga0068852_1000185616 315
668 3300005616 Ga0068852_100183356 Ga0068852_1001833562 315
669 3300005617 Ga0068859_100009836 Ga0068859_1000098365 315
670 3300005618 Ga0068864_100043697 Ga0068864_1000436974 315
671 3300005834 Ga0068851_10015469 Ga0068851_100154693 315
672 3300005834 Ga0068851_10016929 Ga0068851_100169293 315
673 3300005834 Ga0068851_10036048 Ga0068851_100360483 315
674 3300005834 Ga0068851_10053657 Ga0068851_100536572 315
675 3300005834 Ga0068851_10074997 Ga0068851_100749972 315
676 3300005840 Ga0068870_10000991 Ga0068870_100009912 315
677 3300005841 Ga0068863_100048655 Ga0068863_1000486554 315
678 3300005842 Ga0068858_100050217 Ga0068858_1000502174 315
679 3300005843 Ga0068860_100047590 Ga0068860_1000475904 315
680 3300005843 Ga0068860_100330497 Ga0068860_1003304972 315
681 3300005844 Ga0068862_100004412 Ga0068862_1000044125 315
682 3300006358 Ga0068871_100123984 Ga0068871_1001239841 315
683 3300006881 Ga0068865_100052693 Ga0068865_1000526932 315
684 3300006931 Ga0097620_100009836 Ga0097620_1000098365 315
685 3300009093 Ga0105240_10002216 Ga0105240_1000221611 315
686 3300009174 Ga0105241_10001246 Ga0105241_100012468 315
687 3300009174 Ga0105241_10009600 Ga0105241_100096006 315
688 3300009177 Ga0105248_10002109 Ga0105248_100021092 315
689 3300009177 Ga0105248_10071495 Ga0105248_100714954 315
690 3300009545 Ga0105237_10188418 Ga0105237_101884182 315
691 3300009551 Ga0105238_10002109 Ga0105238_1000210917 315
692 3300009551 Ga0105238_10120972 Ga0105238_101209722 315
693 3300010375 Ga0105239_10208964 Ga0105239_102089642 315
694 3300013100 Ga0157373_10001504 Ga0157373_1000150414 315
695 3300013100 Ga0157373_10096769 Ga0157373_100967692 315
696 3300013102 Ga0157371_10038271 Ga0157371_100382713 315
697 3300013102 Ga0157371_10134147 Ga0157371_101341472 315
698 3300013104 Ga0157370_10103891 Ga0157370_101038912 315
699 3300013104 Ga0157370_10129658 Ga0157370_101296581 315
700 3300013104 Ga0157370_10205073 Ga0157370_102050732 315
701 3300013105 Ga0157369_10002700 Ga0157369_100027004 315
702 3300013105 Ga0157369_10004550 Ga0157369_100045503 315
703 3300013105 Ga0157369_10059854 Ga0157369_100598542 315
704 3300013105 Ga0157369_10130905 Ga0157369_101309052 315
705 3300013296 Ga0157374_10014729 Ga0157374_100147292 315
706 3300013296 Ga0157374_10016719 Ga0157374_100167192 315
707 3300013296 Ga0157374_10037164 Ga0157374_100371642 315
708 3300013306 Ga0163162_10051253 Ga0163162_100512532 315
709 3300013307 Ga0157372_10003646 Ga0157372_1000364610 315
710 3300013307 Ga0157372_10052848 Ga0157372_100528482 315
711 3300013308 Ga0157375_10043153 Ga0157375_100431533 315
712 3300013308 Ga0157375_10064445 Ga0157375_100644451 315
713 3300014325 Ga0163163_10057467 Ga0163163_100574672 315
714 3300014745 Ga0157377_10004960 Ga0157377_100049602 315
715 3300014968 Ga0157379_10412934 Ga0157379_104129342 315
716 3300017792 Ga0163161_10075531 Ga0163161_100755312 315
717 3300025315 Ga0207697_10000014 Ga0207697_1000001439 315
718 3300025321 Ga0207656_10049306 Ga0207656_100493062 315
719 3300025321 Ga0207656_10087064 Ga0207656_100870642 315
720 3300025901 Ga0207688_10025126 Ga0207688_100251262 315
721 3300025903 Ga0207680_10142655 Ga0207680_101426552 315
722 3300025907 Ga0207645_10000272 Ga0207645_1000027241 315
723 3300025909 Ga0207705_10038517 Ga0207705_100385172 315
724 3300025909 Ga0207705_10071543 Ga0207705_100715433 315
725 3300025909 Ga0207705_10157297 Ga0207705_101572972 315
726 3300025911 Ga0207654_10021926 Ga0207654_100219262 315
727 3300025912 Ga0207707_10003509 Ga0207707_1000350912 315
728 3300025913 Ga0207695_10005581 Ga0207695_1000558110 315
729 3300025913 Ga0207695_10040873 Ga0207695_100408734 315
730 3300025914 Ga0207671_10059136 Ga0207671_100591362 315
731 3300025914 Ga0207671_10227918 Ga0207671_102279181 315
732 3300025917 Ga0207660_10178621 Ga0207660_101786212 315
733 3300025917 Ga0207660_10296229 Ga0207660_102962291 315
734 3300025919 Ga0207657_10004564 Ga0207657_100045642 315
735 3300025919 Ga0207657_10009458 Ga0207657_100094589 315
736 3300025919 Ga0207657_10054883 Ga0207657_100548832 315
737 3300025919 Ga0207657_10082316 Ga0207657_100823163 315
738 3300025920 Ga0207649_10007496 Ga0207649_100074965 315
739 3300025920 Ga0207649_10007682 Ga0207649_100076826 315
740 3300025921 Ga0207652_10002018 Ga0207652_1000201811 315
741 3300025921 Ga0207652_10012436 Ga0207652_100124365 315
742 3300025923 Ga0207681_10014887 Ga0207681_100148872 315
743 3300025924 Ga0207694_10017958 Ga0207694_100179584 315
744 3300025924 Ga0207694_10030434 Ga0207694_100304341 315
745 3300025925 Ga0207650_10009121 Ga0207650_100091216 315
746 3300025925 Ga0207650_10020730 Ga0207650_100207303 315
747 3300025925 Ga0207650_10056502 Ga0207650_100565021 315
748 3300025926 Ga0207659_10001243 Ga0207659_1000124315 315
749 3300025929 Ga0207664_10002222 Ga0207664_100022229 315
750 3300025929 Ga0207664_10018572 Ga0207664_100185725 315
751 3300025931 Ga0207644_10014925 Ga0207644_100149254 315
752 3300025932 Ga0207690_10010564 Ga0207690_100105644 315
753 3300025932 Ga0207690_10020114 Ga0207690_100201144 315
754 3300025932 Ga0207690_10032000 Ga0207690_100320001 315
755 3300025932 Ga0207690_10159178 Ga0207690_101591782 315
756 3300025932 Ga0207690_10238108 Ga0207690_102381082 315
757 3300025933 Ga0207706_10185248 Ga0207706_101852482 315
758 3300025936 Ga0207670_10011774 Ga0207670_100117746 315
759 3300025937 Ga0207669_10250525 Ga0207669_102505251 315
760 3300025938 Ga0207704_10099245 Ga0207704_100992452 315
761 3300025940 Ga0207691_10028863 Ga0207691_100288632 315
762 3300025940 Ga0207691_10050250 Ga0207691_100502504 315
763 3300025941 Ga0207711_10002413 Ga0207711_1000241316 315
764 3300025941 Ga0207711_10017384 Ga0207711_100173842 315
765 3300025942 Ga0207689_10000559 Ga0207689_100005592 315
766 3300025944 Ga0207661_10050422 Ga0207661_100504221 315
767 3300025945 Ga0207679_10002983 Ga0207679_100029836 315
768 3300025945 Ga0207679_10006832 Ga0207679_100068324 315
769 3300025945 Ga0207679_10022583 Ga0207679_100225831 315
770 3300025945 Ga0207679_10026584 Ga0207679_100265843 315
771 3300025949 Ga0207667_10003655 Ga0207667_1000365510 315
772 3300025949 Ga0207667_10013313 Ga0207667_100133135 315
773 3300025960 Ga0207651_10001519 Ga0207651_100015196 315
774 3300025981 Ga0207640_10018156 Ga0207640_100181562 315
775 3300025981 Ga0207640_10166494 Ga0207640_101664942 315
776 3300025981 Ga0207640_10182996 Ga0207640_101829962 315
777 3300025986 Ga0207658_10030065 Ga0207658_100300654 315
778 3300026023 Ga0207677_10012228 Ga0207677_100122285 315
779 3300026035 Ga0207703_10042796 Ga0207703_100427961 315
780 3300026041 Ga0207639_10170261 Ga0207639_101702612 315
781 3300026067 Ga0207678_10050199 Ga0207678_100501992 315
782 3300026078 Ga0207702_10023904 Ga0207702_100239045 315
783 3300026078 Ga0207702_10031508 Ga0207702_100315084 315
784 3300026078 Ga0207702_10082465 Ga0207702_100824652 315
785 3300026088 Ga0207641_10023943 Ga0207641_100239434 315
786 3300026088 Ga0207641_10386225 Ga0207641_103862251 315
787 3300026095 Ga0207676_10031852 Ga0207676_100318521 315
788 3300026116 Ga0207674_10000045 Ga0207674_1000004596 315
789 3300026116 Ga0207674_10003080 Ga0207674_1000308014 315
790 3300026116 Ga0207674_10005204 Ga0207674_1000520416 315
791 3300026116 Ga0207674_10110851 Ga0207674_101108512 315
792 3300026121 Ga0207683_10045996 Ga0207683_100459964 315
793 3300026121 Ga0207683_10226824 Ga0207683_102268242 315
794 3300026142 Ga0207698_10001195 Ga0207698_100011959 315
795 3300026142 Ga0207698_10029519 Ga0207698_100295192 315
796 3300026142 Ga0207698_10068341 Ga0207698_100683412 315
797 3300026142 Ga0207698_10091066 Ga0207698_100910662 315
798 3300027665 Ga0209983_1022159 Ga0209983_10221591 315
799 3300027682 Ga0209971_1000590 Ga0209971_10005901 315
800 3300027717 Ga0209998_10000663 Ga0209998_100006635 315
801 3300027876 Ga0209974_10005077 Ga0209974_100050773 315
802 3300028379 Ga0268266_10033065 Ga0268266_100330655 315
803 3300028379 Ga0268266_10444116 Ga0268266_104441161 315
804 3300028380 Ga0268265_10180398 Ga0268265_101803982 315
805 3300028381 Ga0268264_10020012 Ga0268264_100200126 315
806 3300037312 Ga0395899_0009384 Ga0395899_0009384_4635_5591 315
807 3300038443 Ga0395901_0363899 Ga0395901_0363899_177_1136 315
808 3300046663 Ga0495635_0175223 Ga0495635_0175223_68_1021 315
809 3300047319 Ga0495674_0062526 Ga0495674_0062526_1355_2308 315
810 3300048903 Ga0496100_0040251 Ga0496100_0040251_1694_2653 315
811 3300048907 Ga0496104_0016794 Ga0496104_0016794_1123_2082 315
812 3300048908 Ga0496105_0043714 Ga0496105_0043714_2647_3606 315
813 3300048909 Ga0496106_0186580 Ga0496106_0186580_455_1414 315
814 3300048910 Ga0496107_0163089 Ga0496107_0163089_567_1526 315
815 3300048911 Ga0496108_0003315 Ga0496108_0003315_10992_11951 315
816 3300048911 Ga0496108_0267431 Ga0496108_0267431_129_1088 315
817 3300048912 Ga0496109_0106658 Ga0496109_0106658_53_1012 315
818 3300048913 Ga0496110_0075816 Ga0496110_0075816_1823_2782 315
819 3300048914 Ga0496111_0030170 Ga0496111_0030170_1329_2288 315
820 3300048917 Ga0496114_0017697 Ga0496114_0017697_3779_4738 315
821 3300002772 JGI25164J39214_1002902 JGI25164J39214_10029022 316
822 3300003214 JGI25165J46597_1000030 JGI25165J46597_1000030260 316
823 3300003751 Ga0055538_1000017 Ga0055538_100001741 316
824 3300003752 Ga0055539_1000022 Ga0055539_100002241 316
825 3300003756 Ga0055533_1000030 Ga0055533_100003041 316
826 3300003759 Ga0055525_1000034 Ga0055525_100003441 316
827 3300003841 Ga0055541_1000015 Ga0055541_100001541 316
828 3300014497 Ga0182008_10034769 Ga0182008_100347692 316
829 3300015261 Ga0182006_1003224 Ga0182006_10032247 316
830 3300015262 Ga0182007_10004074 Ga0182007_100040744 316
831 3300015265 Ga0182005_1001051 Ga0182005_10010515 316
832 3300025207 Ga0209760_100791 Ga0209760_1007913 316
833 3300025224 Ga0209784_100034 Ga0209784_100034258 316
834 3300025225 Ga0209566_100038 Ga0209566_10003841 316
835 3300025226 Ga0209674_100056 Ga0209674_100056258 316
836 3300025230 Ga0209563_100057 Ga0209563_10005741 316
837 3300025231 Ga0207427_100288 Ga0207427_10028831 316
838 3300025233 Ga0209437_100071 Ga0209437_10007141 316
839 3300025253 Ga0209677_100035 Ga0209677_100035258 316
840 3300025261 Ga0209233_1000094 Ga0209233_100009441 316
841 3300046454 Ga0495592_0124457 Ga0495592_0124457_297_1247 316
842 3300046462 Ga0495651_0032726 Ga0495651_0032726_414_1364 316
843 3300046462 Ga0495651_0072865 Ga0495651_0072865_1632_2582 316
844 3300046511 Ga0495608_0005231 Ga0495608_0005231_8211_9161 316
845 3300046516 Ga0495628_0006680 Ga0495628_0006680_5533_6483 316
846 3300046678 Ga0495599_0012955 Ga0495599_0012955_3137_4087 316
847 3300046679 Ga0495623_0029623 Ga0495623_0029623_2480_3430 316
848 3300046680 Ga0495646_0011091 Ga0495646_0011091_769_1719 316
849 3300046809 Ga0495600_0021968 Ga0495600_0021968_229_1179 316
850 3300047317 Ga0495604_0036323 Ga0495604_0036323_129_1079 316
851 3300048088 Ga0495602_0079418 Ga0495602_0079418_80_1030 316
852 3300053119 Ga0500595_000447 Ga0500595_000447_3147_4097 316
853 3300053141 Ga0500574_002511 Ga0500574_002511_1018_1968 316
854 3300053154 Ga0500619_000959 Ga0500619_000959_324_1274 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16868

NMT1_3

NMT1-like family

95

379

0.97

PF09084

NMT1

NMT1/THI5 like

121

297

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.8591 24 316
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.8385 24 316
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.8048 24 315
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.7908 24 315
2b99-assembly1.cif.gz_A crystal structure of an archaeal pentameric riboflavin synthase complex with a substrate analog inhibitor 0.7585 24 75
ID Description Score Start End Superfamily
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.959 114 249 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9389 114 249 3.40.190.10
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9307 114 249 3.40.190.10
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9116 114 249 3.40.190.10
1us4A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9034 24 316 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A529Q1G6-F1-model_v4 TAXI family TRAP transporter solute-binding subunit 0.9377 86 209
AF-X1W1P1-F1-model_v4 Uncharacterized protein 0.9375 111 250
AF-S6HMX2-F1-model_v4 Immunogenic protein 0.9273 105 316
AF-A0A644ZQ59-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.927 73 315
AF-A0A660T6I0-F1-model_v4 HTH gntR-type domain-containing protein 0.9264 28 316 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
92 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map