F483598
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 854 | 443 | 784 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300048925|Ga0496122_0094171|Ga0496122_0094171_675_1820 |
| Length | 381 |
| Sequence | MAWPKEWHCNHRYVGLYVLARNFVARYSGLGLPTLCGPKINPPGNDPGTAMMTGSATMNRPSVKRRVLALCTAAGFGIGLGFAALPAQAEAFITVLTGGTSGVYYPLGVALSNVYGKALPGAKVTAQATKASVENLNLLQAGRGEIGFTLGDSLSDAWKGNEEVGFKQKLDKLRTIAAIYPNYIQVVAAKESGIKTLADLKGKRVSVGAPKSGTELNARAIFGAAGLTYKDFAKTEYLPFGESVDLIKNRQLDATLISAGLGVAAIKDLSSSQEITVVSIPAELVQKVGDAAYITETIPAGTYPGQTEAVPTAAVRNLLVSHSGVSDDAAYAMTKTLFENLDALAAAHVAAKQIKLDQTATQSPVPLHPGAIKYFKEKGLM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 2 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 3 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 4 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 5 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 6 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 7 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 8 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 9 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 10 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 11 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 12 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 13 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 14 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 15 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 16 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 17 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 18 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 19 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 20 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 21 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 22 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 23 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 24 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 25 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 26 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 27 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 28 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 29 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 30 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 31 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 32 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 33 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 34 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 35 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 36 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 37 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 38 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 39 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 40 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 41 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 42 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 43 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 44 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 45 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 46 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 47 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 48 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 49 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 50 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 51 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 52 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 53 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 54 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 55 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 56 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 58 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 59 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 60 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 65 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 75 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 79 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 81 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 106 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 115 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 123 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 125 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 126 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 127 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 129 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 130 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 131 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 132 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 133 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 134 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 135 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 136 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 137 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 138 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 139 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 140 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 141 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 142 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 144 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 145 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 170 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 175 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 176 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 249 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 255 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 259 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 260 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 263 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 264 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 266 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 267 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 268 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 269 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 270 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 275 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 281 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 283 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 284 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 285 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 287 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 289 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 290 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 291 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 292 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 293 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 294 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 295 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 296 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 297 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 298 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 299 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 300 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 301 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 302 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 303 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 304 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 305 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 306 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 307 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 308 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 309 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 310 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 311 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 312 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 313 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 314 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 315 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 316 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 317 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 318 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 319 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 320 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 321 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 322 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 374 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 377 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 378 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 381 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 382 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 383 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 384 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 385 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 386 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 410 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 413 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 414 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 417 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 422 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 424 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 426 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 436 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 437 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 438 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 439 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 440 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 441 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 442 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 443 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.75 |
| Metatranscriptomes | 1.05 |
| Isolates | 8.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.75 |
| Nodule | 1.76 |
| Rhizoplane | 4.68 |
| Rhizosphere | 85.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25164J39214_1002902 | 3300002772 | Bacteria | 2366 |
| 2 | JGI25406J46586_10043756 | 3300003203 | Bacteria | 1556 |
| 3 | JGI25165J46597_1000030 | 3300003214 | Bacteria | 305254 |
| 4 | rootH1_10090803 | 3300003323 | Bacteria | 1292 |
| 5 | Ga0055538_1000017 | 3300003751 | Bacteria | 305254 |
| 6 | Ga0055539_1000022 | 3300003752 | Bacteria | 305254 |
| 7 | Ga0055533_1000030 | 3300003756 | Bacteria | 305254 |
| 8 | Ga0055525_1000034 | 3300003759 | Bacteria | 305254 |
| 9 | Ga0055536_1018774 | 3300003781 | Bacteria | 2201 |
| 10 | Ga0055540_1003328 | 3300003792 | Bacteria | 7828 |
| 11 | Ga0055531_10006103 | 3300003794 | Bacteria | 6899 |
| 12 | Ga0055541_1000015 | 3300003841 | Bacteria | 305254 |
| 13 | Ga0065714_10089262 | 3300005288 | Bacteria | 1986 |
| 14 | Ga0070658_10017819 | 3300005327 | Bacteria | 5679 |
| 15 | Ga0070676_10061476 | 3300005328 | Bacteria | 2233 |
| 16 | Ga0070683_100013010 | 3300005329 | Bacteria | 7244 |
| 17 | Ga0070683_100015845 | 3300005329 | Bacteria | 6630 |
| 18 | Ga0070690_100001596 | 3300005330 | Bacteria | 11908 |
| 19 | Ga0070690_100002584 | 3300005330 | Bacteria | 9748 |
| 20 | Ga0070670_100006044 | 3300005331 | Bacteria | 10237 |
| 21 | Ga0070670_100006491 | 3300005331 | Bacteria | 9901 |
| 22 | Ga0070670_100030761 | 3300005331 | Bacteria | 4623 |
| 23 | Ga0070670_100036804 | 3300005331 | Bacteria | 4211 |
| 24 | Ga0070677_10087592 | 3300005333 | Bacteria | 1347 |
| 25 | Ga0068869_100093136 | 3300005334 | Bacteria | 2269 |
| 26 | Ga0070666_10029252 | 3300005335 | Bacteria | 3620 |
| 27 | Ga0070666_10058733 | 3300005335 | Bacteria | 2601 |
| 28 | Ga0070680_100027929 | 3300005336 | Bacteria | 4522 |
| 29 | Ga0070680_100084024 | 3300005336 | Bacteria | 2629 |
| 30 | Ga0070680_100145415 | 3300005336 | Bacteria | 1989 |
| 31 | Ga0070682_100028485 | 3300005337 | Bacteria | 3360 |
| 32 | Ga0068868_100008529 | 3300005338 | Bacteria | 7338 |
| 33 | Ga0068868_100013751 | 3300005338 | Bacteria | 5946 |
| 34 | Ga0068868_100068700 | 3300005338 | Bacteria | 2822 |
| 35 | Ga0068868_100081917 | 3300005338 | Bacteria | 2588 |
| 36 | Ga0070660_100004672 | 3300005339 | Bacteria | 9482 |
| 37 | Ga0070660_100053054 | 3300005339 | Bacteria | 3126 |
| 38 | Ga0070660_100099632 | 3300005339 | Bacteria | 2301 |
| 39 | Ga0070660_100106735 | 3300005339 | Bacteria | 2224 |
| 40 | Ga0070689_100021008 | 3300005340 | Bacteria | 4853 |
| 41 | Ga0070687_100004394 | 3300005343 | Bacteria | 5616 |
| 42 | Ga0070661_100002328 | 3300005344 | Bacteria | 13044 |
| 43 | Ga0070661_100006323 | 3300005344 | Bacteria | 8170 |
| 44 | Ga0070661_100054951 | 3300005344 | Bacteria | 2916 |
| 45 | Ga0070661_100057040 | 3300005344 | Bacteria | 2862 |
| 46 | Ga0070661_100058717 | 3300005344 | Bacteria | 2819 |
| 47 | Ga0070661_100058950 | 3300005344 | Bacteria | 2814 |
| 48 | Ga0070661_100134542 | 3300005344 | Bacteria | 1859 |
| 49 | Ga0070692_10003709 | 3300005345 | Bacteria | 6264 |
| 50 | Ga0070692_10113971 | 3300005345 | Bacteria | 1499 |
| 51 | Ga0070692_10162336 | 3300005345 | Bacteria | 1281 |
| 52 | Ga0070668_100029719 | 3300005347 | Bacteria | 4152 |
| 53 | Ga0070669_100019131 | 3300005353 | Bacteria | 4895 |
| 54 | Ga0070669_100195615 | 3300005353 | Bacteria | 1588 |
| 55 | Ga0070675_100014162 | 3300005354 | Bacteria | 6286 |
| 56 | Ga0070671_100040743 | 3300005355 | Bacteria | 3859 |
| 57 | Ga0070671_100156319 | 3300005355 | Bacteria | 1926 |
| 58 | Ga0070674_100090010 | 3300005356 | Bacteria | 2212 |
| 59 | Ga0070674_100364470 | 3300005356 | Bacteria | 1171 |
| 60 | Ga0070673_100004297 | 3300005364 | Bacteria | 8997 |
| 61 | Ga0070673_100033870 | 3300005364 | Bacteria | 3860 |
| 62 | Ga0070673_100096708 | 3300005364 | Bacteria | 2423 |
| 63 | Ga0070688_100013185 | 3300005365 | Bacteria | 4654 |
| 64 | Ga0070659_100008372 | 3300005366 | Bacteria | 7554 |
| 65 | Ga0070659_100009606 | 3300005366 | Bacteria | 7110 |
| 66 | Ga0070659_100013641 | 3300005366 | Bacteria | 6053 |
| 67 | Ga0070659_100036790 | 3300005366 | Bacteria | 3816 |
| 68 | Ga0070659_100079405 | 3300005366 | Bacteria | 2619 |
| 69 | Ga0070659_100202068 | 3300005366 | Bacteria | 1636 |
| 70 | Ga0070659_100384191 | 3300005366 | Bacteria | 1183 |
| 71 | Ga0070667_100042899 | 3300005367 | Bacteria | 3795 |
| 72 | Ga0070667_100140265 | 3300005367 | Bacteria | 2116 |
| 73 | Ga0070709_10012700 | 3300005434 | Bacteria | 4717 |
| 74 | Ga0070709_10021508 | 3300005434 | Bacteria | 3757 |
| 75 | Ga0070709_10121651 | 3300005434 | Bacteria | 1770 |
| 76 | Ga0070714_100000958 | 3300005435 | Bacteria | 20590 |
| 77 | Ga0070714_100013339 | 3300005435 | Bacteria | 6585 |
| 78 | Ga0070714_100185687 | 3300005435 | Bacteria | 1894 |
| 79 | Ga0070713_100018721 | 3300005436 | Bacteria | 5267 |
| 80 | Ga0070713_100130489 | 3300005436 | Bacteria | 2215 |
| 81 | Ga0070710_10010103 | 3300005437 | Bacteria | 4631 |
| 82 | Ga0070710_10046000 | 3300005437 | Bacteria | 2428 |
| 83 | Ga0070701_10022204 | 3300005438 | Bacteria | 3040 |
| 84 | Ga0070711_100002652 | 3300005439 | Bacteria | 10249 |
| 85 | Ga0070705_100134515 | 3300005440 | Bacteria | 1618 |
| 86 | Ga0070705_100188828 | 3300005440 | Bacteria | 1402 |
| 87 | Ga0070694_100030783 | 3300005444 | Bacteria | 3513 |
| 88 | Ga0070708_100023923 | 3300005445 | Bacteria | 5199 |
| 89 | Ga0070663_100011218 | 3300005455 | Bacteria | 5614 |
| 90 | Ga0070663_100027174 | 3300005455 | Bacteria | 3882 |
| 91 | Ga0070663_100085494 | 3300005455 | Bacteria | 2328 |
| 92 | Ga0070678_100002448 | 3300005456 | Bacteria | 10167 |
| 93 | Ga0070678_100015132 | 3300005456 | Bacteria | 4893 |
| 94 | Ga0070678_100203924 | 3300005456 | Bacteria | 1634 |
| 95 | Ga0070662_100062593 | 3300005457 | Bacteria | 2719 |
| 96 | Ga0070662_100199514 | 3300005457 | Bacteria | 1587 |
| 97 | Ga0070662_100213688 | 3300005457 | Bacteria | 1536 |
| 98 | Ga0070662_100267372 | 3300005457 | Bacteria | 1379 |
| 99 | Ga0068867_100016181 | 3300005459 | Bacteria | 5298 |
| 100 | Ga0068867_100303364 | 3300005459 | Bacteria | 1317 |
| 101 | Ga0070685_10000875 | 3300005466 | Bacteria | 16309 |
| 102 | Ga0070685_10004917 | 3300005466 | Bacteria | 6759 |
| 103 | Ga0070706_100074933 | 3300005467 | Bacteria | 3132 |
| 104 | Ga0070707_100048222 | 3300005468 | Bacteria | 4080 |
| 105 | Ga0070698_100083905 | 3300005471 | Bacteria | 3175 |
| 106 | Ga0070699_100007695 | 3300005518 | Bacteria | 9367 |
| 107 | Ga0070679_100019673 | 3300005530 | Bacteria | 6570 |
| 108 | Ga0070679_100053494 | 3300005530 | Bacteria | 4019 |
| 109 | Ga0070679_100057106 | 3300005530 | Bacteria | 3890 |
| 110 | Ga0070679_100062132 | 3300005530 | Bacteria | 3723 |
| 111 | Ga0070679_100354092 | 3300005530 | Bacteria | 1415 |
| 112 | Ga0070679_100540150 | 3300005530 | Bacteria | 1109 |
| 113 | Ga0070684_100008174 | 3300005535 | Bacteria | 8172 |
| 114 | Ga0070684_100019953 | 3300005535 | Bacteria | 5556 |
| 115 | Ga0070684_100058203 | 3300005535 | Bacteria | 3377 |
| 116 | Ga0070684_100112794 | 3300005535 | Bacteria | 2439 |
| 117 | Ga0070697_100051730 | 3300005536 | Bacteria | 3338 |
| 118 | Ga0068853_100037502 | 3300005539 | Bacteria | 4124 |
| 119 | Ga0068853_100071377 | 3300005539 | Bacteria | 3024 |
| 120 | Ga0068853_100088708 | 3300005539 | Bacteria | 2715 |
| 121 | Ga0068853_100120104 | 3300005539 | Bacteria | 2343 |
| 122 | Ga0070672_100034117 | 3300005543 | Bacteria | 3860 |
| 123 | Ga0070672_100265956 | 3300005543 | Bacteria | 1447 |
| 124 | Ga0070686_100079205 | 3300005544 | Bacteria | 2171 |
| 125 | Ga0070695_100001413 | 3300005545 | Bacteria | 13309 |
| 126 | Ga0070696_100038761 | 3300005546 | Bacteria | 3290 |
| 127 | Ga0070693_100000736 | 3300005547 | Bacteria | 14434 |
| 128 | Ga0070693_100016720 | 3300005547 | Bacteria | 3801 |
| 129 | Ga0070693_100326110 | 3300005547 | Bacteria | 1043 |
| 130 | Ga0070665_100002011 | 3300005548 | Bacteria | 22862 |
| 131 | Ga0070665_100046504 | 3300005548 | Bacteria | 4359 |
| 132 | Ga0070665_100284678 | 3300005548 | Bacteria | 1655 |
| 133 | Ga0070704_100025569 | 3300005549 | Bacteria | 3888 |
| 134 | Ga0068855_100004494 | 3300005563 | Bacteria | 17044 |
| 135 | Ga0068855_100199948 | 3300005563 | Bacteria | 2250 |
| 136 | Ga0070664_100000225 | 3300005564 | Bacteria | 40336 |
| 137 | Ga0070664_100006637 | 3300005564 | Bacteria | 9333 |
| 138 | Ga0070664_100010013 | 3300005564 | Bacteria | 7682 |
| 139 | Ga0070664_100015585 | 3300005564 | Bacteria | 6219 |
| 140 | Ga0070664_100033629 | 3300005564 | Bacteria | 4296 |
| 141 | Ga0068857_100001492 | 3300005577 | Bacteria | 18627 |
| 142 | Ga0068857_100014731 | 3300005577 | Bacteria | 6822 |
| 143 | Ga0068857_100113712 | 3300005577 | Bacteria | 2434 |
| 144 | Ga0068857_100124095 | 3300005577 | Bacteria | 2326 |
| 145 | Ga0068857_100142569 | 3300005577 | Bacteria | 2166 |
| 146 | Ga0068854_100002211 | 3300005578 | Bacteria | 11975 |
| 147 | Ga0068854_100004576 | 3300005578 | Bacteria | 8721 |
| 148 | Ga0068854_100016831 | 3300005578 | Bacteria | 4881 |
| 149 | Ga0068854_100024525 | 3300005578 | Bacteria | 4130 |
| 150 | Ga0068854_100042449 | 3300005578 | Bacteria | 3219 |
| 151 | Ga0068854_100206615 | 3300005578 | Bacteria | 1547 |
| 152 | Ga0068854_100334977 | 3300005578 | Bacteria | 1234 |
| 153 | Ga0068856_100005098 | 3300005614 | Bacteria | 12982 |
| 154 | Ga0068856_100017037 | 3300005614 | Bacteria | 7042 |
| 155 | Ga0068856_100093545 | 3300005614 | Bacteria | 2991 |
| 156 | Ga0068856_100114069 | 3300005614 | Bacteria | 2701 |
| 157 | Ga0070702_100037966 | 3300005615 | Bacteria | 2678 |
| 158 | Ga0068852_100001351 | 3300005616 | Bacteria | 16461 |
| 159 | Ga0068852_100002563 | 3300005616 | Bacteria | 12518 |
| 160 | Ga0068852_100006471 | 3300005616 | Bacteria | 8462 |
| 161 | Ga0068852_100008012 | 3300005616 | Bacteria | 7748 |
| 162 | Ga0068852_100018561 | 3300005616 | Bacteria | 5482 |
| 163 | Ga0068852_100051932 | 3300005616 | Bacteria | 3521 |
| 164 | Ga0068852_100110836 | 3300005616 | Bacteria | 2495 |
| 165 | Ga0068852_100183356 | 3300005616 | Bacteria | 1970 |
| 166 | Ga0068859_100005232 | 3300005617 | Bacteria | 13183 |
| 167 | Ga0068859_100009836 | 3300005617 | Bacteria | 9653 |
| 168 | Ga0068864_100004349 | 3300005618 | Bacteria | 11626 |
| 169 | Ga0068864_100043697 | 3300005618 | Bacteria | 3837 |
| 170 | Ga0068866_10003938 | 3300005718 | Bacteria | 6096 |
| 171 | Ga0068851_10015469 | 3300005834 | Bacteria | 3635 |
| 172 | Ga0068851_10016929 | 3300005834 | Bacteria | 3495 |
| 173 | Ga0068851_10036048 | 3300005834 | Bacteria | 2476 |
| 174 | Ga0068851_10037090 | 3300005834 | Bacteria | 2443 |
| 175 | Ga0068851_10053657 | 3300005834 | Bacteria | 2053 |
| 176 | Ga0068851_10069635 | 3300005834 | Bacteria | 1817 |
| 177 | Ga0068851_10074997 | 3300005834 | Bacteria | 1757 |
| 178 | Ga0068870_10000991 | 3300005840 | Bacteria | 11207 |
| 179 | Ga0068863_100001667 | 3300005841 | Bacteria | 21948 |
| 180 | Ga0068863_100048655 | 3300005841 | Bacteria | 4020 |
| 181 | Ga0068858_100001809 | 3300005842 | Bacteria | 21766 |
| 182 | Ga0068858_100050217 | 3300005842 | Bacteria | 3860 |
| 183 | Ga0068860_100047590 | 3300005843 | Bacteria | 4087 |
| 184 | Ga0068860_100223075 | 3300005843 | Bacteria | 1830 |
| 185 | Ga0068860_100330497 | 3300005843 | Bacteria | 1497 |
| 186 | Ga0068862_100004412 | 3300005844 | Bacteria | 11874 |
| 187 | Ga0081455_10000438 | 3300005937 | Bacteria | 54690 |
| 188 | Ga0081539_10001093 | 3300005985 | Bacteria | 49316 |
| 189 | Ga0075365_10006849 | 3300006038 | Bacteria | 6320 |
| 190 | Ga0070712_100016226 | 3300006175 | Bacteria | 4809 |
| 191 | Ga0097621_100058781 | 3300006237 | Bacteria | 3146 |
| 192 | Ga0097621_100066150 | 3300006237 | Bacteria | 2976 |
| 193 | Ga0068871_100123984 | 3300006358 | Bacteria | 2185 |
| 194 | Ga0068871_100142733 | 3300006358 | Bacteria | 2037 |
| 195 | Ga0068871_100154363 | 3300006358 | Bacteria | 1959 |
| 196 | Ga0068871_100226863 | 3300006358 | Bacteria | 1620 |
| 197 | Ga0068865_100019122 | 3300006881 | Bacteria | 4430 |
| 198 | Ga0068865_100052693 | 3300006881 | Bacteria | 2821 |
| 199 | Ga0097620_100005232 | 3300006931 | Bacteria | 13183 |
| 200 | Ga0097620_100009836 | 3300006931 | Bacteria | 9653 |
| 201 | Ga0075435_100175954 | 3300007076 | Bacteria | 1807 |
| 202 | Ga0105240_10002216 | 3300009093 | Bacteria | 31667 |
| 203 | Ga0105240_10066377 | 3300009093 | Bacteria | 4476 |
| 204 | Ga0105245_10162659 | 3300009098 | Bacteria | 2119 |
| 205 | Ga0105247_10045703 | 3300009101 | Bacteria | 2687 |
| 206 | Ga0105243_10057920 | 3300009148 | Bacteria | 3087 |
| 207 | Ga0105243_10119272 | 3300009148 | Bacteria | 2221 |
| 208 | Ga0105241_10001246 | 3300009174 | Bacteria | 19419 |
| 209 | Ga0105241_10009600 | 3300009174 | Bacteria | 7113 |
| 210 | Ga0105241_10041482 | 3300009174 | Bacteria | 3477 |
| 211 | Ga0105242_10050907 | 3300009176 | Bacteria | 3374 |
| 212 | Ga0105248_10002109 | 3300009177 | Bacteria | 22030 |
| 213 | Ga0105248_10071495 | 3300009177 | Bacteria | 3898 |
| 214 | Ga0105248_10120824 | 3300009177 | Bacteria | 2955 |
| 215 | Ga0105237_10146314 | 3300009545 | Bacteria | 2358 |
| 216 | Ga0105237_10188418 | 3300009545 | Bacteria | 2063 |
| 217 | Ga0105238_10002109 | 3300009551 | Bacteria | 20087 |
| 218 | Ga0105238_10086374 | 3300009551 | Bacteria | 3125 |
| 219 | Ga0105238_10095199 | 3300009551 | Bacteria | 2965 |
| 220 | Ga0105238_10120972 | 3300009551 | Bacteria | 2597 |
| 221 | Ga0105249_10073643 | 3300009553 | Bacteria | 3160 |
| 222 | Ga0105239_10168648 | 3300010375 | Bacteria | 2448 |
| 223 | Ga0105239_10177751 | 3300010375 | Bacteria | 2381 |
| 224 | Ga0105239_10208964 | 3300010375 | Bacteria | 2187 |
| 225 | Ga0105246_10039608 | 3300011119 | Bacteria | 3176 |
| 226 | Ga0105246_10093886 | 3300011119 | Bacteria | 2168 |
| 227 | Ga0157373_10001504 | 3300013100 | Bacteria | 17780 |
| 228 | Ga0157373_10026641 | 3300013100 | Bacteria | 4173 |
| 229 | Ga0157373_10070413 | 3300013100 | Bacteria | 2471 |
| 230 | Ga0157373_10096769 | 3300013100 | Bacteria | 2078 |
| 231 | Ga0157371_10032051 | 3300013102 | Bacteria | 3784 |
| 232 | Ga0157371_10038271 | 3300013102 | Bacteria | 3432 |
| 233 | Ga0157371_10134147 | 3300013102 | Bacteria | 1763 |
| 234 | Ga0157370_10010238 | 3300013104 | Bacteria | 9901 |
| 235 | Ga0157370_10103891 | 3300013104 | Bacteria | 2659 |
| 236 | Ga0157370_10117932 | 3300013104 | Bacteria | 2480 |
| 237 | Ga0157370_10129658 | 3300013104 | Bacteria | 2353 |
| 238 | Ga0157370_10137663 | 3300013104 | Bacteria | 2275 |
| 239 | Ga0157370_10205073 | 3300013104 | Bacteria | 1828 |
| 240 | Ga0157369_10001055 | 3300013105 | Bacteria | 34811 |
| 241 | Ga0157369_10002700 | 3300013105 | Bacteria | 21159 |
| 242 | Ga0157369_10004550 | 3300013105 | Bacteria | 16308 |
| 243 | Ga0157369_10059854 | 3300013105 | Bacteria | 4108 |
| 244 | Ga0157369_10130905 | 3300013105 | Bacteria | 2659 |
| 245 | Ga0157369_10583568 | 3300013105 | Bacteria | 1154 |
| 246 | Ga0157374_10001520 | 3300013296 | Bacteria | 19535 |
| 247 | Ga0157374_10014729 | 3300013296 | Bacteria | 6848 |
| 248 | Ga0157374_10016719 | 3300013296 | Bacteria | 6454 |
| 249 | Ga0157374_10037164 | 3300013296 | Bacteria | 4467 |
| 250 | Ga0157374_10170283 | 3300013296 | Bacteria | 2124 |
| 251 | Ga0157378_10184572 | 3300013297 | Bacteria | 1964 |
| 252 | Ga0163162_10051253 | 3300013306 | Bacteria | 4141 |
| 253 | Ga0163162_10178027 | 3300013306 | Bacteria | 2252 |
| 254 | Ga0157372_10003646 | 3300013307 | Bacteria | 16572 |
| 255 | Ga0157372_10052848 | 3300013307 | Bacteria | 4526 |
| 256 | Ga0157372_10143694 | 3300013307 | Bacteria | 2751 |
| 257 | Ga0157372_10433971 | 3300013307 | Bacteria | 1531 |
| 258 | Ga0157375_10043153 | 3300013308 | Bacteria | 4371 |
| 259 | Ga0157375_10064445 | 3300013308 | Bacteria | 3648 |
| 260 | Ga0157375_10149243 | 3300013308 | Bacteria | 2472 |
| 261 | Ga0163163_10011448 | 3300014325 | Bacteria | 8047 |
| 262 | Ga0163163_10019812 | 3300014325 | Bacteria | 6326 |
| 263 | Ga0163163_10057467 | 3300014325 | Bacteria | 3847 |
| 264 | Ga0182008_10034769 | 3300014497 | Bacteria | 2526 |
| 265 | Ga0157377_10004960 | 3300014745 | Bacteria | 6204 |
| 266 | Ga0157379_10063612 | 3300014968 | Bacteria | 3298 |
| 267 | Ga0157379_10412934 | 3300014968 | Bacteria | 1242 |
| 268 | Ga0157376_10197097 | 3300014969 | Bacteria | 1850 |
| 269 | Ga0182006_1000143 | 3300015261 | Bacteria | 76634 |
| 270 | Ga0182006_1003224 | 3300015261 | Bacteria | 8474 |
| 271 | Ga0182006_1052987 | 3300015261 | Bacteria | 1557 |
| 272 | Ga0182007_10004074 | 3300015262 | Bacteria | 6724 |
| 273 | Ga0182005_1001051 | 3300015265 | Bacteria | 11687 |
| 274 | Ga0163161_10035214 | 3300017792 | Bacteria | 3583 |
| 275 | Ga0163161_10075531 | 3300017792 | Bacteria | 2473 |
| 276 | Ga0209760_100791 | 3300025207 | Bacteria | 4385 |
| 277 | Ga0209784_100034 | 3300025224 | Bacteria | 305504 |
| 278 | Ga0209566_100038 | 3300025225 | Bacteria | 305504 |
| 279 | Ga0209674_100056 | 3300025226 | Bacteria | 305504 |
| 280 | Ga0209563_100057 | 3300025230 | Bacteria | 305604 |
| 281 | Ga0207427_100288 | 3300025231 | Bacteria | 35935 |
| 282 | Ga0209437_100071 | 3300025233 | Bacteria | 305604 |
| 283 | Ga0209677_100035 | 3300025253 | Bacteria | 305504 |
| 284 | Ga0209233_1000094 | 3300025261 | Bacteria | 305604 |
| 285 | Ga0209676_1000590 | 3300025292 | Bacteria | 54164 |
| 286 | Ga0209676_1004595 | 3300025292 | Bacteria | 7621 |
| 287 | Ga0209758_1000191 | 3300025297 | Bacteria | 136984 |
| 288 | Ga0209050_1014575 | 3300025298 | Bacteria | 3373 |
| 289 | Ga0209051_1002129 | 3300025303 | Bacteria | 14756 |
| 290 | Ga0209257_1002628 | 3300025304 | Bacteria | 17336 |
| 291 | Ga0207697_10000014 | 3300025315 | Bacteria | 59917 |
| 292 | Ga0207656_10006475 | 3300025321 | Bacteria | 4213 |
| 293 | Ga0207656_10007607 | 3300025321 | Bacteria | 3955 |
| 294 | Ga0207656_10049306 | 3300025321 | Bacteria | 1815 |
| 295 | Ga0207656_10087064 | 3300025321 | Bacteria | 1412 |
| 296 | Ga0207642_10025710 | 3300025899 | Bacteria | 2386 |
| 297 | Ga0207710_10025741 | 3300025900 | Bacteria | 2540 |
| 298 | Ga0207688_10021352 | 3300025901 | Bacteria | 3537 |
| 299 | Ga0207688_10025126 | 3300025901 | Bacteria | 3269 |
| 300 | Ga0207680_10032849 | 3300025903 | Bacteria | 2954 |
| 301 | Ga0207680_10142655 | 3300025903 | Bacteria | 1589 |
| 302 | Ga0207699_10066657 | 3300025906 | Bacteria | 2186 |
| 303 | Ga0207645_10000272 | 3300025907 | Bacteria | 42718 |
| 304 | Ga0207645_10043526 | 3300025907 | Bacteria | 2874 |
| 305 | Ga0207643_10070437 | 3300025908 | Bacteria | 2011 |
| 306 | Ga0207705_10038517 | 3300025909 | Bacteria | 3423 |
| 307 | Ga0207705_10071543 | 3300025909 | Bacteria | 2514 |
| 308 | Ga0207705_10157297 | 3300025909 | Bacteria | 1705 |
| 309 | Ga0207684_10061717 | 3300025910 | Bacteria | 3183 |
| 310 | Ga0207654_10021926 | 3300025911 | Bacteria | 3402 |
| 311 | Ga0207654_10097868 | 3300025911 | Bacteria | 1802 |
| 312 | Ga0207707_10003509 | 3300025912 | Bacteria | 13888 |
| 313 | Ga0207707_10067275 | 3300025912 | Bacteria | 3120 |
| 314 | Ga0207695_10005581 | 3300025913 | Bacteria | 16617 |
| 315 | Ga0207695_10040873 | 3300025913 | Bacteria | 4967 |
| 316 | Ga0207695_10054390 | 3300025913 | Bacteria | 4181 |
| 317 | Ga0207671_10059136 | 3300025914 | Bacteria | 2841 |
| 318 | Ga0207671_10227918 | 3300025914 | Bacteria | 1461 |
| 319 | Ga0207693_10000153 | 3300025915 | Bacteria | 63886 |
| 320 | Ga0207693_10009237 | 3300025915 | Bacteria | 8050 |
| 321 | Ga0207663_10129265 | 3300025916 | Bacteria | 1743 |
| 322 | Ga0207660_10098777 | 3300025917 | Bacteria | 2178 |
| 323 | Ga0207660_10178621 | 3300025917 | Bacteria | 1647 |
| 324 | Ga0207660_10296229 | 3300025917 | Bacteria | 1287 |
| 325 | Ga0207657_10001195 | 3300025919 | Bacteria | 27622 |
| 326 | Ga0207657_10004564 | 3300025919 | Bacteria | 14645 |
| 327 | Ga0207657_10009458 | 3300025919 | Bacteria | 9793 |
| 328 | Ga0207657_10054883 | 3300025919 | Bacteria | 3444 |
| 329 | Ga0207657_10082316 | 3300025919 | Bacteria | 2702 |
| 330 | Ga0207649_10007496 | 3300025920 | Bacteria | 5931 |
| 331 | Ga0207649_10007682 | 3300025920 | Bacteria | 5865 |
| 332 | Ga0207652_10002018 | 3300025921 | Bacteria | 17506 |
| 333 | Ga0207652_10012436 | 3300025921 | Bacteria | 6879 |
| 334 | Ga0207652_10205620 | 3300025921 | Bacteria | 1772 |
| 335 | Ga0207646_10049291 | 3300025922 | Bacteria | 3773 |
| 336 | Ga0207681_10014887 | 3300025923 | Bacteria | 4844 |
| 337 | Ga0207681_10258143 | 3300025923 | Bacteria | 1363 |
| 338 | Ga0207694_10017958 | 3300025924 | Bacteria | 5347 |
| 339 | Ga0207694_10030434 | 3300025924 | Bacteria | 4122 |
| 340 | Ga0207694_10205905 | 3300025924 | Bacteria | 1602 |
| 341 | Ga0207650_10009121 | 3300025925 | Bacteria | 6779 |
| 342 | Ga0207650_10020730 | 3300025925 | Bacteria | 4640 |
| 343 | Ga0207650_10056502 | 3300025925 | Bacteria | 2916 |
| 344 | Ga0207650_10312102 | 3300025925 | Bacteria | 1286 |
| 345 | Ga0207659_10001243 | 3300025926 | Bacteria | 15264 |
| 346 | Ga0207687_10041564 | 3300025927 | Bacteria | 3158 |
| 347 | Ga0207700_10000031 | 3300025928 | Bacteria | 130086 |
| 348 | Ga0207700_10077734 | 3300025928 | Bacteria | 2579 |
| 349 | Ga0207664_10001923 | 3300025929 | Bacteria | 13641 |
| 350 | Ga0207664_10002222 | 3300025929 | Bacteria | 12783 |
| 351 | Ga0207664_10018572 | 3300025929 | Bacteria | 5123 |
| 352 | Ga0207644_10014925 | 3300025931 | Bacteria | 5208 |
| 353 | Ga0207644_10164857 | 3300025931 | Bacteria | 1725 |
| 354 | Ga0207690_10010564 | 3300025932 | Bacteria | 5493 |
| 355 | Ga0207690_10020114 | 3300025932 | Bacteria | 4120 |
| 356 | Ga0207690_10032000 | 3300025932 | Bacteria | 3372 |
| 357 | Ga0207690_10159178 | 3300025932 | Bacteria | 1682 |
| 358 | Ga0207690_10238108 | 3300025932 | Bacteria | 1400 |
| 359 | Ga0207706_10008764 | 3300025933 | Bacteria | 9310 |
| 360 | Ga0207706_10045511 | 3300025933 | Bacteria | 3888 |
| 361 | Ga0207706_10185248 | 3300025933 | Bacteria | 1828 |
| 362 | Ga0207706_10252130 | 3300025933 | Bacteria | 1541 |
| 363 | Ga0207686_10009489 | 3300025934 | Bacteria | 5280 |
| 364 | Ga0207670_10011774 | 3300025936 | Bacteria | 5091 |
| 365 | Ga0207669_10086145 | 3300025937 | Bacteria | 2030 |
| 366 | Ga0207669_10250525 | 3300025937 | Bacteria | 1318 |
| 367 | Ga0207704_10099245 | 3300025938 | Bacteria | 1936 |
| 368 | Ga0207704_10250977 | 3300025938 | Bacteria | 1328 |
| 369 | Ga0207665_10014257 | 3300025939 | Bacteria | 5232 |
| 370 | Ga0207691_10028863 | 3300025940 | Bacteria | 5192 |
| 371 | Ga0207691_10050250 | 3300025940 | Bacteria | 3818 |
| 372 | Ga0207691_10275850 | 3300025940 | Bacteria | 1447 |
| 373 | Ga0207711_10000677 | 3300025941 | Bacteria | 33809 |
| 374 | Ga0207711_10002413 | 3300025941 | Bacteria | 16687 |
| 375 | Ga0207711_10017384 | 3300025941 | Bacteria | 5974 |
| 376 | Ga0207689_10000559 | 3300025942 | Bacteria | 35553 |
| 377 | Ga0207689_10026713 | 3300025942 | Bacteria | 4836 |
| 378 | Ga0207661_10050422 | 3300025944 | Bacteria | 3316 |
| 379 | Ga0207661_10173745 | 3300025944 | Bacteria | 1877 |
| 380 | Ga0207679_10002983 | 3300025945 | Bacteria | 10498 |
| 381 | Ga0207679_10006832 | 3300025945 | Bacteria | 7235 |
| 382 | Ga0207679_10022583 | 3300025945 | Bacteria | 4287 |
| 383 | Ga0207679_10026584 | 3300025945 | Bacteria | 3992 |
| 384 | Ga0207679_10074374 | 3300025945 | Bacteria | 2574 |
| 385 | Ga0207667_10003655 | 3300025949 | Bacteria | 18970 |
| 386 | Ga0207667_10013313 | 3300025949 | Bacteria | 9421 |
| 387 | Ga0207667_10092686 | 3300025949 | Bacteria | 3120 |
| 388 | Ga0207651_10001519 | 3300025960 | Bacteria | 10592 |
| 389 | Ga0207651_10081577 | 3300025960 | Bacteria | 2331 |
| 390 | Ga0207640_10010405 | 3300025981 | Bacteria | 5241 |
| 391 | Ga0207640_10018156 | 3300025981 | Bacteria | 4128 |
| 392 | Ga0207640_10057922 | 3300025981 | Bacteria | 2550 |
| 393 | Ga0207640_10125451 | 3300025981 | Bacteria | 1847 |
| 394 | Ga0207640_10166494 | 3300025981 | Bacteria | 1637 |
| 395 | Ga0207640_10182996 | 3300025981 | Bacteria | 1573 |
| 396 | Ga0207658_10030065 | 3300025986 | Bacteria | 3842 |
| 397 | Ga0207658_10112669 | 3300025986 | Bacteria | 2153 |
| 398 | Ga0207677_10000568 | 3300026023 | Bacteria | 23256 |
| 399 | Ga0207677_10012228 | 3300026023 | Bacteria | 4925 |
| 400 | Ga0207677_10095431 | 3300026023 | Bacteria | 2173 |
| 401 | Ga0207703_10004124 | 3300026035 | Bacteria | 11994 |
| 402 | Ga0207703_10042796 | 3300026035 | Bacteria | 3633 |
| 403 | Ga0207639_10170261 | 3300026041 | Bacteria | 1844 |
| 404 | Ga0207678_10050199 | 3300026067 | Bacteria | 3604 |
| 405 | Ga0207678_10091146 | 3300026067 | Bacteria | 2605 |
| 406 | Ga0207702_10023904 | 3300026078 | Bacteria | 5070 |
| 407 | Ga0207702_10031508 | 3300026078 | Bacteria | 4419 |
| 408 | Ga0207702_10047420 | 3300026078 | Bacteria | 3621 |
| 409 | Ga0207702_10068761 | 3300026078 | Bacteria | 3043 |
| 410 | Ga0207702_10082465 | 3300026078 | Bacteria | 2796 |
| 411 | Ga0207702_10172822 | 3300026078 | Bacteria | 1983 |
| 412 | Ga0207641_10015245 | 3300026088 | Bacteria | 6298 |
| 413 | Ga0207641_10023943 | 3300026088 | Bacteria | 5033 |
| 414 | Ga0207641_10386225 | 3300026088 | Bacteria | 1342 |
| 415 | Ga0207648_10089654 | 3300026089 | Bacteria | 2687 |
| 416 | Ga0207676_10000487 | 3300026095 | Bacteria | 33269 |
| 417 | Ga0207676_10031852 | 3300026095 | Bacteria | 3967 |
| 418 | Ga0207674_10000045 | 3300026116 | Bacteria | 122251 |
| 419 | Ga0207674_10003080 | 3300026116 | Bacteria | 20626 |
| 420 | Ga0207674_10005204 | 3300026116 | Bacteria | 15486 |
| 421 | Ga0207674_10009680 | 3300026116 | Bacteria | 10984 |
| 422 | Ga0207674_10110851 | 3300026116 | Bacteria | 2719 |
| 423 | Ga0207683_10003159 | 3300026121 | Bacteria | 14381 |
| 424 | Ga0207683_10045996 | 3300026121 | Bacteria | 3818 |
| 425 | Ga0207683_10226824 | 3300026121 | Bacteria | 1703 |
| 426 | Ga0207698_10001195 | 3300026142 | Bacteria | 15126 |
| 427 | Ga0207698_10006291 | 3300026142 | Bacteria | 7389 |
| 428 | Ga0207698_10029519 | 3300026142 | Bacteria | 3929 |
| 429 | Ga0207698_10068341 | 3300026142 | Bacteria | 2805 |
| 430 | Ga0207698_10076484 | 3300026142 | Bacteria | 2679 |
| 431 | Ga0207698_10091066 | 3300026142 | Bacteria | 2495 |
| 432 | Ga0209281_1002608 | 3300027111 | Bacteria | 6946 |
| 433 | Ga0209371_1000073 | 3300027312 | Bacteria | 199474 |
| 434 | Ga0209983_1022159 | 3300027665 | Bacteria | 1330 |
| 435 | Ga0209971_1000590 | 3300027682 | Bacteria | 9450 |
| 436 | Ga0209998_10000663 | 3300027717 | Bacteria | 9181 |
| 437 | Ga0209974_10005077 | 3300027876 | Bacteria | 4650 |
| 438 | Ga0207428_10138618 | 3300027907 | Bacteria | 1859 |
| 439 | Ga0268266_10033065 | 3300028379 | Bacteria | 4397 |
| 440 | Ga0268266_10092168 | 3300028379 | Bacteria | 2658 |
| 441 | Ga0268266_10444116 | 3300028379 | Bacteria | 1232 |
| 442 | Ga0268265_10180398 | 3300028380 | Bacteria | 1813 |
| 443 | Ga0268264_10020012 | 3300028381 | Bacteria | 5467 |
| 444 | Ga0268264_10112465 | 3300028381 | Bacteria | 2387 |
| 445 | Ga0268256_1000125 | 3300030500 | Bacteria | 110255 |
| 446 | Ga0316178_1001888 | 3300030735 | Bacteria | 10576 |
| 447 | Ga0265332_10021705 | 3300031238 | Bacteria | 2835 |
| 448 | Ga0265320_10001181 | 3300031240 | Bacteria | 19237 |
| 449 | Ga0265325_10143663 | 3300031241 | Bacteria | 1133 |
| 450 | Ga0265329_10014464 | 3300031242 | Bacteria | 2784 |
| 451 | Ga0265331_10001334 | 3300031250 | Bacteria | 18265 |
| 452 | Ga0307408_100000028 | 3300031548 | Bacteria | 233440 |
| 453 | Ga0307408_100000042 | 3300031548 | Bacteria | 172505 |
| 454 | Ga0307408_100194915 | 3300031548 | Bacteria | 1635 |
| 455 | Ga0265314_10027078 | 3300031711 | Bacteria | 4297 |
| 456 | Ga0307412_10099164 | 3300031911 | Bacteria | 2056 |
| 457 | Ga0307409_100024624 | 3300031995 | Bacteria | 4202 |
| 458 | Ga0307414_10001280 | 3300032004 | Bacteria | 12981 |
| 459 | Ga0307414_10027440 | 3300032004 | Bacteria | 3680 |
| 460 | Ga0307414_10411827 | 3300032004 | Bacteria | 1177 |
| 461 | Ga0373934_0007016 | 3300035086 | Bacteria | 4178 |
| 462 | Ga0373944_0039817 | 3300035089 | Bacteria | 1448 |
| 463 | Ga0373923_0020146 | 3300035111 | Bacteria | 2588 |
| 464 | Ga0373945_0010434 | 3300035116 | Bacteria | 3059 |
| 465 | Ga0373953_0031632 | 3300035117 | Bacteria | 2059 |
| 466 | Ga0373954_0023088 | 3300035118 | Bacteria | 2825 |
| 467 | Ga0373956_0025875 | 3300035119 | Bacteria | 2538 |
| 468 | Ga0373943_0043051 | 3300035170 | Bacteria | 2191 |
| 469 | Ga0373946_0100662 | 3300035171 | Bacteria | 1295 |
| 470 | Ga0373955_0016513 | 3300035172 | Bacteria | 3635 |
| 471 | Ga0373955_0078201 | 3300035172 | Bacteria | 1864 |
| 472 | Ga0373931_0118704 | 3300035691 | Bacteria | 1509 |
| 473 | Ga0373935_0042472 | 3300035692 | Bacteria | 2859 |
| 474 | Ga0373935_0072438 | 3300035692 | Bacteria | 2224 |
| 475 | Ga0373927_0002553 | 3300035695 | Bacteria | 13269 |
| 476 | Ga0373927_0120725 | 3300035695 | Bacteria | 1710 |
| 477 | Ga0373933_0140652 | 3300035724 | Bacteria | 1524 |
| 478 | Ga0373947_0105605 | 3300035725 | Bacteria | 1774 |
| 479 | Ga0373937_0001059 | 3300036401 | Bacteria | 23216 |
| 480 | Ga0373937_0037600 | 3300036401 | Bacteria | 4412 |
| 481 | Ga0373937_0356820 | 3300036401 | Bacteria | 1385 |
| 482 | Ga0373937_0406399 | 3300036401 | Bacteria | 1292 |
| 483 | Ga0316584_0022046 | 3300036712 | Bacteria | 4641 |
| 484 | Ga0373925_0032093 | 3300037068 | Bacteria | 3864 |
| 485 | Ga0373925_0053454 | 3300037068 | Bacteria | 3019 |
| 486 | Ga0373925_0102579 | 3300037068 | Bacteria | 2201 |
| 487 | Ga0373925_0278705 | 3300037068 | Bacteria | 1346 |
| 488 | Ga0395899_0000590 | 3300037312 | Bacteria | 38255 |
| 489 | Ga0395899_0009384 | 3300037312 | Bacteria | 7513 |
| 490 | Ga0395899_0010616 | 3300037312 | Bacteria | 7056 |
| 491 | Ga0395899_0028074 | 3300037312 | Bacteria | 4238 |
| 492 | Ga0395899_0040209 | 3300037312 | Bacteria | 3498 |
| 493 | Ga0395900_0008216 | 3300037418 | Bacteria | 10745 |
| 494 | Ga0395900_0018519 | 3300037418 | Bacteria | 7102 |
| 495 | Ga0395900_0019772 | 3300037418 | Bacteria | 6863 |
| 496 | Ga0395900_0336795 | 3300037418 | Bacteria | 1485 |
| 497 | Ga0395898_0007300 | 3300037466 | Bacteria | 11732 |
| 498 | Ga0395898_0059593 | 3300037466 | Bacteria | 3712 |
| 499 | Ga0395898_0191471 | 3300037466 | Bacteria | 1954 |
| 500 | Ga0395905_0163994 | 3300037471 | Bacteria | 2088 |
| 501 | Ga0395901_0016591 | 3300038443 | Bacteria | 7505 |
| 502 | Ga0395901_0298915 | 3300038443 | Bacteria | 1669 |
| 503 | Ga0395901_0363899 | 3300038443 | Bacteria | 1491 |
| 504 | Ga0439438_000325 | 3300041405 | Bacteria | 21449 |
| 505 | Ga0439438_000523 | 3300041405 | Bacteria | 17389 |
| 506 | Ga0439438_000560 | 3300041405 | Bacteria | 16976 |
| 507 | Ga0439447_011363 | 3300041407 | Bacteria | 2602 |
| 508 | Ga0439466_0006481 | 3300041411 | Bacteria | 4447 |
| 509 | Ga0439466_0025101 | 3300041411 | Bacteria | 2083 |
| 510 | Ga0439465_0014168 | 3300041413 | Bacteria | 2485 |
| 511 | Ga0451853_1178748 | 3300041512 | Bacteria | 2133 |
| 512 | Ga0439432_042769 | 3300042006 | Bacteria | 1431 |
| 513 | Ga0439452_000107 | 3300042010 | Bacteria | 67397 |
| 514 | Ga0439452_001101 | 3300042010 | Bacteria | 11897 |
| 515 | Ga0439452_040282 | 3300042010 | Bacteria | 1102 |
| 516 | Ga0439456_001944 | 3300042013 | Bacteria | 4163 |
| 517 | Ga0450911_000010 | 3300042115 | Bacteria | 149605 |
| 518 | Ga0450911_001859 | 3300042115 | Bacteria | 4471 |
| 519 | Ga0450900_002531 | 3300042136 | Bacteria | 1948 |
| 520 | Ga0450903_001468 | 3300042138 | Bacteria | 4395 |
| 521 | Ga0450905_002036 | 3300042142 | Bacteria | 2580 |
| 522 | Ga0450905_015374 | 3300042142 | Bacteria | 1097 |
| 523 | Ga0450906_000096 | 3300042145 | Bacteria | 14819 |
| 524 | Ga0450907_000858 | 3300042146 | Bacteria | 7357 |
| 525 | Ga0439446_0002538 | 3300042156 | Bacteria | 4392 |
| 526 | Ga0439464_0000304 | 3300042439 | Bacteria | 9337 |
| 527 | Ga0439464_0001499 | 3300042439 | Bacteria | 5518 |
| 528 | Ga0439464_0037521 | 3300042439 | Bacteria | 1374 |
| 529 | Ga0439460_0004134 | 3300042461 | Bacteria | 3529 |
| 530 | Ga0450918_015227 | 3300042531 | Bacteria | 1337 |
| 531 | Ga0451577_0018682 | 3300042876 | Bacteria | 6380 |
| 532 | Ga0451577_0038802 | 3300042876 | Bacteria | 4282 |
| 533 | Ga0451577_0053265 | 3300042876 | Bacteria | 3612 |
| 534 | Ga0451577_0110661 | 3300042876 | Bacteria | 2457 |
| 535 | Ga0451577_0507799 | 3300042876 | Bacteria | 1095 |
| 536 | Ga0466969_0082984 | 3300044656 | Bacteria | 1526 |
| 537 | Ga0466972_0000162 | 3300044658 | Bacteria | 53301 |
| 538 | Ga0466972_0065018 | 3300044658 | Bacteria | 1745 |
| 539 | Ga0466963_0017345 | 3300044694 | Bacteria | 4487 |
| 540 | Ga0466964_0039023 | 3300044706 | Bacteria | 1911 |
| 541 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 542 | Ga0453684_0000410 | 3300044712 | Bacteria | 175627 |
| 543 | Ga0453684_0190847 | 3300044712 | Bacteria | 2397 |
| 544 | Ga0453684_0406506 | 3300044712 | Bacteria | 1524 |
| 545 | Ga0466971_0128214 | 3300044719 | Bacteria | 1176 |
| 546 | Ga0466970_0001930 | 3300044765 | Bacteria | 10024 |
| 547 | Ga0466959_0000159 | 3300045049 | Bacteria | 44154 |
| 548 | Ga0466959_0001957 | 3300045049 | Bacteria | 12981 |
| 549 | Ga0451576_0000108 | 3300045051 | Bacteria | 211233 |
| 550 | Ga0451576_0000695 | 3300045051 | Bacteria | 68253 |
| 551 | Ga0451576_0393260 | 3300045051 | Bacteria | 1453 |
| 552 | Ga0466967_0034676 | 3300045976 | Bacteria | 4286 |
| 553 | Ga0495592_0124457 | 3300046454 | Bacteria | 1810 |
| 554 | Ga0495591_001322 | 3300046458 | Bacteria | 15588 |
| 555 | Ga0495638_0017612 | 3300046460 | Bacteria | 4758 |
| 556 | Ga0495638_0156393 | 3300046460 | Bacteria | 1318 |
| 557 | Ga0495651_0032726 | 3300046462 | Bacteria | 4054 |
| 558 | Ga0495651_0072865 | 3300046462 | Bacteria | 2607 |
| 559 | Ga0495580_0029333 | 3300046472 | Bacteria | 3994 |
| 560 | Ga0495580_0110591 | 3300046472 | Bacteria | 1908 |
| 561 | Ga0495605_0000128 | 3300046474 | Bacteria | 100439 |
| 562 | Ga0495639_0012593 | 3300046475 | Bacteria | 3649 |
| 563 | Ga0495662_0021664 | 3300046476 | Bacteria | 3105 |
| 564 | Ga0495596_0041378 | 3300046500 | Bacteria | 1817 |
| 565 | Ga0495607_0000197 | 3300046501 | Bacteria | 63955 |
| 566 | Ga0495607_0005748 | 3300046501 | Bacteria | 8826 |
| 567 | Ga0495607_0006748 | 3300046501 | Bacteria | 8026 |
| 568 | Ga0495607_0118131 | 3300046501 | Bacteria | 1396 |
| 569 | Ga0495583_0008522 | 3300046506 | Bacteria | 6256 |
| 570 | Ga0495608_0005231 | 3300046511 | Bacteria | 9271 |
| 571 | Ga0495610_0004661 | 3300046512 | Bacteria | 10029 |
| 572 | Ga0495620_0000030 | 3300046515 | Bacteria | 122177 |
| 573 | Ga0495620_0000148 | 3300046515 | Bacteria | 57242 |
| 574 | Ga0495628_0006680 | 3300046516 | Bacteria | 10058 |
| 575 | Ga0495628_0032233 | 3300046516 | Bacteria | 4232 |
| 576 | Ga0495628_0087313 | 3300046516 | Bacteria | 2418 |
| 577 | Ga0495632_0000553 | 3300046519 | Bacteria | 34975 |
| 578 | Ga0495632_0017233 | 3300046519 | Bacteria | 3993 |
| 579 | Ga0495632_0070201 | 3300046519 | Bacteria | 1685 |
| 580 | Ga0495637_0000099 | 3300046520 | Bacteria | 66214 |
| 581 | Ga0495637_0002768 | 3300046520 | Bacteria | 9514 |
| 582 | Ga0495637_0013134 | 3300046520 | Bacteria | 3938 |
| 583 | Ga0495637_0050308 | 3300046520 | Bacteria | 1748 |
| 584 | Ga0495643_0000295 | 3300046522 | Bacteria | 70296 |
| 585 | Ga0495643_0119682 | 3300046522 | Bacteria | 1331 |
| 586 | Ga0495648_0001090 | 3300046524 | Bacteria | 27610 |
| 587 | Ga0495648_0001324 | 3300046524 | Bacteria | 24557 |
| 588 | Ga0495640_0106515 | 3300046533 | Bacteria | 1836 |
| 589 | Ga0495609_0007997 | 3300046538 | Bacteria | 5221 |
| 590 | Ga0495621_0010043 | 3300046539 | Bacteria | 2889 |
| 591 | Ga0495645_0008700 | 3300046543 | Bacteria | 7088 |
| 592 | Ga0495667_0145282 | 3300046559 | Bacteria | 1528 |
| 593 | Ga0495668_0010420 | 3300046616 | Bacteria | 5624 |
| 594 | Ga0495635_0175223 | 3300046663 | Bacteria | 1458 |
| 595 | Ga0495661_0001554 | 3300046665 | Bacteria | 18936 |
| 596 | Ga0495599_0012955 | 3300046678 | Bacteria | 5147 |
| 597 | Ga0495623_0029623 | 3300046679 | Bacteria | 3522 |
| 598 | Ga0495646_0011091 | 3300046680 | Bacteria | 5721 |
| 599 | Ga0495647_0001415 | 3300046681 | Bacteria | 7411 |
| 600 | Ga0495658_0117547 | 3300046683 | Bacteria | 1605 |
| 601 | Ga0495613_0029582 | 3300046689 | Bacteria | 4072 |
| 602 | Ga0495613_0248220 | 3300046689 | Bacteria | 1243 |
| 603 | Ga0495671_0020446 | 3300046692 | Bacteria | 3487 |
| 604 | Ga0495671_0058908 | 3300046692 | Bacteria | 1899 |
| 605 | Ga0495649_0160278 | 3300046694 | Bacteria | 1179 |
| 606 | Ga0495589_0014569 | 3300046794 | Bacteria | 4046 |
| 607 | Ga0495600_0021968 | 3300046809 | Bacteria | 4093 |
| 608 | Ga0495660_0006828 | 3300046810 | Bacteria | 6729 |
| 609 | Ga0495604_0036323 | 3300047317 | Bacteria | 3884 |
| 610 | Ga0495674_0062526 | 3300047319 | Bacteria | 3241 |
| 611 | Ga0495676_0010575 | 3300047321 | Bacteria | 8358 |
| 612 | Ga0495673_0002221 | 3300047469 | Bacteria | 13969 |
| 613 | Ga0495684_0039446 | 3300047471 | Bacteria | 3620 |
| 614 | Ga0495686_0012347 | 3300047472 | Bacteria | 5979 |
| 615 | Ga0495686_0057459 | 3300047472 | Bacteria | 2428 |
| 616 | Ga0495602_0079418 | 3300048088 | Bacteria | 2767 |
| 617 | Ga0496100_0040251 | 3300048903 | Bacteria | 2972 |
| 618 | Ga0496101_0282066 | 3300048904 | Bacteria | 1298 |
| 619 | Ga0496102_0235332 | 3300048905 | Bacteria | 1727 |
| 620 | Ga0496102_0405963 | 3300048905 | Bacteria | 1280 |
| 621 | Ga0496104_0015271 | 3300048907 | Bacteria | 6954 |
| 622 | Ga0496104_0016794 | 3300048907 | Bacteria | 6653 |
| 623 | Ga0496104_0026147 | 3300048907 | Bacteria | 5385 |
| 624 | Ga0496104_0039327 | 3300048907 | Bacteria | 4429 |
| 625 | Ga0496105_0043714 | 3300048908 | Bacteria | 3695 |
| 626 | Ga0496105_0052983 | 3300048908 | Bacteria | 3351 |
| 627 | Ga0496105_0078221 | 3300048908 | Bacteria | 2731 |
| 628 | Ga0496106_0186580 | 3300048909 | Bacteria | 1647 |
| 629 | Ga0496107_0038750 | 3300048910 | Bacteria | 3418 |
| 630 | Ga0496107_0163089 | 3300048910 | Bacteria | 1652 |
| 631 | Ga0496108_0003315 | 3300048911 | Bacteria | 12939 |
| 632 | Ga0496108_0132199 | 3300048911 | Bacteria | 2145 |
| 633 | Ga0496108_0204446 | 3300048911 | Unclassified | 1714 |
| 634 | Ga0496108_0267431 | 3300048911 | Bacteria | 1488 |
| 635 | Ga0496109_0007561 | 3300048912 | Bacteria | 9209 |
| 636 | Ga0496109_0106658 | 3300048912 | Bacteria | 2602 |
| 637 | Ga0496110_0010533 | 3300048913 | Bacteria | 7527 |
| 638 | Ga0496110_0075640 | 3300048913 | Bacteria | 2992 |
| 639 | Ga0496110_0075816 | 3300048913 | Bacteria | 2989 |
| 640 | Ga0496110_0095689 | 3300048913 | Bacteria | 2660 |
| 641 | Ga0496111_0030170 | 3300048914 | Bacteria | 3856 |
| 642 | Ga0496111_0065817 | 3300048914 | Bacteria | 2631 |
| 643 | Ga0496112_0000710 | 3300048915 | Bacteria | 23117 |
| 644 | Ga0496112_0082927 | 3300048915 | Bacteria | 3170 |
| 645 | Ga0496112_0553231 | 3300048915 | Unclassified | 1084 |
| 646 | Ga0496113_0022096 | 3300048916 | Bacteria | 4495 |
| 647 | Ga0496113_0030699 | 3300048916 | Bacteria | 3892 |
| 648 | Ga0496114_0017697 | 3300048917 | Bacteria | 5757 |
| 649 | Ga0496114_0048145 | 3300048917 | Bacteria | 3546 |
| 650 | Ga0496115_0099480 | 3300048918 | Bacteria | 2383 |
| 651 | Ga0496117_0039805 | 3300048920 | Bacteria | 3465 |
| 652 | Ga0496121_0029834 | 3300048924 | Bacteria | 5027 |
| 653 | Ga0496122_0094171 | 3300048925 | Bacteria | 2029 |
| 654 | Ga0496123_0109275 | 3300048926 | Bacteria | 1585 |
| 655 | Ga0495678_000394 | 3300049459 | Bacteria | 44121 |
| 656 | Ga0495682_0000014 | 3300049460 | Bacteria | 249706 |
| 657 | Ga0501031_0000006 | 3300049568 | Bacteria | 176019 |
| 658 | Ga0501031_0020152 | 3300049568 | Bacteria | 4346 |
| 659 | Ga0501031_0021358 | 3300049568 | Bacteria | 4220 |
| 660 | Ga0501031_0121797 | 3300049568 | Bacteria | 1704 |
| 661 | Ga0501031_0129724 | 3300049568 | Bacteria | 1647 |
| 662 | Ga0501032_0000016 | 3300049569 | Bacteria | 174688 |
| 663 | Ga0501032_0000019 | 3300049569 | Bacteria | 155168 |
| 664 | Ga0501032_0000663 | 3300049569 | Bacteria | 27949 |
| 665 | Ga0501032_0049323 | 3300049569 | Bacteria | 2840 |
| 666 | Ga0501032_0054646 | 3300049569 | Bacteria | 2687 |
| 667 | Ga0501033_0000247 | 3300049570 | Bacteria | 52148 |
| 668 | Ga0501033_0000304 | 3300049570 | Bacteria | 46485 |
| 669 | Ga0501033_0001170 | 3300049570 | Bacteria | 23691 |
| 670 | Ga0501033_0021429 | 3300049570 | Bacteria | 4875 |
| 671 | Ga0501033_0028092 | 3300049570 | Bacteria | 4228 |
| 672 | Ga0501033_0046990 | 3300049570 | Bacteria | 3210 |
| 673 | Ga0501034_0000130 | 3300049571 | Bacteria | 139568 |
| 674 | Ga0501034_0000243 | 3300049571 | Bacteria | 100637 |
| 675 | Ga0501034_0000668 | 3300049571 | Bacteria | 52166 |
| 676 | Ga0501034_0009787 | 3300049571 | Bacteria | 10025 |
| 677 | Ga0501034_0043629 | 3300049571 | Bacteria | 4537 |
| 678 | Ga0501034_0103352 | 3300049571 | Bacteria | 2842 |
| 679 | Ga0501034_0131833 | 3300049571 | Bacteria | 2482 |
| 680 | Ga0501034_0304326 | 3300049571 | Bacteria | 1530 |
| 681 | Ga0501036_0000126 | 3300049572 | Bacteria | 48725 |
| 682 | Ga0501036_0008112 | 3300049572 | Bacteria | 8606 |
| 683 | Ga0501036_0020797 | 3300049572 | Bacteria | 5511 |
| 684 | Ga0501036_0099308 | 3300049572 | Bacteria | 2462 |
| 685 | Ga0501037_0000013 | 3300049573 | Bacteria | 174688 |
| 686 | Ga0501037_0000154 | 3300049573 | Bacteria | 64077 |
| 687 | Ga0501037_0000218 | 3300049573 | Bacteria | 50780 |
| 688 | Ga0501037_0256063 | 3300049573 | Bacteria | 1224 |
| 689 | Ga0501038_0000012 | 3300049574 | Bacteria | 174688 |
| 690 | Ga0501038_0001991 | 3300049574 | Bacteria | 18870 |
| 691 | Ga0501038_0014331 | 3300049574 | Bacteria | 7224 |
| 692 | Ga0501038_0036570 | 3300049574 | Bacteria | 4308 |
| 693 | Ga0501038_0046399 | 3300049574 | Bacteria | 3767 |
| 694 | Ga0501039_0000019 | 3300049575 | Bacteria | 174688 |
| 695 | Ga0501039_0000028 | 3300049575 | Bacteria | 139568 |
| 696 | Ga0501039_0025670 | 3300049575 | Bacteria | 4528 |
| 697 | Ga0501039_0035936 | 3300049575 | Bacteria | 3822 |
| 698 | Ga0501040_0004900 | 3300049576 | Bacteria | 8661 |
| 699 | Ga0501042_0100113 | 3300049578 | Bacteria | 2084 |
| 700 | Ga0501042_0277663 | 3300049578 | Bacteria | 1210 |
| 701 | Ga0501043_0000007 | 3300049579 | Bacteria | 224595 |
| 702 | Ga0501043_0000113 | 3300049579 | Bacteria | 76112 |
| 703 | Ga0501043_0000410 | 3300049579 | Bacteria | 38554 |
| 704 | Ga0501043_0012683 | 3300049579 | Bacteria | 6591 |
| 705 | Ga0501043_0020805 | 3300049579 | Bacteria | 5145 |
| 706 | Ga0501043_0111469 | 3300049579 | Bacteria | 2148 |
| 707 | Ga0501043_0269161 | 3300049579 | Bacteria | 1308 |
| 708 | Ga0501046_0012937 | 3300049580 | Bacteria | 7092 |
| 709 | Ga0501046_0014482 | 3300049580 | Bacteria | 6653 |
| 710 | Ga0501046_0107510 | 3300049580 | Bacteria | 2134 |
| 711 | Ga0501047_0001728 | 3300049581 | Bacteria | 21212 |
| 712 | Ga0501047_0003138 | 3300049581 | Bacteria | 15680 |
| 713 | Ga0501047_0053161 | 3300049581 | Bacteria | 3915 |
| 714 | Ga0501047_0056141 | 3300049581 | Bacteria | 3807 |
| 715 | Ga0501047_0082812 | 3300049581 | Bacteria | 3084 |
| 716 | Ga0501067_0006027 | 3300049583 | Bacteria | 6721 |
| 717 | Ga0501068_0011521 | 3300049584 | Bacteria | 4993 |
| 718 | Ga0501069_0000027 | 3300049585 | Bacteria | 106217 |
| 719 | Ga0501070_0000231 | 3300049586 | Bacteria | 52768 |
| 720 | Ga0501070_0001716 | 3300049586 | Bacteria | 19386 |
| 721 | Ga0501070_0009169 | 3300049586 | Bacteria | 8366 |
| 722 | Ga0501070_0029060 | 3300049586 | Bacteria | 4636 |
| 723 | Ga0501070_0039405 | 3300049586 | Bacteria | 3942 |
| 724 | Ga0501070_0076266 | 3300049586 | Bacteria | 2775 |
| 725 | Ga0501070_0132097 | 3300049586 | Bacteria | 2062 |
| 726 | Ga0501071_0012648 | 3300049587 | Bacteria | 5733 |
| 727 | Ga0501071_0394920 | 3300049587 | Bacteria | 1056 |
| 728 | Ga0501072_0153380 | 3300049588 | Bacteria | 1837 |
| 729 | Ga0501073_0011007 | 3300049589 | Bacteria | 6616 |
| 730 | Ga0501073_0058680 | 3300049589 | Bacteria | 2689 |
| 731 | Ga0501073_0181501 | 3300049589 | Bacteria | 1456 |
| 732 | Ga0501073_0249726 | 3300049589 | Bacteria | 1225 |
| 733 | Ga0501074_0000066 | 3300049590 | Bacteria | 50258 |
| 734 | Ga0501074_0186541 | 3300049590 | Bacteria | 1479 |
| 735 | Ga0501074_0250824 | 3300049590 | Bacteria | 1259 |
| 736 | Ga0501238_008399 | 3300049671 | Bacteria | 1358 |
| 737 | Ga0501080_0000667 | 3300049742 | Bacteria | 27300 |
| 738 | Ga0501080_0028031 | 3300049742 | Bacteria | 5237 |
| 739 | Ga0501080_0110001 | 3300049742 | Bacteria | 2554 |
| 740 | Ga0501083_0000012 | 3300049744 | Bacteria | 178668 |
| 741 | Ga0501083_0023679 | 3300049744 | Bacteria | 4258 |
| 742 | Ga0501083_0087148 | 3300049744 | Bacteria | 2065 |
| 743 | Ga0501269_002980 | 3300049766 | Bacteria | 2056 |
| 744 | Ga0501280_003094 | 3300049776 | Bacteria | 2615 |
| 745 | Ga0501035_0000073 | 3300049822 | Bacteria | 122603 |
| 746 | Ga0501035_0000201 | 3300049822 | Bacteria | 72627 |
| 747 | Ga0501035_0000409 | 3300049822 | Bacteria | 48705 |
| 748 | Ga0501035_0012174 | 3300049822 | Bacteria | 7956 |
| 749 | Ga0501035_0030611 | 3300049822 | Bacteria | 4905 |
| 750 | Ga0501035_0059132 | 3300049822 | Bacteria | 3413 |
| 751 | Ga0501035_0122870 | 3300049822 | Bacteria | 2268 |
| 752 | Ga0501035_0127521 | 3300049822 | Bacteria | 2221 |
| 753 | Ga0501044_0000029 | 3300049823 | Bacteria | 176024 |
| 754 | Ga0501044_0000118 | 3300049823 | Bacteria | 95218 |
| 755 | Ga0501044_0015872 | 3300049823 | Bacteria | 8105 |
| 756 | Ga0501044_0038514 | 3300049823 | Bacteria | 4992 |
| 757 | Ga0501044_0055127 | 3300049823 | Bacteria | 4083 |
| 758 | Ga0501044_0098424 | 3300049823 | Bacteria | 2945 |
| 759 | Ga0501044_0103501 | 3300049823 | Bacteria | 2861 |
| 760 | Ga0501044_0142949 | 3300049823 | Bacteria | 2380 |
| 761 | Ga0501044_0156620 | 3300049823 | Bacteria | 2257 |
| 762 | nmdc:mga0yw44_441_c1 | 3300050492 | Bacteria | 14578 |
| 763 | nmdc:mga0rr50_171112_c1 | 3300050513 | Bacteria | 1770 |
| 764 | Ga0495601_0099729 | 3300053077 | Bacteria | 1875 |
| 765 | Ga0495601_0105990 | 3300053077 | Bacteria | 1818 |
| 766 | Ga0495595_0095717 | 3300053084 | Bacteria | 1429 |
| 767 | Ga0495619_0019668 | 3300053085 | Bacteria | 4294 |
| 768 | Ga0495619_0112421 | 3300053085 | Bacteria | 1862 |
| 769 | Ga0500595_000447 | 3300053119 | Bacteria | 25711 |
| 770 | Ga0500618_001639 | 3300053125 | Bacteria | 9634 |
| 771 | Ga0500574_002511 | 3300053141 | Bacteria | 3038 |
| 772 | Ga0500616_0000777 | 3300053153 | Bacteria | 36725 |
| 773 | Ga0500619_000959 | 3300053154 | Bacteria | 4950 |
| 774 | Ga0587080_015249 | 3300059503 | Bacteria | 1198 |
| 775 | Ga0587082_005260 | 3300059504 | Bacteria | 1675 |
| 776 | Ga0587082_015131 | 3300059504 | Bacteria | 1186 |
| 777 | Ga0587083_0018239 | 3300059505 | Bacteria | 1266 |
| 778 | Ga0587067_007907 | 3300059640 | Bacteria | 1537 |
| 779 | Ga0587069_004016 | 3300059642 | Bacteria | 1631 |
| 780 | Ga0587075_013315 | 3300059644 | Bacteria | 1130 |
| 781 | Ga0587079_004637 | 3300059647 | Bacteria | 1886 |
| 782 | Ga0587111_0004670 | 3300060346 | Bacteria | 2059 |
| 783 | Ga0501082_0015316 | 3300060353 | Bacteria | 6601 |
| 784 | Ga0501082_0080083 | 3300060353 | Bacteria | 2818 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003794 | Ga0055531_10006103 | Ga0055531_100061035 | 263 |
| 2 | 3300048908 | Ga0496105_0078221 | Ga0496105_0078221_135_962 | 275 |
| 3 | 3300048915 | Ga0496112_0553231 | Ga0496112_0553231_173_1000 | 275 |
| 4 | 3300044712 | Ga0453684_0000410 | Ga0453684_0000410_7421_8362 | 287 |
| 5 | 3300025949 | Ga0207667_10092686 | Ga0207667_100926862 | 297 |
| 6 | 3300015261 | Ga0182006_1000143 | Ga0182006_100014343 | 301 |
| 7 | 3300009148 | Ga0105243_10119272 | Ga0105243_101192722 | 303 |
| 8 | 3300014325 | Ga0163163_10019812 | Ga0163163_100198125 | 303 |
| 9 | 3300025901 | Ga0207688_10021352 | Ga0207688_100213522 | 303 |
| 10 | 3300048907 | Ga0496104_0039327 | Ga0496104_0039327_1430_2371 | 303 |
| 11 | 3300048913 | Ga0496110_0010533 | Ga0496110_0010533_1070_2011 | 303 |
| 12 | 3300048916 | Ga0496113_0030699 | Ga0496113_0030699_2444_3385 | 303 |
| 13 | 3300005288 | Ga0065714_10089262 | Ga0065714_100892622 | 304 |
| 14 | 3300035695 | Ga0373927_0002553 | Ga0373927_0002553_10999_11946 | 304 |
| 15 | 3300037068 | Ga0373925_0102579 | Ga0373925_0102579_732_1679 | 304 |
| 16 | 3300049568 | Ga0501031_0000006 | Ga0501031_0000006_30222_31178 | 304 |
| 17 | 3300049569 | Ga0501032_0000016 | Ga0501032_0000016_30227_31183 | 304 |
| 18 | 3300049570 | Ga0501033_0000247 | Ga0501033_0000247_30227_31183 | 304 |
| 19 | 3300049571 | Ga0501034_0000668 | Ga0501034_0000668_20966_21922 | 304 |
| 20 | 3300049572 | Ga0501036_0000126 | Ga0501036_0000126_22815_23771 | 304 |
| 21 | 3300049573 | Ga0501037_0000013 | Ga0501037_0000013_143506_144462 | 304 |
| 22 | 3300049574 | Ga0501038_0000012 | Ga0501038_0000012_143506_144462 | 304 |
| 23 | 3300049575 | Ga0501039_0000019 | Ga0501039_0000019_143506_144462 | 304 |
| 24 | 3300049576 | Ga0501040_0004900 | Ga0501040_0004900_1091_2047 | 304 |
| 25 | 3300049579 | Ga0501043_0000410 | Ga0501043_0000410_25089_26045 | 304 |
| 26 | 3300049580 | Ga0501046_0012937 | Ga0501046_0012937_2260_3216 | 304 |
| 27 | 3300049581 | Ga0501047_0001728 | Ga0501047_0001728_1173_2129 | 304 |
| 28 | 3300049586 | Ga0501070_0132097 | Ga0501070_0132097_155_1111 | 304 |
| 29 | 3300049822 | Ga0501035_0000409 | Ga0501035_0000409_22822_23778 | 304 |
| 30 | 3300049823 | Ga0501044_0000029 | Ga0501044_0000029_30227_31183 | 304 |
| 31 | 3300046460 | Ga0495638_0156393 | Ga0495638_0156393_124_1062 | 305 |
| 32 | 3300049590 | Ga0501074_0250824 | Ga0501074_0250824_14_934 | 305 |
| 33 | 3300044658 | Ga0466972_0065018 | Ga0466972_0065018_224_1183 | 306 |
| 34 | 3300048904 | Ga0496101_0282066 | Ga0496101_0282066_267_1199 | 306 |
| 35 | 3300005530 | Ga0070679_100019673 | Ga0070679_1000196736 | 308 |
| 36 | 3300049587 | Ga0501071_0394920 | Ga0501071_0394920_91_1032 | 308 |
| 37 | 3300049588 | Ga0501072_0153380 | Ga0501072_0153380_76_1017 | 308 |
| 38 | iso_pu_bacteria | 2522572158 | 2523102674 | 308 |
| 39 | iso_pu_bacteria | 2597490356 | 2599101154 | 308 |
| 40 | iso_pu_bacteria | 2846952575 | 2846954126 | 308 |
| 41 | iso_pu_bacteria | 2848858292 | 2848859598 | 308 |
| 42 | iso_pu_bacteria | 2869162929 | 2869168262 | 308 |
| 43 | iso_pu_bacteria | 2897803580 | 2897805620 | 308 |
| 44 | 3300025908 | Ga0207643_10070437 | Ga0207643_100704373 | 309 |
| 45 | 3300041413 | Ga0439465_0014168 | Ga0439465_0014168_897_1829 | 309 |
| 46 | iso_pu_bacteria | 2998344455 | 2998345001 | 309 |
| 47 | 3300005344 | Ga0070661_100134542 | Ga0070661_1001345421 | 310 |
| 48 | 3300005457 | Ga0070662_100213688 | Ga0070662_1002136881 | 310 |
| 49 | 3300005539 | Ga0068853_100071377 | Ga0068853_1000713773 | 310 |
| 50 | 3300005578 | Ga0068854_100042449 | Ga0068854_1000424493 | 310 |
| 51 | 3300005616 | Ga0068852_100008012 | Ga0068852_1000080123 | 310 |
| 52 | 3300013105 | Ga0157369_10583568 | Ga0157369_105835681 | 310 |
| 53 | 3300025933 | Ga0207706_10252130 | Ga0207706_102521302 | 310 |
| 54 | 3300025981 | Ga0207640_10010405 | Ga0207640_100104054 | 310 |
| 55 | 3300032004 | Ga0307414_10411827 | Ga0307414_104118271 | 310 |
| 56 | 3300041512 | Ga0451853_1178748 | Ga0451853_1178748_1077_2024 | 310 |
| 57 | 3300044712 | Ga0453684_0406506 | Ga0453684_0406506_486_1421 | 310 |
| 58 | 3300045051 | Ga0451576_0393260 | Ga0451576_0393260_361_1305 | 310 |
| 59 | 3300048907 | Ga0496104_0026147 | Ga0496104_0026147_2557_3501 | 310 |
| 60 | 3300048911 | Ga0496108_0204446 | Ga0496108_0204446_421_1365 | 310 |
| 61 | 3300048913 | Ga0496110_0095689 | Ga0496110_0095689_1531_2475 | 310 |
| 62 | 3300048914 | Ga0496111_0065817 | Ga0496111_0065817_321_1265 | 310 |
| 63 | 3300048915 | Ga0496112_0082927 | Ga0496112_0082927_429_1373 | 310 |
| 64 | 3300048916 | Ga0496113_0022096 | Ga0496113_0022096_1739_2683 | 310 |
| 65 | 3300048924 | Ga0496121_0029834 | Ga0496121_0029834_1420_2382 | 310 |
| 66 | 3300049571 | Ga0501034_0000243 | Ga0501034_0000243_32567_33634 | 310 |
| 67 | 3300049571 | Ga0501034_0131833 | Ga0501034_0131833_103_1059 | 310 |
| 68 | iso_pu_bacteria | 2643221580 | 2643913046 | 310 |
| 69 | iso_pu_bacteria | 2643221674 | 2644411500 | 310 |
| 70 | iso_pu_bacteria | 2937843397 | 2937844901 | 310 |
| 71 | iso_pu_bacteria | 639633007 | 639787066 | 310 |
| 72 | 3300003781 | Ga0055536_1018774 | Ga0055536_10187742 | 311 |
| 73 | 3300005338 | Ga0068868_100081917 | Ga0068868_1000819171 | 311 |
| 74 | 3300005616 | Ga0068852_100002563 | Ga0068852_10000256311 | 311 |
| 75 | 3300005834 | Ga0068851_10069635 | Ga0068851_100696352 | 311 |
| 76 | 3300006237 | Ga0097621_100058781 | Ga0097621_1000587813 | 311 |
| 77 | 3300006358 | Ga0068871_100142733 | Ga0068871_1001427331 | 311 |
| 78 | 3300025292 | Ga0209676_1000590 | Ga0209676_100059019 | 311 |
| 79 | 3300025298 | Ga0209050_1014575 | Ga0209050_10145752 | 311 |
| 80 | 3300025321 | Ga0207656_10006475 | Ga0207656_100064754 | 311 |
| 81 | 3300026023 | Ga0207677_10095431 | Ga0207677_100954312 | 311 |
| 82 | 3300026142 | Ga0207698_10006291 | Ga0207698_100062912 | 311 |
| 83 | 3300031240 | Ga0265320_10001181 | Ga0265320_100011814 | 311 |
| 84 | 3300031711 | Ga0265314_10027078 | Ga0265314_100270783 | 311 |
| 85 | 3300042876 | Ga0451577_0018682 | Ga0451577_0018682_518_1465 | 311 |
| 86 | 3300042876 | Ga0451577_0038802 | Ga0451577_0038802_778_1725 | 311 |
| 87 | 3300042876 | Ga0451577_0110661 | Ga0451577_0110661_366_1316 | 311 |
| 88 | 3300042876 | Ga0451577_0507799 | Ga0451577_0507799_21_965 | 311 |
| 89 | 3300044712 | Ga0453684_0190847 | Ga0453684_0190847_1303_2250 | 311 |
| 90 | 3300045051 | Ga0451576_0000108 | Ga0451576_0000108_198112_199062 | 311 |
| 91 | 3300045051 | Ga0451576_0000695 | Ga0451576_0000695_44310_45257 | 311 |
| 92 | 3300048907 | Ga0496104_0015271 | Ga0496104_0015271_317_1369 | 311 |
| 93 | 3300048913 | Ga0496110_0075640 | Ga0496110_0075640_237_1289 | 311 |
| 94 | 3300048920 | Ga0496117_0039805 | Ga0496117_0039805_2302_3351 | 311 |
| 95 | 3300049671 | Ga0501238_008399 | Ga0501238_008399_297_1247 | 311 |
| 96 | iso_pu_bacteria | 2522572158 | 2523103098 | 311 |
| 97 | iso_pu_bacteria | 2775506901 | 2776262338 | 311 |
| 98 | iso_pu_bacteria | 2882456835 | 2882458904 | 311 |
| 99 | iso_pu_bacteria | 8045864390 | 8045868823 | 311 |
| 100 | 3300005937 | Ga0081455_10000438 | Ga0081455_100004386 | 312 |
| 101 | 3300027111 | Ga0209281_1002608 | Ga0209281_10026083 | 312 |
| 102 | 3300027907 | Ga0207428_10138618 | Ga0207428_101386182 | 312 |
| 103 | 3300030735 | Ga0316178_1001888 | Ga0316178_10018889 | 312 |
| 104 | 3300031548 | Ga0307408_100194915 | Ga0307408_1001949151 | 312 |
| 105 | 3300031911 | Ga0307412_10099164 | Ga0307412_100991641 | 312 |
| 106 | 3300031995 | Ga0307409_100024624 | Ga0307409_1000246244 | 312 |
| 107 | 3300037068 | Ga0373925_0278705 | Ga0373925_0278705_225_1163 | 312 |
| 108 | 3300041405 | Ga0439438_000325 | Ga0439438_000325_17048_17998 | 312 |
| 109 | 3300041405 | Ga0439438_000560 | Ga0439438_000560_2000_2950 | 312 |
| 110 | 3300041407 | Ga0439447_011363 | Ga0439447_011363_280_1230 | 312 |
| 111 | 3300042006 | Ga0439432_042769 | Ga0439432_042769_137_1087 | 312 |
| 112 | 3300042010 | Ga0439452_000107 | Ga0439452_000107_17708_18658 | 312 |
| 113 | 3300042010 | Ga0439452_040282 | Ga0439452_040282_77_1027 | 312 |
| 114 | 3300042013 | Ga0439456_001944 | Ga0439456_001944_1655_2605 | 312 |
| 115 | 3300042115 | Ga0450911_000010 | Ga0450911_000010_59170_60120 | 312 |
| 116 | 3300042136 | Ga0450900_002531 | Ga0450900_002531_697_1647 | 312 |
| 117 | 3300042142 | Ga0450905_015374 | Ga0450905_015374_100_1050 | 312 |
| 118 | 3300042145 | Ga0450906_000096 | Ga0450906_000096_891_1841 | 312 |
| 119 | 3300042531 | Ga0450918_015227 | Ga0450918_015227_312_1262 | 312 |
| 120 | 3300044712 | Ga0453684_0000006 | Ga0453684_0000006_31094_32035 | 312 |
| 121 | 3300046500 | Ga0495596_0041378 | Ga0495596_0041378_675_1625 | 312 |
| 122 | 3300046512 | Ga0495610_0004661 | Ga0495610_0004661_5110_6060 | 312 |
| 123 | 3300046515 | Ga0495620_0000030 | Ga0495620_0000030_60480_61430 | 312 |
| 124 | 3300046519 | Ga0495632_0000553 | Ga0495632_0000553_31008_31958 | 312 |
| 125 | 3300046519 | Ga0495632_0070201 | Ga0495632_0070201_336_1286 | 312 |
| 126 | 3300046520 | Ga0495637_0002768 | Ga0495637_0002768_5145_6095 | 312 |
| 127 | 3300046522 | Ga0495643_0000295 | Ga0495643_0000295_59523_60473 | 312 |
| 128 | 3300046524 | Ga0495648_0001090 | Ga0495648_0001090_3195_4145 | 312 |
| 129 | 3300046538 | Ga0495609_0007997 | Ga0495609_0007997_3220_4170 | 312 |
| 130 | 3300046689 | Ga0495613_0248220 | Ga0495613_0248220_173_1126 | 312 |
| 131 | 3300047472 | Ga0495686_0012347 | Ga0495686_0012347_4592_5542 | 312 |
| 132 | 3300049568 | Ga0501031_0020152 | Ga0501031_0020152_692_1648 | 312 |
| 133 | 3300049568 | Ga0501031_0021358 | Ga0501031_0021358_2702_3658 | 312 |
| 134 | 3300049568 | Ga0501031_0129724 | Ga0501031_0129724_673_1629 | 312 |
| 135 | 3300049569 | Ga0501032_0049323 | Ga0501032_0049323_266_1216 | 312 |
| 136 | 3300049569 | Ga0501032_0054646 | Ga0501032_0054646_1573_2529 | 312 |
| 137 | 3300049570 | Ga0501033_0021429 | Ga0501033_0021429_3682_4638 | 312 |
| 138 | 3300049570 | Ga0501033_0028092 | Ga0501033_0028092_3114_4070 | 312 |
| 139 | 3300049570 | Ga0501033_0046990 | Ga0501033_0046990_2016_2966 | 312 |
| 140 | 3300049571 | Ga0501034_0043629 | Ga0501034_0043629_2890_3846 | 312 |
| 141 | 3300049571 | Ga0501034_0103352 | Ga0501034_0103352_159_1115 | 312 |
| 142 | 3300049572 | Ga0501036_0020797 | Ga0501036_0020797_1853_2809 | 312 |
| 143 | 3300049574 | Ga0501038_0036570 | Ga0501038_0036570_691_1647 | 312 |
| 144 | 3300049574 | Ga0501038_0046399 | Ga0501038_0046399_2720_3670 | 312 |
| 145 | 3300049575 | Ga0501039_0025670 | Ga0501039_0025670_255_1211 | 312 |
| 146 | 3300049575 | Ga0501039_0035936 | Ga0501039_0035936_168_1124 | 312 |
| 147 | 3300049579 | Ga0501043_0012683 | Ga0501043_0012683_4944_5900 | 312 |
| 148 | 3300049579 | Ga0501043_0020805 | Ga0501043_0020805_691_1647 | 312 |
| 149 | 3300049580 | Ga0501046_0014482 | Ga0501046_0014482_661_1617 | 312 |
| 150 | 3300049581 | Ga0501047_0003138 | Ga0501047_0003138_11022_11972 | 312 |
| 151 | 3300049581 | Ga0501047_0053161 | Ga0501047_0053161_431_1387 | 312 |
| 152 | 3300049586 | Ga0501070_0001716 | Ga0501070_0001716_958_1908 | 312 |
| 153 | 3300049586 | Ga0501070_0029060 | Ga0501070_0029060_1204_2160 | 312 |
| 154 | 3300049586 | Ga0501070_0039405 | Ga0501070_0039405_446_1402 | 312 |
| 155 | 3300049589 | Ga0501073_0011007 | Ga0501073_0011007_1545_2495 | 312 |
| 156 | 3300049589 | Ga0501073_0181501 | Ga0501073_0181501_352_1308 | 312 |
| 157 | 3300049589 | Ga0501073_0249726 | Ga0501073_0249726_190_1146 | 312 |
| 158 | 3300049742 | Ga0501080_0028031 | Ga0501080_0028031_3861_4817 | 312 |
| 159 | 3300049744 | Ga0501083_0087148 | Ga0501083_0087148_356_1312 | 312 |
| 160 | 3300049766 | Ga0501269_002980 | Ga0501269_002980_897_1847 | 312 |
| 161 | 3300049776 | Ga0501280_003094 | Ga0501280_003094_1166_2161 | 312 |
| 162 | 3300049822 | Ga0501035_0030611 | Ga0501035_0030611_84_1034 | 312 |
| 163 | 3300049823 | Ga0501044_0015872 | Ga0501044_0015872_2830_3780 | 312 |
| 164 | 3300049823 | Ga0501044_0055127 | Ga0501044_0055127_238_1194 | 312 |
| 165 | 3300049823 | Ga0501044_0098424 | Ga0501044_0098424_1967_2923 | 312 |
| 166 | 3300049823 | Ga0501044_0103501 | Ga0501044_0103501_1747_2703 | 312 |
| 167 | 3300060353 | Ga0501082_0080083 | Ga0501082_0080083_1710_2666 | 312 |
| 168 | iso_pu_bacteria | 2808606382 | 2808958625 | 312 |
| 169 | iso_pu_bacteria | 2818991436 | 2819542107 | 312 |
| 170 | iso_pu_bacteria | 2842832357 | 2842835216 | 312 |
| 171 | iso_pu_bacteria | 2883354860 | 2883357200 | 312 |
| 172 | iso_pu_bacteria | 2891633521 | 2891637500 | 312 |
| 173 | iso_pu_bacteria | 2998139840 | 2998142314 | 312 |
| 174 | iso_pu_bacteria | 3007511990 | 3007512101 | 312 |
| 175 | iso_pu_bacteria | 8005658619 | 8005662407 | 312 |
| 176 | iso_pu_bacteria | 8029995093 | 8029998384 | 312 |
| 177 | iso_pu_bacteria | 8052494512 | 8052498081 | 312 |
| 178 | iso_pu_bacteria | 8056166840 | 8056168755 | 312 |
| 179 | iso_pu_bacteria | 8056875544 | 8056879284 | 312 |
| 180 | 3300003203 | JGI25406J46586_10043756 | JGI25406J46586_100437562 | 313 |
| 181 | 3300003323 | rootH1_10090803 | rootH1_100908031 | 313 |
| 182 | 3300003792 | Ga0055540_1003328 | Ga0055540_10033285 | 313 |
| 183 | 3300005336 | Ga0070680_100145415 | Ga0070680_1001454152 | 313 |
| 184 | 3300005345 | Ga0070692_10113971 | Ga0070692_101139711 | 313 |
| 185 | 3300005530 | Ga0070679_100540150 | Ga0070679_1005401501 | 313 |
| 186 | 3300005985 | Ga0081539_10001093 | Ga0081539_1000109342 | 313 |
| 187 | 3300006038 | Ga0075365_10006849 | Ga0075365_100068493 | 313 |
| 188 | 3300013105 | Ga0157369_10001055 | Ga0157369_1000105527 | 313 |
| 189 | 3300013307 | Ga0157372_10433971 | Ga0157372_104339712 | 313 |
| 190 | 3300025292 | Ga0209676_1004595 | Ga0209676_10045957 | 313 |
| 191 | 3300025297 | Ga0209758_1000191 | Ga0209758_100019149 | 313 |
| 192 | 3300025303 | Ga0209051_1002129 | Ga0209051_10021294 | 313 |
| 193 | 3300025304 | Ga0209257_1002628 | Ga0209257_10026288 | 313 |
| 194 | 3300025917 | Ga0207660_10098777 | Ga0207660_100987771 | 313 |
| 195 | 3300025928 | Ga0207700_10077734 | Ga0207700_100777343 | 313 |
| 196 | 3300026078 | Ga0207702_10172822 | Ga0207702_101728222 | 313 |
| 197 | 3300028379 | Ga0268266_10092168 | Ga0268266_100921682 | 313 |
| 198 | 3300031548 | Ga0307408_100000028 | Ga0307408_10000002896 | 313 |
| 199 | 3300032004 | Ga0307414_10001280 | Ga0307414_100012808 | 313 |
| 200 | 3300032004 | Ga0307414_10027440 | Ga0307414_100274402 | 313 |
| 201 | 3300036401 | Ga0373937_0001059 | Ga0373937_0001059_12228_13178 | 313 |
| 202 | 3300036401 | Ga0373937_0356820 | Ga0373937_0356820_82_1035 | 313 |
| 203 | 3300036401 | Ga0373937_0406399 | Ga0373937_0406399_76_1029 | 313 |
| 204 | 3300037312 | Ga0395899_0000590 | Ga0395899_0000590_5428_6387 | 313 |
| 205 | 3300037312 | Ga0395899_0010616 | Ga0395899_0010616_5943_6902 | 313 |
| 206 | 3300037312 | Ga0395899_0028074 | Ga0395899_0028074_2830_3783 | 313 |
| 207 | 3300037418 | Ga0395900_0008216 | Ga0395900_0008216_1092_2045 | 313 |
| 208 | 3300037418 | Ga0395900_0018519 | Ga0395900_0018519_1130_2089 | 313 |
| 209 | 3300037418 | Ga0395900_0019772 | Ga0395900_0019772_3492_4451 | 313 |
| 210 | 3300037466 | Ga0395898_0007300 | Ga0395898_0007300_5293_6246 | 313 |
| 211 | 3300037466 | Ga0395898_0059593 | Ga0395898_0059593_2713_3672 | 313 |
| 212 | 3300037471 | Ga0395905_0163994 | Ga0395905_0163994_741_1700 | 313 |
| 213 | 3300038443 | Ga0395901_0016591 | Ga0395901_0016591_1260_2213 | 313 |
| 214 | 3300038443 | Ga0395901_0298915 | Ga0395901_0298915_560_1519 | 313 |
| 215 | 3300041405 | Ga0439438_000523 | Ga0439438_000523_3083_4036 | 313 |
| 216 | 3300041411 | Ga0439466_0006481 | Ga0439466_0006481_415_1368 | 313 |
| 217 | 3300042010 | Ga0439452_001101 | Ga0439452_001101_10670_11623 | 313 |
| 218 | 3300042115 | Ga0450911_001859 | Ga0450911_001859_3355_4308 | 313 |
| 219 | 3300042138 | Ga0450903_001468 | Ga0450903_001468_1220_2173 | 313 |
| 220 | 3300042142 | Ga0450905_002036 | Ga0450905_002036_1083_2036 | 313 |
| 221 | 3300042146 | Ga0450907_000858 | Ga0450907_000858_3155_4108 | 313 |
| 222 | 3300042439 | Ga0439464_0001499 | Ga0439464_0001499_3939_4892 | 313 |
| 223 | 3300042461 | Ga0439460_0004134 | Ga0439460_0004134_312_1265 | 313 |
| 224 | 3300044658 | Ga0466972_0000162 | Ga0466972_0000162_5151_6125 | 313 |
| 225 | 3300044706 | Ga0466964_0039023 | Ga0466964_0039023_304_1278 | 313 |
| 226 | 3300044765 | Ga0466970_0001930 | Ga0466970_0001930_7433_8392 | 313 |
| 227 | 3300045049 | Ga0466959_0001957 | Ga0466959_0001957_2258_3217 | 313 |
| 228 | 3300046458 | Ga0495591_001322 | Ga0495591_001322_9350_10303 | 313 |
| 229 | 3300046460 | Ga0495638_0017612 | Ga0495638_0017612_1335_2294 | 313 |
| 230 | 3300046474 | Ga0495605_0000128 | Ga0495605_0000128_77517_78470 | 313 |
| 231 | 3300046501 | Ga0495607_0000197 | Ga0495607_0000197_58281_59234 | 313 |
| 232 | 3300046501 | Ga0495607_0005748 | Ga0495607_0005748_777_1730 | 313 |
| 233 | 3300046501 | Ga0495607_0006748 | Ga0495607_0006748_6102_7055 | 313 |
| 234 | 3300046501 | Ga0495607_0118131 | Ga0495607_0118131_236_1189 | 313 |
| 235 | 3300046506 | Ga0495583_0008522 | Ga0495583_0008522_4210_5163 | 313 |
| 236 | 3300046515 | Ga0495620_0000148 | Ga0495620_0000148_4115_5068 | 313 |
| 237 | 3300046519 | Ga0495632_0017233 | Ga0495632_0017233_244_1197 | 313 |
| 238 | 3300046520 | Ga0495637_0000099 | Ga0495637_0000099_12745_13698 | 313 |
| 239 | 3300046520 | Ga0495637_0013134 | Ga0495637_0013134_2768_3721 | 313 |
| 240 | 3300046520 | Ga0495637_0050308 | Ga0495637_0050308_586_1578 | 313 |
| 241 | 3300046522 | Ga0495643_0119682 | Ga0495643_0119682_101_1054 | 313 |
| 242 | 3300046524 | Ga0495648_0001324 | Ga0495648_0001324_949_1902 | 313 |
| 243 | 3300046616 | Ga0495668_0010420 | Ga0495668_0010420_2673_3626 | 313 |
| 244 | 3300046665 | Ga0495661_0001554 | Ga0495661_0001554_11274_12227 | 313 |
| 245 | 3300046683 | Ga0495658_0117547 | Ga0495658_0117547_253_1206 | 313 |
| 246 | 3300046692 | Ga0495671_0020446 | Ga0495671_0020446_1883_2836 | 313 |
| 247 | 3300046692 | Ga0495671_0058908 | Ga0495671_0058908_751_1743 | 313 |
| 248 | 3300046694 | Ga0495649_0160278 | Ga0495649_0160278_61_1014 | 313 |
| 249 | 3300046794 | Ga0495589_0014569 | Ga0495589_0014569_2863_3816 | 313 |
| 250 | 3300046810 | Ga0495660_0006828 | Ga0495660_0006828_996_1949 | 313 |
| 251 | 3300047321 | Ga0495676_0010575 | Ga0495676_0010575_1796_2788 | 313 |
| 252 | 3300047469 | Ga0495673_0002221 | Ga0495673_0002221_4922_5875 | 313 |
| 253 | 3300047472 | Ga0495686_0057459 | Ga0495686_0057459_1245_2198 | 313 |
| 254 | 3300048925 | Ga0496122_0094171 | Ga0496122_0094171_675_1820 | 313 |
| 255 | 3300049459 | Ga0495678_000394 | Ga0495678_000394_11725_12678 | 313 |
| 256 | 3300049460 | Ga0495682_0000014 | Ga0495682_0000014_244700_245653 | 313 |
| 257 | 3300049568 | Ga0501031_0121797 | Ga0501031_0121797_101_1060 | 313 |
| 258 | 3300049569 | Ga0501032_0000019 | Ga0501032_0000019_28913_29872 | 313 |
| 259 | 3300049569 | Ga0501032_0000663 | Ga0501032_0000663_2091_3044 | 313 |
| 260 | 3300049570 | Ga0501033_0000304 | Ga0501033_0000304_39241_40194 | 313 |
| 261 | 3300049570 | Ga0501033_0001170 | Ga0501033_0001170_103_1062 | 313 |
| 262 | 3300049571 | Ga0501034_0000130 | Ga0501034_0000130_13313_14272 | 313 |
| 263 | 3300049571 | Ga0501034_0304326 | Ga0501034_0304326_68_1027 | 313 |
| 264 | 3300049572 | Ga0501036_0008112 | Ga0501036_0008112_85_1044 | 313 |
| 265 | 3300049572 | Ga0501036_0099308 | Ga0501036_0099308_1075_2082 | 313 |
| 266 | 3300049573 | Ga0501037_0000154 | Ga0501037_0000154_31637_32590 | 313 |
| 267 | 3300049573 | Ga0501037_0000218 | Ga0501037_0000218_11284_12243 | 313 |
| 268 | 3300049573 | Ga0501037_0256063 | Ga0501037_0256063_81_1088 | 313 |
| 269 | 3300049574 | Ga0501038_0001991 | Ga0501038_0001991_13313_14272 | 313 |
| 270 | 3300049574 | Ga0501038_0014331 | Ga0501038_0014331_153_1106 | 313 |
| 271 | 3300049575 | Ga0501039_0000028 | Ga0501039_0000028_125297_126256 | 313 |
| 272 | 3300049578 | Ga0501042_0100113 | Ga0501042_0100113_370_1419 | 313 |
| 273 | 3300049578 | Ga0501042_0277663 | Ga0501042_0277663_149_1108 | 313 |
| 274 | 3300049579 | Ga0501043_0000007 | Ga0501043_0000007_49914_50867 | 313 |
| 275 | 3300049579 | Ga0501043_0000113 | Ga0501043_0000113_33175_34134 | 313 |
| 276 | 3300049579 | Ga0501043_0111469 | Ga0501043_0111469_399_1352 | 313 |
| 277 | 3300049579 | Ga0501043_0269161 | Ga0501043_0269161_279_1262 | 313 |
| 278 | 3300049580 | Ga0501046_0107510 | Ga0501046_0107510_1004_2011 | 313 |
| 279 | 3300049581 | Ga0501047_0056141 | Ga0501047_0056141_705_1712 | 313 |
| 280 | 3300049581 | Ga0501047_0082812 | Ga0501047_0082812_948_1901 | 313 |
| 281 | 3300049583 | Ga0501067_0006027 | Ga0501067_0006027_5568_6521 | 313 |
| 282 | 3300049584 | Ga0501068_0011521 | Ga0501068_0011521_3973_4926 | 313 |
| 283 | 3300049585 | Ga0501069_0000027 | Ga0501069_0000027_55346_56299 | 313 |
| 284 | 3300049586 | Ga0501070_0000231 | Ga0501070_0000231_5904_6857 | 313 |
| 285 | 3300049586 | Ga0501070_0009169 | Ga0501070_0009169_3743_4696 | 313 |
| 286 | 3300049586 | Ga0501070_0076266 | Ga0501070_0076266_284_1237 | 313 |
| 287 | 3300049587 | Ga0501071_0012648 | Ga0501071_0012648_1812_2765 | 313 |
| 288 | 3300049589 | Ga0501073_0058680 | Ga0501073_0058680_49_1002 | 313 |
| 289 | 3300049590 | Ga0501074_0000066 | Ga0501074_0000066_5647_6600 | 313 |
| 290 | 3300049590 | Ga0501074_0186541 | Ga0501074_0186541_150_1097 | 313 |
| 291 | 3300049742 | Ga0501080_0000667 | Ga0501080_0000667_8262_9215 | 313 |
| 292 | 3300049742 | Ga0501080_0110001 | Ga0501080_0110001_317_1324 | 313 |
| 293 | 3300049744 | Ga0501083_0000012 | Ga0501083_0000012_127645_128598 | 313 |
| 294 | 3300049822 | Ga0501035_0000073 | Ga0501035_0000073_77413_78366 | 313 |
| 295 | 3300049822 | Ga0501035_0000201 | Ga0501035_0000201_33173_34132 | 313 |
| 296 | 3300049822 | Ga0501035_0012174 | Ga0501035_0012174_5503_6456 | 313 |
| 297 | 3300049822 | Ga0501035_0059132 | Ga0501035_0059132_606_1613 | 313 |
| 298 | 3300049822 | Ga0501035_0122870 | Ga0501035_0122870_913_1866 | 313 |
| 299 | 3300049822 | Ga0501035_0127521 | Ga0501035_0127521_907_1860 | 313 |
| 300 | 3300049823 | Ga0501044_0000118 | Ga0501044_0000118_44324_45277 | 313 |
| 301 | 3300049823 | Ga0501044_0038514 | Ga0501044_0038514_1450_2403 | 313 |
| 302 | 3300049823 | Ga0501044_0142949 | Ga0501044_0142949_178_1137 | 313 |
| 303 | 3300049823 | Ga0501044_0156620 | Ga0501044_0156620_927_1880 | 313 |
| 304 | 3300050492 | nmdc:mga0yw44_441_c1 | nmdc:mga0yw44_441_c1_4432_5412 | 313 |
| 305 | 3300053125 | Ga0500618_001639 | Ga0500618_001639_8537_9490 | 313 |
| 306 | 3300053153 | Ga0500616_0000777 | Ga0500616_0000777_4822_5793 | 313 |
| 307 | 3300059503 | Ga0587080_015249 | Ga0587080_015249_163_1122 | 313 |
| 308 | 3300059504 | Ga0587082_005260 | Ga0587082_005260_86_1045 | 313 |
| 309 | 3300059504 | Ga0587082_015131 | Ga0587082_015131_142_1101 | 313 |
| 310 | 3300059505 | Ga0587083_0018239 | Ga0587083_0018239_225_1184 | 313 |
| 311 | 3300059640 | Ga0587067_007907 | Ga0587067_007907_127_1086 | 313 |
| 312 | 3300059642 | Ga0587069_004016 | Ga0587069_004016_626_1585 | 313 |
| 313 | 3300059644 | Ga0587075_013315 | Ga0587075_013315_62_1021 | 313 |
| 314 | 3300059647 | Ga0587079_004637 | Ga0587079_004637_625_1584 | 313 |
| 315 | 3300060346 | Ga0587111_0004670 | Ga0587111_0004670_355_1314 | 313 |
| 316 | 3300060353 | Ga0501082_0015316 | Ga0501082_0015316_5542_6495 | 313 |
| 317 | iso_pu_bacteria | 2510917026 | 2511170425 | 313 |
| 318 | iso_pu_bacteria | 2511231221 | 2512035008 | 313 |
| 319 | iso_pu_bacteria | 2585427633 | 2585994656 | 313 |
| 320 | iso_pu_bacteria | 2585427634 | 2585999140 | 313 |
| 321 | iso_pu_bacteria | 2597489875 | 2597810774 | 313 |
| 322 | iso_pu_bacteria | 2600254954 | 2600446194 | 313 |
| 323 | iso_pu_bacteria | 2600255389 | 2602008004 | 313 |
| 324 | iso_pu_bacteria | 2643221564 | 2643836933 | 313 |
| 325 | iso_pu_bacteria | 2643221603 | 2644031503 | 313 |
| 326 | iso_pu_bacteria | 2808606377 | 2808929751 | 313 |
| 327 | iso_pu_bacteria | 2808606381 | 2808951670 | 313 |
| 328 | iso_pu_bacteria | 2808606385 | 2808979853 | 313 |
| 329 | iso_pu_bacteria | 2808606388 | 2808995573 | 313 |
| 330 | iso_pu_bacteria | 2823421272 | 2823421344 | 313 |
| 331 | iso_pu_bacteria | 2839993093 | 2839994842 | 313 |
| 332 | iso_pu_bacteria | 2852612431 | 2852614633 | 313 |
| 333 | iso_pu_bacteria | 2852667396 | 2852667629 | 313 |
| 334 | iso_pu_bacteria | 2854896431 | 2854898452 | 313 |
| 335 | iso_pu_bacteria | 2854916844 | 2854917773 | 313 |
| 336 | iso_pu_bacteria | 2860339153 | 2860339346 | 313 |
| 337 | iso_pu_bacteria | 2888350351 | 2888353332 | 313 |
| 338 | iso_pu_bacteria | 2889010040 | 2889015049 | 313 |
| 339 | iso_pu_bacteria | 2889016732 | 2889019877 | 313 |
| 340 | iso_pu_bacteria | 2906354277 | 2906355693 | 313 |
| 341 | iso_pu_bacteria | 2919171160 | 2919171885 | 313 |
| 342 | iso_pu_bacteria | 2919501602 | 2919502964 | 313 |
| 343 | iso_pu_bacteria | 2922130491 | 2922130745 | 313 |
| 344 | iso_pu_bacteria | 2926063275 | 2926064637 | 313 |
| 345 | iso_pu_bacteria | 2958100919 | 2958102448 | 313 |
| 346 | iso_pu_bacteria | 2958172287 | 2958174004 | 313 |
| 347 | iso_pu_bacteria | 2965119406 | 2965127532 | 313 |
| 348 | iso_pu_bacteria | 2979710463 | 2979717310 | 313 |
| 349 | iso_pu_bacteria | 2979742915 | 2979751602 | 313 |
| 350 | iso_pu_bacteria | 2987652177 | 2987658953 | 313 |
| 351 | iso_pu_bacteria | 8034962539 | 8034965514 | 313 |
| 352 | iso_pu_bacteria | 8054002106 | 8054008971 | 313 |
| 353 | 3300005328 | Ga0070676_10061476 | Ga0070676_100614761 | 314 |
| 354 | 3300005330 | Ga0070690_100001596 | Ga0070690_1000015962 | 314 |
| 355 | 3300005331 | Ga0070670_100036804 | Ga0070670_1000368042 | 314 |
| 356 | 3300005333 | Ga0070677_10087592 | Ga0070677_100875921 | 314 |
| 357 | 3300005334 | Ga0068869_100093136 | Ga0068869_1000931362 | 314 |
| 358 | 3300005335 | Ga0070666_10058733 | Ga0070666_100587332 | 314 |
| 359 | 3300005336 | Ga0070680_100027929 | Ga0070680_1000279292 | 314 |
| 360 | 3300005337 | Ga0070682_100028485 | Ga0070682_1000284852 | 314 |
| 361 | 3300005338 | Ga0068868_100008529 | Ga0068868_1000085297 | 314 |
| 362 | 3300005338 | Ga0068868_100068700 | Ga0068868_1000687002 | 314 |
| 363 | 3300005339 | Ga0070660_100099632 | Ga0070660_1000996322 | 314 |
| 364 | 3300005344 | Ga0070661_100057040 | Ga0070661_1000570402 | 314 |
| 365 | 3300005345 | Ga0070692_10003709 | Ga0070692_100037094 | 314 |
| 366 | 3300005345 | Ga0070692_10162336 | Ga0070692_101623361 | 314 |
| 367 | 3300005353 | Ga0070669_100195615 | Ga0070669_1001956151 | 314 |
| 368 | 3300005355 | Ga0070671_100156319 | Ga0070671_1001563192 | 314 |
| 369 | 3300005356 | Ga0070674_100090010 | Ga0070674_1000900102 | 314 |
| 370 | 3300005364 | Ga0070673_100004297 | Ga0070673_1000042975 | 314 |
| 371 | 3300005366 | Ga0070659_100009606 | Ga0070659_1000096067 | 314 |
| 372 | 3300005366 | Ga0070659_100202068 | Ga0070659_1002020682 | 314 |
| 373 | 3300005366 | Ga0070659_100384191 | Ga0070659_1003841911 | 314 |
| 374 | 3300005367 | Ga0070667_100140265 | Ga0070667_1001402651 | 314 |
| 375 | 3300005434 | Ga0070709_10012700 | Ga0070709_100127005 | 314 |
| 376 | 3300005434 | Ga0070709_10021508 | Ga0070709_100215082 | 314 |
| 377 | 3300005435 | Ga0070714_100185687 | Ga0070714_1001856872 | 314 |
| 378 | 3300005436 | Ga0070713_100018721 | Ga0070713_1000187214 | 314 |
| 379 | 3300005436 | Ga0070713_100130489 | Ga0070713_1001304892 | 314 |
| 380 | 3300005437 | Ga0070710_10010103 | Ga0070710_100101033 | 314 |
| 381 | 3300005437 | Ga0070710_10046000 | Ga0070710_100460002 | 314 |
| 382 | 3300005438 | Ga0070701_10022204 | Ga0070701_100222042 | 314 |
| 383 | 3300005439 | Ga0070711_100002652 | Ga0070711_1000026522 | 314 |
| 384 | 3300005440 | Ga0070705_100134515 | Ga0070705_1001345152 | 314 |
| 385 | 3300005440 | Ga0070705_100188828 | Ga0070705_1001888282 | 314 |
| 386 | 3300005444 | Ga0070694_100030783 | Ga0070694_1000307832 | 314 |
| 387 | 3300005445 | Ga0070708_100023923 | Ga0070708_1000239233 | 314 |
| 388 | 3300005455 | Ga0070663_100011218 | Ga0070663_1000112184 | 314 |
| 389 | 3300005455 | Ga0070663_100085494 | Ga0070663_1000854943 | 314 |
| 390 | 3300005456 | Ga0070678_100002448 | Ga0070678_10000244810 | 314 |
| 391 | 3300005457 | Ga0070662_100199514 | Ga0070662_1001995142 | 314 |
| 392 | 3300005457 | Ga0070662_100267372 | Ga0070662_1002673722 | 314 |
| 393 | 3300005459 | Ga0068867_100016181 | Ga0068867_1000161814 | 314 |
| 394 | 3300005459 | Ga0068867_100303364 | Ga0068867_1003033641 | 314 |
| 395 | 3300005466 | Ga0070685_10000875 | Ga0070685_1000087512 | 314 |
| 396 | 3300005467 | Ga0070706_100074933 | Ga0070706_1000749332 | 314 |
| 397 | 3300005468 | Ga0070707_100048222 | Ga0070707_1000482225 | 314 |
| 398 | 3300005471 | Ga0070698_100083905 | Ga0070698_1000839054 | 314 |
| 399 | 3300005518 | Ga0070699_100007695 | Ga0070699_1000076953 | 314 |
| 400 | 3300005530 | Ga0070679_100062132 | Ga0070679_1000621324 | 314 |
| 401 | 3300005535 | Ga0070684_100058203 | Ga0070684_1000582034 | 314 |
| 402 | 3300005536 | Ga0070697_100051730 | Ga0070697_1000517304 | 314 |
| 403 | 3300005539 | Ga0068853_100037502 | Ga0068853_1000375024 | 314 |
| 404 | 3300005543 | Ga0070672_100265956 | Ga0070672_1002659562 | 314 |
| 405 | 3300005545 | Ga0070695_100001413 | Ga0070695_1000014133 | 314 |
| 406 | 3300005546 | Ga0070696_100038761 | Ga0070696_1000387612 | 314 |
| 407 | 3300005547 | Ga0070693_100000736 | Ga0070693_10000073615 | 314 |
| 408 | 3300005548 | Ga0070665_100002011 | Ga0070665_10000201111 | 314 |
| 409 | 3300005549 | Ga0070704_100025569 | Ga0070704_1000255693 | 314 |
| 410 | 3300005563 | Ga0068855_100199948 | Ga0068855_1001999483 | 314 |
| 411 | 3300005564 | Ga0070664_100033629 | Ga0070664_1000336294 | 314 |
| 412 | 3300005577 | Ga0068857_100142569 | Ga0068857_1001425692 | 314 |
| 413 | 3300005578 | Ga0068854_100004576 | Ga0068854_1000045762 | 314 |
| 414 | 3300005578 | Ga0068854_100016831 | Ga0068854_1000168315 | 314 |
| 415 | 3300005614 | Ga0068856_100093545 | Ga0068856_1000935452 | 314 |
| 416 | 3300005614 | Ga0068856_100114069 | Ga0068856_1001140694 | 314 |
| 417 | 3300005615 | Ga0070702_100037966 | Ga0070702_1000379662 | 314 |
| 418 | 3300005616 | Ga0068852_100051932 | Ga0068852_1000519324 | 314 |
| 419 | 3300005616 | Ga0068852_100110836 | Ga0068852_1001108362 | 314 |
| 420 | 3300005617 | Ga0068859_100005232 | Ga0068859_1000052327 | 314 |
| 421 | 3300005618 | Ga0068864_100004349 | Ga0068864_1000043493 | 314 |
| 422 | 3300005718 | Ga0068866_10003938 | Ga0068866_100039382 | 314 |
| 423 | 3300005834 | Ga0068851_10037090 | Ga0068851_100370902 | 314 |
| 424 | 3300005841 | Ga0068863_100001667 | Ga0068863_10000166713 | 314 |
| 425 | 3300005842 | Ga0068858_100001809 | Ga0068858_10000180910 | 314 |
| 426 | 3300005843 | Ga0068860_100223075 | Ga0068860_1002230752 | 314 |
| 427 | 3300006175 | Ga0070712_100016226 | Ga0070712_1000162264 | 314 |
| 428 | 3300006237 | Ga0097621_100066150 | Ga0097621_1000661502 | 314 |
| 429 | 3300006358 | Ga0068871_100154363 | Ga0068871_1001543631 | 314 |
| 430 | 3300006358 | Ga0068871_100226863 | Ga0068871_1002268631 | 314 |
| 431 | 3300006881 | Ga0068865_100019122 | Ga0068865_1000191222 | 314 |
| 432 | 3300006931 | Ga0097620_100005232 | Ga0097620_1000052327 | 314 |
| 433 | 3300007076 | Ga0075435_100175954 | Ga0075435_1001759542 | 314 |
| 434 | 3300009093 | Ga0105240_10066377 | Ga0105240_100663772 | 314 |
| 435 | 3300009098 | Ga0105245_10162659 | Ga0105245_101626592 | 314 |
| 436 | 3300009101 | Ga0105247_10045703 | Ga0105247_100457033 | 314 |
| 437 | 3300009148 | Ga0105243_10057920 | Ga0105243_100579202 | 314 |
| 438 | 3300009174 | Ga0105241_10041482 | Ga0105241_100414824 | 314 |
| 439 | 3300009176 | Ga0105242_10050907 | Ga0105242_100509073 | 314 |
| 440 | 3300009177 | Ga0105248_10120824 | Ga0105248_101208242 | 314 |
| 441 | 3300009545 | Ga0105237_10146314 | Ga0105237_101463143 | 314 |
| 442 | 3300009551 | Ga0105238_10086374 | Ga0105238_100863742 | 314 |
| 443 | 3300009551 | Ga0105238_10095199 | Ga0105238_100951994 | 314 |
| 444 | 3300009553 | Ga0105249_10073643 | Ga0105249_100736432 | 314 |
| 445 | 3300010375 | Ga0105239_10168648 | Ga0105239_101686482 | 314 |
| 446 | 3300010375 | Ga0105239_10177751 | Ga0105239_101777513 | 314 |
| 447 | 3300011119 | Ga0105246_10039608 | Ga0105246_100396082 | 314 |
| 448 | 3300011119 | Ga0105246_10093886 | Ga0105246_100938862 | 314 |
| 449 | 3300013100 | Ga0157373_10026641 | Ga0157373_100266414 | 314 |
| 450 | 3300013100 | Ga0157373_10070413 | Ga0157373_100704132 | 314 |
| 451 | 3300013102 | Ga0157371_10032051 | Ga0157371_100320513 | 314 |
| 452 | 3300013104 | Ga0157370_10010238 | Ga0157370_100102381 | 314 |
| 453 | 3300013104 | Ga0157370_10117932 | Ga0157370_101179322 | 314 |
| 454 | 3300013104 | Ga0157370_10137663 | Ga0157370_101376632 | 314 |
| 455 | 3300013296 | Ga0157374_10001520 | Ga0157374_1000152011 | 314 |
| 456 | 3300013296 | Ga0157374_10170283 | Ga0157374_101702832 | 314 |
| 457 | 3300013297 | Ga0157378_10184572 | Ga0157378_101845722 | 314 |
| 458 | 3300013306 | Ga0163162_10178027 | Ga0163162_101780272 | 314 |
| 459 | 3300013307 | Ga0157372_10143694 | Ga0157372_101436942 | 314 |
| 460 | 3300013308 | Ga0157375_10149243 | Ga0157375_101492432 | 314 |
| 461 | 3300014325 | Ga0163163_10011448 | Ga0163163_100114487 | 314 |
| 462 | 3300014968 | Ga0157379_10063612 | Ga0157379_100636122 | 314 |
| 463 | 3300014969 | Ga0157376_10197097 | Ga0157376_101970972 | 314 |
| 464 | 3300015261 | Ga0182006_1052987 | Ga0182006_10529872 | 314 |
| 465 | 3300017792 | Ga0163161_10035214 | Ga0163161_100352141 | 314 |
| 466 | 3300025321 | Ga0207656_10007607 | Ga0207656_100076072 | 314 |
| 467 | 3300025899 | Ga0207642_10025710 | Ga0207642_100257101 | 314 |
| 468 | 3300025900 | Ga0207710_10025741 | Ga0207710_100257413 | 314 |
| 469 | 3300025903 | Ga0207680_10032849 | Ga0207680_100328493 | 314 |
| 470 | 3300025906 | Ga0207699_10066657 | Ga0207699_100666572 | 314 |
| 471 | 3300025907 | Ga0207645_10043526 | Ga0207645_100435262 | 314 |
| 472 | 3300025910 | Ga0207684_10061717 | Ga0207684_100617172 | 314 |
| 473 | 3300025911 | Ga0207654_10097868 | Ga0207654_100978682 | 314 |
| 474 | 3300025912 | Ga0207707_10067275 | Ga0207707_100672752 | 314 |
| 475 | 3300025913 | Ga0207695_10054390 | Ga0207695_100543902 | 314 |
| 476 | 3300025915 | Ga0207693_10000153 | Ga0207693_1000015357 | 314 |
| 477 | 3300025915 | Ga0207693_10009237 | Ga0207693_100092376 | 314 |
| 478 | 3300025916 | Ga0207663_10129265 | Ga0207663_101292652 | 314 |
| 479 | 3300025919 | Ga0207657_10001195 | Ga0207657_100011955 | 314 |
| 480 | 3300025921 | Ga0207652_10205620 | Ga0207652_102056201 | 314 |
| 481 | 3300025922 | Ga0207646_10049291 | Ga0207646_100492912 | 314 |
| 482 | 3300025923 | Ga0207681_10258143 | Ga0207681_102581432 | 314 |
| 483 | 3300025924 | Ga0207694_10205905 | Ga0207694_102059052 | 314 |
| 484 | 3300025925 | Ga0207650_10312102 | Ga0207650_103121022 | 314 |
| 485 | 3300025927 | Ga0207687_10041564 | Ga0207687_100415641 | 314 |
| 486 | 3300025928 | Ga0207700_10000031 | Ga0207700_1000003172 | 314 |
| 487 | 3300025929 | Ga0207664_10001923 | Ga0207664_100019235 | 314 |
| 488 | 3300025931 | Ga0207644_10164857 | Ga0207644_101648571 | 314 |
| 489 | 3300025933 | Ga0207706_10008764 | Ga0207706_100087647 | 314 |
| 490 | 3300025933 | Ga0207706_10045511 | Ga0207706_100455113 | 314 |
| 491 | 3300025934 | Ga0207686_10009489 | Ga0207686_100094894 | 314 |
| 492 | 3300025937 | Ga0207669_10086145 | Ga0207669_100861452 | 314 |
| 493 | 3300025938 | Ga0207704_10250977 | Ga0207704_102509771 | 314 |
| 494 | 3300025939 | Ga0207665_10014257 | Ga0207665_100142574 | 314 |
| 495 | 3300025940 | Ga0207691_10275850 | Ga0207691_102758501 | 314 |
| 496 | 3300025941 | Ga0207711_10000677 | Ga0207711_100006777 | 314 |
| 497 | 3300025942 | Ga0207689_10026713 | Ga0207689_100267133 | 314 |
| 498 | 3300025944 | Ga0207661_10173745 | Ga0207661_101737453 | 314 |
| 499 | 3300025945 | Ga0207679_10074374 | Ga0207679_100743742 | 314 |
| 500 | 3300025960 | Ga0207651_10081577 | Ga0207651_100815772 | 314 |
| 501 | 3300025981 | Ga0207640_10057922 | Ga0207640_100579222 | 314 |
| 502 | 3300025981 | Ga0207640_10125451 | Ga0207640_101254512 | 314 |
| 503 | 3300025986 | Ga0207658_10112669 | Ga0207658_101126692 | 314 |
| 504 | 3300026023 | Ga0207677_10000568 | Ga0207677_1000056814 | 314 |
| 505 | 3300026035 | Ga0207703_10004124 | Ga0207703_100041246 | 314 |
| 506 | 3300026067 | Ga0207678_10091146 | Ga0207678_100911461 | 314 |
| 507 | 3300026078 | Ga0207702_10047420 | Ga0207702_100474202 | 314 |
| 508 | 3300026078 | Ga0207702_10068761 | Ga0207702_100687612 | 314 |
| 509 | 3300026088 | Ga0207641_10015245 | Ga0207641_100152452 | 314 |
| 510 | 3300026089 | Ga0207648_10089654 | Ga0207648_100896544 | 314 |
| 511 | 3300026095 | Ga0207676_10000487 | Ga0207676_1000048734 | 314 |
| 512 | 3300026116 | Ga0207674_10009680 | Ga0207674_100096807 | 314 |
| 513 | 3300026121 | Ga0207683_10003159 | Ga0207683_100031596 | 314 |
| 514 | 3300026142 | Ga0207698_10076484 | Ga0207698_100764842 | 314 |
| 515 | 3300027312 | Ga0209371_1000073 | Ga0209371_1000073167 | 314 |
| 516 | 3300028381 | Ga0268264_10112465 | Ga0268264_101124653 | 314 |
| 517 | 3300030500 | Ga0268256_1000125 | Ga0268256_100012581 | 314 |
| 518 | 3300031238 | Ga0265332_10021705 | Ga0265332_100217052 | 314 |
| 519 | 3300031241 | Ga0265325_10143663 | Ga0265325_101436632 | 314 |
| 520 | 3300031242 | Ga0265329_10014464 | Ga0265329_100144643 | 314 |
| 521 | 3300031250 | Ga0265331_10001334 | Ga0265331_100013345 | 314 |
| 522 | 3300031548 | Ga0307408_100000042 | Ga0307408_10000004215 | 314 |
| 523 | 3300035086 | Ga0373934_0007016 | Ga0373934_0007016_3127_4074 | 314 |
| 524 | 3300035089 | Ga0373944_0039817 | Ga0373944_0039817_465_1412 | 314 |
| 525 | 3300035111 | Ga0373923_0020146 | Ga0373923_0020146_1341_2288 | 314 |
| 526 | 3300035116 | Ga0373945_0010434 | Ga0373945_0010434_455_1402 | 314 |
| 527 | 3300035117 | Ga0373953_0031632 | Ga0373953_0031632_796_1743 | 314 |
| 528 | 3300035118 | Ga0373954_0023088 | Ga0373954_0023088_698_1645 | 314 |
| 529 | 3300035119 | Ga0373956_0025875 | Ga0373956_0025875_608_1555 | 314 |
| 530 | 3300035170 | Ga0373943_0043051 | Ga0373943_0043051_877_1824 | 314 |
| 531 | 3300035171 | Ga0373946_0100662 | Ga0373946_0100662_264_1211 | 314 |
| 532 | 3300035172 | Ga0373955_0016513 | Ga0373955_0016513_2380_3327 | 314 |
| 533 | 3300035172 | Ga0373955_0078201 | Ga0373955_0078201_407_1354 | 314 |
| 534 | 3300035691 | Ga0373931_0118704 | Ga0373931_0118704_500_1447 | 314 |
| 535 | 3300035692 | Ga0373935_0042472 | Ga0373935_0042472_86_1033 | 314 |
| 536 | 3300035692 | Ga0373935_0072438 | Ga0373935_0072438_1131_2078 | 314 |
| 537 | 3300035695 | Ga0373927_0120725 | Ga0373927_0120725_29_976 | 314 |
| 538 | 3300035724 | Ga0373933_0140652 | Ga0373933_0140652_167_1114 | 314 |
| 539 | 3300035725 | Ga0373947_0105605 | Ga0373947_0105605_195_1142 | 314 |
| 540 | 3300036401 | Ga0373937_0037600 | Ga0373937_0037600_2022_2969 | 314 |
| 541 | 3300036712 | Ga0316584_0022046 | Ga0316584_0022046_436_1392 | 314 |
| 542 | 3300037068 | Ga0373925_0032093 | Ga0373925_0032093_1092_2039 | 314 |
| 543 | 3300037068 | Ga0373925_0053454 | Ga0373925_0053454_1220_2167 | 314 |
| 544 | 3300037312 | Ga0395899_0040209 | Ga0395899_0040209_212_1168 | 314 |
| 545 | 3300037418 | Ga0395900_0336795 | Ga0395900_0336795_501_1457 | 314 |
| 546 | 3300037466 | Ga0395898_0191471 | Ga0395898_0191471_427_1383 | 314 |
| 547 | 3300041411 | Ga0439466_0025101 | Ga0439466_0025101_653_1609 | 314 |
| 548 | 3300042156 | Ga0439446_0002538 | Ga0439446_0002538_3159_4196 | 314 |
| 549 | 3300042439 | Ga0439464_0000304 | Ga0439464_0000304_2280_3236 | 314 |
| 550 | 3300042439 | Ga0439464_0037521 | Ga0439464_0037521_204_1160 | 314 |
| 551 | 3300042876 | Ga0451577_0053265 | Ga0451577_0053265_513_1469 | 314 |
| 552 | 3300044656 | Ga0466969_0082984 | Ga0466969_0082984_208_1158 | 314 |
| 553 | 3300044694 | Ga0466963_0017345 | Ga0466963_0017345_148_1098 | 314 |
| 554 | 3300044719 | Ga0466971_0128214 | Ga0466971_0128214_196_1146 | 314 |
| 555 | 3300045049 | Ga0466959_0000159 | Ga0466959_0000159_3615_4565 | 314 |
| 556 | 3300045976 | Ga0466967_0034676 | Ga0466967_0034676_2185_3135 | 314 |
| 557 | 3300046472 | Ga0495580_0029333 | Ga0495580_0029333_2642_3598 | 314 |
| 558 | 3300046472 | Ga0495580_0110591 | Ga0495580_0110591_522_1469 | 314 |
| 559 | 3300046475 | Ga0495639_0012593 | Ga0495639_0012593_1741_2688 | 314 |
| 560 | 3300046476 | Ga0495662_0021664 | Ga0495662_0021664_1582_2529 | 314 |
| 561 | 3300046516 | Ga0495628_0032233 | Ga0495628_0032233_3097_4044 | 314 |
| 562 | 3300046516 | Ga0495628_0087313 | Ga0495628_0087313_965_1912 | 314 |
| 563 | 3300046533 | Ga0495640_0106515 | Ga0495640_0106515_595_1542 | 314 |
| 564 | 3300046539 | Ga0495621_0010043 | Ga0495621_0010043_1162_2109 | 314 |
| 565 | 3300046543 | Ga0495645_0008700 | Ga0495645_0008700_1388_2335 | 314 |
| 566 | 3300046559 | Ga0495667_0145282 | Ga0495667_0145282_310_1257 | 314 |
| 567 | 3300046681 | Ga0495647_0001415 | Ga0495647_0001415_4832_5779 | 314 |
| 568 | 3300046689 | Ga0495613_0029582 | Ga0495613_0029582_1328_2275 | 314 |
| 569 | 3300047471 | Ga0495684_0039446 | Ga0495684_0039446_575_1522 | 314 |
| 570 | 3300048905 | Ga0496102_0235332 | Ga0496102_0235332_268_1215 | 314 |
| 571 | 3300048905 | Ga0496102_0405963 | Ga0496102_0405963_223_1170 | 314 |
| 572 | 3300048908 | Ga0496105_0052983 | Ga0496105_0052983_1088_2035 | 314 |
| 573 | 3300048910 | Ga0496107_0038750 | Ga0496107_0038750_544_1491 | 314 |
| 574 | 3300048911 | Ga0496108_0132199 | Ga0496108_0132199_931_1878 | 314 |
| 575 | 3300048912 | Ga0496109_0007561 | Ga0496109_0007561_3523_4470 | 314 |
| 576 | 3300048915 | Ga0496112_0000710 | Ga0496112_0000710_19147_20094 | 314 |
| 577 | 3300048917 | Ga0496114_0048145 | Ga0496114_0048145_967_1914 | 314 |
| 578 | 3300048918 | Ga0496115_0099480 | Ga0496115_0099480_329_1276 | 314 |
| 579 | 3300048926 | Ga0496123_0109275 | Ga0496123_0109275_139_1095 | 314 |
| 580 | 3300049571 | Ga0501034_0009787 | Ga0501034_0009787_605_1567 | 314 |
| 581 | 3300049744 | Ga0501083_0023679 | Ga0501083_0023679_3174_4133 | 314 |
| 582 | 3300050513 | nmdc:mga0rr50_171112_c1 | nmdc:mga0rr50_171112_c1_175_1122 | 314 |
| 583 | 3300053077 | Ga0495601_0099729 | Ga0495601_0099729_274_1221 | 314 |
| 584 | 3300053077 | Ga0495601_0105990 | Ga0495601_0105990_389_1345 | 314 |
| 585 | 3300053084 | Ga0495595_0095717 | Ga0495595_0095717_451_1398 | 314 |
| 586 | 3300053085 | Ga0495619_0019668 | Ga0495619_0019668_1469_2416 | 314 |
| 587 | 3300053085 | Ga0495619_0112421 | Ga0495619_0112421_687_1634 | 314 |
| 588 | iso_pu_bacteria | 2600254954 | 2600446396 | 314 |
| 589 | iso_pu_bacteria | 2600255389 | 2602010545 | 314 |
| 590 | iso_pu_bacteria | 2823421272 | 2823423081 | 314 |
| 591 | iso_pu_bacteria | 2919501602 | 2919505513 | 314 |
| 592 | iso_pu_bacteria | 2926063275 | 2926067190 | 314 |
| 593 | iso_pu_bacteria | 3007315729 | 3007316218 | 314 |
| 594 | iso_pu_bacteria | 8034962539 | 8034963993 | 314 |
| 595 | 3300005327 | Ga0070658_10017819 | Ga0070658_100178195 | 315 |
| 596 | 3300005329 | Ga0070683_100013010 | Ga0070683_1000130106 | 315 |
| 597 | 3300005329 | Ga0070683_100015845 | Ga0070683_1000158454 | 315 |
| 598 | 3300005330 | Ga0070690_100002584 | Ga0070690_1000025843 | 315 |
| 599 | 3300005331 | Ga0070670_100006044 | Ga0070670_1000060445 | 315 |
| 600 | 3300005331 | Ga0070670_100006491 | Ga0070670_1000064913 | 315 |
| 601 | 3300005331 | Ga0070670_100030761 | Ga0070670_1000307614 | 315 |
| 602 | 3300005335 | Ga0070666_10029252 | Ga0070666_100292523 | 315 |
| 603 | 3300005336 | Ga0070680_100084024 | Ga0070680_1000840242 | 315 |
| 604 | 3300005338 | Ga0068868_100013751 | Ga0068868_1000137514 | 315 |
| 605 | 3300005339 | Ga0070660_100004672 | Ga0070660_1000046722 | 315 |
| 606 | 3300005339 | Ga0070660_100053054 | Ga0070660_1000530542 | 315 |
| 607 | 3300005339 | Ga0070660_100106735 | Ga0070660_1001067352 | 315 |
| 608 | 3300005340 | Ga0070689_100021008 | Ga0070689_1000210085 | 315 |
| 609 | 3300005343 | Ga0070687_100004394 | Ga0070687_1000043944 | 315 |
| 610 | 3300005344 | Ga0070661_100002328 | Ga0070661_10000232811 | 315 |
| 611 | 3300005344 | Ga0070661_100006323 | Ga0070661_1000063239 | 315 |
| 612 | 3300005344 | Ga0070661_100054951 | Ga0070661_1000549512 | 315 |
| 613 | 3300005344 | Ga0070661_100058717 | Ga0070661_1000587172 | 315 |
| 614 | 3300005344 | Ga0070661_100058950 | Ga0070661_1000589502 | 315 |
| 615 | 3300005347 | Ga0070668_100029719 | Ga0070668_1000297194 | 315 |
| 616 | 3300005353 | Ga0070669_100019131 | Ga0070669_1000191312 | 315 |
| 617 | 3300005354 | Ga0070675_100014162 | Ga0070675_1000141624 | 315 |
| 618 | 3300005355 | Ga0070671_100040743 | Ga0070671_1000407434 | 315 |
| 619 | 3300005356 | Ga0070674_100364470 | Ga0070674_1003644701 | 315 |
| 620 | 3300005364 | Ga0070673_100033870 | Ga0070673_1000338704 | 315 |
| 621 | 3300005364 | Ga0070673_100096708 | Ga0070673_1000967082 | 315 |
| 622 | 3300005365 | Ga0070688_100013185 | Ga0070688_1000131853 | 315 |
| 623 | 3300005366 | Ga0070659_100008372 | Ga0070659_1000083729 | 315 |
| 624 | 3300005366 | Ga0070659_100013641 | Ga0070659_1000136414 | 315 |
| 625 | 3300005366 | Ga0070659_100036790 | Ga0070659_1000367903 | 315 |
| 626 | 3300005366 | Ga0070659_100079405 | Ga0070659_1000794052 | 315 |
| 627 | 3300005367 | Ga0070667_100042899 | Ga0070667_1000428994 | 315 |
| 628 | 3300005434 | Ga0070709_10121651 | Ga0070709_101216512 | 315 |
| 629 | 3300005435 | Ga0070714_100000958 | Ga0070714_1000009589 | 315 |
| 630 | 3300005435 | Ga0070714_100013339 | Ga0070714_1000133397 | 315 |
| 631 | 3300005455 | Ga0070663_100027174 | Ga0070663_1000271743 | 315 |
| 632 | 3300005456 | Ga0070678_100015132 | Ga0070678_1000151325 | 315 |
| 633 | 3300005456 | Ga0070678_100203924 | Ga0070678_1002039242 | 315 |
| 634 | 3300005457 | Ga0070662_100062593 | Ga0070662_1000625932 | 315 |
| 635 | 3300005466 | Ga0070685_10004917 | Ga0070685_100049177 | 315 |
| 636 | 3300005530 | Ga0070679_100053494 | Ga0070679_1000534942 | 315 |
| 637 | 3300005530 | Ga0070679_100057106 | Ga0070679_1000571064 | 315 |
| 638 | 3300005530 | Ga0070679_100354092 | Ga0070679_1003540922 | 315 |
| 639 | 3300005535 | Ga0070684_100008174 | Ga0070684_1000081745 | 315 |
| 640 | 3300005535 | Ga0070684_100019953 | Ga0070684_1000199535 | 315 |
| 641 | 3300005535 | Ga0070684_100112794 | Ga0070684_1001127942 | 315 |
| 642 | 3300005539 | Ga0068853_100088708 | Ga0068853_1000887082 | 315 |
| 643 | 3300005539 | Ga0068853_100120104 | Ga0068853_1001201042 | 315 |
| 644 | 3300005543 | Ga0070672_100034117 | Ga0070672_1000341174 | 315 |
| 645 | 3300005544 | Ga0070686_100079205 | Ga0070686_1000792052 | 315 |
| 646 | 3300005547 | Ga0070693_100016720 | Ga0070693_1000167205 | 315 |
| 647 | 3300005547 | Ga0070693_100326110 | Ga0070693_1003261101 | 315 |
| 648 | 3300005548 | Ga0070665_100046504 | Ga0070665_1000465044 | 315 |
| 649 | 3300005548 | Ga0070665_100284678 | Ga0070665_1002846782 | 315 |
| 650 | 3300005563 | Ga0068855_100004494 | Ga0068855_1000044945 | 315 |
| 651 | 3300005564 | Ga0070664_100000225 | Ga0070664_10000022517 | 315 |
| 652 | 3300005564 | Ga0070664_100006637 | Ga0070664_1000066374 | 315 |
| 653 | 3300005564 | Ga0070664_100010013 | Ga0070664_1000100133 | 315 |
| 654 | 3300005564 | Ga0070664_100015585 | Ga0070664_1000155852 | 315 |
| 655 | 3300005577 | Ga0068857_100001492 | Ga0068857_10000149213 | 315 |
| 656 | 3300005577 | Ga0068857_100014731 | Ga0068857_1000147314 | 315 |
| 657 | 3300005577 | Ga0068857_100113712 | Ga0068857_1001137122 | 315 |
| 658 | 3300005577 | Ga0068857_100124095 | Ga0068857_1001240952 | 315 |
| 659 | 3300005578 | Ga0068854_100002211 | Ga0068854_1000022112 | 315 |
| 660 | 3300005578 | Ga0068854_100024525 | Ga0068854_1000245252 | 315 |
| 661 | 3300005578 | Ga0068854_100206615 | Ga0068854_1002066152 | 315 |
| 662 | 3300005578 | Ga0068854_100334977 | Ga0068854_1003349772 | 315 |
| 663 | 3300005614 | Ga0068856_100005098 | Ga0068856_1000050989 | 315 |
| 664 | 3300005614 | Ga0068856_100017037 | Ga0068856_1000170373 | 315 |
| 665 | 3300005616 | Ga0068852_100001351 | Ga0068852_1000013514 | 315 |
| 666 | 3300005616 | Ga0068852_100006471 | Ga0068852_1000064713 | 315 |
| 667 | 3300005616 | Ga0068852_100018561 | Ga0068852_1000185616 | 315 |
| 668 | 3300005616 | Ga0068852_100183356 | Ga0068852_1001833562 | 315 |
| 669 | 3300005617 | Ga0068859_100009836 | Ga0068859_1000098365 | 315 |
| 670 | 3300005618 | Ga0068864_100043697 | Ga0068864_1000436974 | 315 |
| 671 | 3300005834 | Ga0068851_10015469 | Ga0068851_100154693 | 315 |
| 672 | 3300005834 | Ga0068851_10016929 | Ga0068851_100169293 | 315 |
| 673 | 3300005834 | Ga0068851_10036048 | Ga0068851_100360483 | 315 |
| 674 | 3300005834 | Ga0068851_10053657 | Ga0068851_100536572 | 315 |
| 675 | 3300005834 | Ga0068851_10074997 | Ga0068851_100749972 | 315 |
| 676 | 3300005840 | Ga0068870_10000991 | Ga0068870_100009912 | 315 |
| 677 | 3300005841 | Ga0068863_100048655 | Ga0068863_1000486554 | 315 |
| 678 | 3300005842 | Ga0068858_100050217 | Ga0068858_1000502174 | 315 |
| 679 | 3300005843 | Ga0068860_100047590 | Ga0068860_1000475904 | 315 |
| 680 | 3300005843 | Ga0068860_100330497 | Ga0068860_1003304972 | 315 |
| 681 | 3300005844 | Ga0068862_100004412 | Ga0068862_1000044125 | 315 |
| 682 | 3300006358 | Ga0068871_100123984 | Ga0068871_1001239841 | 315 |
| 683 | 3300006881 | Ga0068865_100052693 | Ga0068865_1000526932 | 315 |
| 684 | 3300006931 | Ga0097620_100009836 | Ga0097620_1000098365 | 315 |
| 685 | 3300009093 | Ga0105240_10002216 | Ga0105240_1000221611 | 315 |
| 686 | 3300009174 | Ga0105241_10001246 | Ga0105241_100012468 | 315 |
| 687 | 3300009174 | Ga0105241_10009600 | Ga0105241_100096006 | 315 |
| 688 | 3300009177 | Ga0105248_10002109 | Ga0105248_100021092 | 315 |
| 689 | 3300009177 | Ga0105248_10071495 | Ga0105248_100714954 | 315 |
| 690 | 3300009545 | Ga0105237_10188418 | Ga0105237_101884182 | 315 |
| 691 | 3300009551 | Ga0105238_10002109 | Ga0105238_1000210917 | 315 |
| 692 | 3300009551 | Ga0105238_10120972 | Ga0105238_101209722 | 315 |
| 693 | 3300010375 | Ga0105239_10208964 | Ga0105239_102089642 | 315 |
| 694 | 3300013100 | Ga0157373_10001504 | Ga0157373_1000150414 | 315 |
| 695 | 3300013100 | Ga0157373_10096769 | Ga0157373_100967692 | 315 |
| 696 | 3300013102 | Ga0157371_10038271 | Ga0157371_100382713 | 315 |
| 697 | 3300013102 | Ga0157371_10134147 | Ga0157371_101341472 | 315 |
| 698 | 3300013104 | Ga0157370_10103891 | Ga0157370_101038912 | 315 |
| 699 | 3300013104 | Ga0157370_10129658 | Ga0157370_101296581 | 315 |
| 700 | 3300013104 | Ga0157370_10205073 | Ga0157370_102050732 | 315 |
| 701 | 3300013105 | Ga0157369_10002700 | Ga0157369_100027004 | 315 |
| 702 | 3300013105 | Ga0157369_10004550 | Ga0157369_100045503 | 315 |
| 703 | 3300013105 | Ga0157369_10059854 | Ga0157369_100598542 | 315 |
| 704 | 3300013105 | Ga0157369_10130905 | Ga0157369_101309052 | 315 |
| 705 | 3300013296 | Ga0157374_10014729 | Ga0157374_100147292 | 315 |
| 706 | 3300013296 | Ga0157374_10016719 | Ga0157374_100167192 | 315 |
| 707 | 3300013296 | Ga0157374_10037164 | Ga0157374_100371642 | 315 |
| 708 | 3300013306 | Ga0163162_10051253 | Ga0163162_100512532 | 315 |
| 709 | 3300013307 | Ga0157372_10003646 | Ga0157372_1000364610 | 315 |
| 710 | 3300013307 | Ga0157372_10052848 | Ga0157372_100528482 | 315 |
| 711 | 3300013308 | Ga0157375_10043153 | Ga0157375_100431533 | 315 |
| 712 | 3300013308 | Ga0157375_10064445 | Ga0157375_100644451 | 315 |
| 713 | 3300014325 | Ga0163163_10057467 | Ga0163163_100574672 | 315 |
| 714 | 3300014745 | Ga0157377_10004960 | Ga0157377_100049602 | 315 |
| 715 | 3300014968 | Ga0157379_10412934 | Ga0157379_104129342 | 315 |
| 716 | 3300017792 | Ga0163161_10075531 | Ga0163161_100755312 | 315 |
| 717 | 3300025315 | Ga0207697_10000014 | Ga0207697_1000001439 | 315 |
| 718 | 3300025321 | Ga0207656_10049306 | Ga0207656_100493062 | 315 |
| 719 | 3300025321 | Ga0207656_10087064 | Ga0207656_100870642 | 315 |
| 720 | 3300025901 | Ga0207688_10025126 | Ga0207688_100251262 | 315 |
| 721 | 3300025903 | Ga0207680_10142655 | Ga0207680_101426552 | 315 |
| 722 | 3300025907 | Ga0207645_10000272 | Ga0207645_1000027241 | 315 |
| 723 | 3300025909 | Ga0207705_10038517 | Ga0207705_100385172 | 315 |
| 724 | 3300025909 | Ga0207705_10071543 | Ga0207705_100715433 | 315 |
| 725 | 3300025909 | Ga0207705_10157297 | Ga0207705_101572972 | 315 |
| 726 | 3300025911 | Ga0207654_10021926 | Ga0207654_100219262 | 315 |
| 727 | 3300025912 | Ga0207707_10003509 | Ga0207707_1000350912 | 315 |
| 728 | 3300025913 | Ga0207695_10005581 | Ga0207695_1000558110 | 315 |
| 729 | 3300025913 | Ga0207695_10040873 | Ga0207695_100408734 | 315 |
| 730 | 3300025914 | Ga0207671_10059136 | Ga0207671_100591362 | 315 |
| 731 | 3300025914 | Ga0207671_10227918 | Ga0207671_102279181 | 315 |
| 732 | 3300025917 | Ga0207660_10178621 | Ga0207660_101786212 | 315 |
| 733 | 3300025917 | Ga0207660_10296229 | Ga0207660_102962291 | 315 |
| 734 | 3300025919 | Ga0207657_10004564 | Ga0207657_100045642 | 315 |
| 735 | 3300025919 | Ga0207657_10009458 | Ga0207657_100094589 | 315 |
| 736 | 3300025919 | Ga0207657_10054883 | Ga0207657_100548832 | 315 |
| 737 | 3300025919 | Ga0207657_10082316 | Ga0207657_100823163 | 315 |
| 738 | 3300025920 | Ga0207649_10007496 | Ga0207649_100074965 | 315 |
| 739 | 3300025920 | Ga0207649_10007682 | Ga0207649_100076826 | 315 |
| 740 | 3300025921 | Ga0207652_10002018 | Ga0207652_1000201811 | 315 |
| 741 | 3300025921 | Ga0207652_10012436 | Ga0207652_100124365 | 315 |
| 742 | 3300025923 | Ga0207681_10014887 | Ga0207681_100148872 | 315 |
| 743 | 3300025924 | Ga0207694_10017958 | Ga0207694_100179584 | 315 |
| 744 | 3300025924 | Ga0207694_10030434 | Ga0207694_100304341 | 315 |
| 745 | 3300025925 | Ga0207650_10009121 | Ga0207650_100091216 | 315 |
| 746 | 3300025925 | Ga0207650_10020730 | Ga0207650_100207303 | 315 |
| 747 | 3300025925 | Ga0207650_10056502 | Ga0207650_100565021 | 315 |
| 748 | 3300025926 | Ga0207659_10001243 | Ga0207659_1000124315 | 315 |
| 749 | 3300025929 | Ga0207664_10002222 | Ga0207664_100022229 | 315 |
| 750 | 3300025929 | Ga0207664_10018572 | Ga0207664_100185725 | 315 |
| 751 | 3300025931 | Ga0207644_10014925 | Ga0207644_100149254 | 315 |
| 752 | 3300025932 | Ga0207690_10010564 | Ga0207690_100105644 | 315 |
| 753 | 3300025932 | Ga0207690_10020114 | Ga0207690_100201144 | 315 |
| 754 | 3300025932 | Ga0207690_10032000 | Ga0207690_100320001 | 315 |
| 755 | 3300025932 | Ga0207690_10159178 | Ga0207690_101591782 | 315 |
| 756 | 3300025932 | Ga0207690_10238108 | Ga0207690_102381082 | 315 |
| 757 | 3300025933 | Ga0207706_10185248 | Ga0207706_101852482 | 315 |
| 758 | 3300025936 | Ga0207670_10011774 | Ga0207670_100117746 | 315 |
| 759 | 3300025937 | Ga0207669_10250525 | Ga0207669_102505251 | 315 |
| 760 | 3300025938 | Ga0207704_10099245 | Ga0207704_100992452 | 315 |
| 761 | 3300025940 | Ga0207691_10028863 | Ga0207691_100288632 | 315 |
| 762 | 3300025940 | Ga0207691_10050250 | Ga0207691_100502504 | 315 |
| 763 | 3300025941 | Ga0207711_10002413 | Ga0207711_1000241316 | 315 |
| 764 | 3300025941 | Ga0207711_10017384 | Ga0207711_100173842 | 315 |
| 765 | 3300025942 | Ga0207689_10000559 | Ga0207689_100005592 | 315 |
| 766 | 3300025944 | Ga0207661_10050422 | Ga0207661_100504221 | 315 |
| 767 | 3300025945 | Ga0207679_10002983 | Ga0207679_100029836 | 315 |
| 768 | 3300025945 | Ga0207679_10006832 | Ga0207679_100068324 | 315 |
| 769 | 3300025945 | Ga0207679_10022583 | Ga0207679_100225831 | 315 |
| 770 | 3300025945 | Ga0207679_10026584 | Ga0207679_100265843 | 315 |
| 771 | 3300025949 | Ga0207667_10003655 | Ga0207667_1000365510 | 315 |
| 772 | 3300025949 | Ga0207667_10013313 | Ga0207667_100133135 | 315 |
| 773 | 3300025960 | Ga0207651_10001519 | Ga0207651_100015196 | 315 |
| 774 | 3300025981 | Ga0207640_10018156 | Ga0207640_100181562 | 315 |
| 775 | 3300025981 | Ga0207640_10166494 | Ga0207640_101664942 | 315 |
| 776 | 3300025981 | Ga0207640_10182996 | Ga0207640_101829962 | 315 |
| 777 | 3300025986 | Ga0207658_10030065 | Ga0207658_100300654 | 315 |
| 778 | 3300026023 | Ga0207677_10012228 | Ga0207677_100122285 | 315 |
| 779 | 3300026035 | Ga0207703_10042796 | Ga0207703_100427961 | 315 |
| 780 | 3300026041 | Ga0207639_10170261 | Ga0207639_101702612 | 315 |
| 781 | 3300026067 | Ga0207678_10050199 | Ga0207678_100501992 | 315 |
| 782 | 3300026078 | Ga0207702_10023904 | Ga0207702_100239045 | 315 |
| 783 | 3300026078 | Ga0207702_10031508 | Ga0207702_100315084 | 315 |
| 784 | 3300026078 | Ga0207702_10082465 | Ga0207702_100824652 | 315 |
| 785 | 3300026088 | Ga0207641_10023943 | Ga0207641_100239434 | 315 |
| 786 | 3300026088 | Ga0207641_10386225 | Ga0207641_103862251 | 315 |
| 787 | 3300026095 | Ga0207676_10031852 | Ga0207676_100318521 | 315 |
| 788 | 3300026116 | Ga0207674_10000045 | Ga0207674_1000004596 | 315 |
| 789 | 3300026116 | Ga0207674_10003080 | Ga0207674_1000308014 | 315 |
| 790 | 3300026116 | Ga0207674_10005204 | Ga0207674_1000520416 | 315 |
| 791 | 3300026116 | Ga0207674_10110851 | Ga0207674_101108512 | 315 |
| 792 | 3300026121 | Ga0207683_10045996 | Ga0207683_100459964 | 315 |
| 793 | 3300026121 | Ga0207683_10226824 | Ga0207683_102268242 | 315 |
| 794 | 3300026142 | Ga0207698_10001195 | Ga0207698_100011959 | 315 |
| 795 | 3300026142 | Ga0207698_10029519 | Ga0207698_100295192 | 315 |
| 796 | 3300026142 | Ga0207698_10068341 | Ga0207698_100683412 | 315 |
| 797 | 3300026142 | Ga0207698_10091066 | Ga0207698_100910662 | 315 |
| 798 | 3300027665 | Ga0209983_1022159 | Ga0209983_10221591 | 315 |
| 799 | 3300027682 | Ga0209971_1000590 | Ga0209971_10005901 | 315 |
| 800 | 3300027717 | Ga0209998_10000663 | Ga0209998_100006635 | 315 |
| 801 | 3300027876 | Ga0209974_10005077 | Ga0209974_100050773 | 315 |
| 802 | 3300028379 | Ga0268266_10033065 | Ga0268266_100330655 | 315 |
| 803 | 3300028379 | Ga0268266_10444116 | Ga0268266_104441161 | 315 |
| 804 | 3300028380 | Ga0268265_10180398 | Ga0268265_101803982 | 315 |
| 805 | 3300028381 | Ga0268264_10020012 | Ga0268264_100200126 | 315 |
| 806 | 3300037312 | Ga0395899_0009384 | Ga0395899_0009384_4635_5591 | 315 |
| 807 | 3300038443 | Ga0395901_0363899 | Ga0395901_0363899_177_1136 | 315 |
| 808 | 3300046663 | Ga0495635_0175223 | Ga0495635_0175223_68_1021 | 315 |
| 809 | 3300047319 | Ga0495674_0062526 | Ga0495674_0062526_1355_2308 | 315 |
| 810 | 3300048903 | Ga0496100_0040251 | Ga0496100_0040251_1694_2653 | 315 |
| 811 | 3300048907 | Ga0496104_0016794 | Ga0496104_0016794_1123_2082 | 315 |
| 812 | 3300048908 | Ga0496105_0043714 | Ga0496105_0043714_2647_3606 | 315 |
| 813 | 3300048909 | Ga0496106_0186580 | Ga0496106_0186580_455_1414 | 315 |
| 814 | 3300048910 | Ga0496107_0163089 | Ga0496107_0163089_567_1526 | 315 |
| 815 | 3300048911 | Ga0496108_0003315 | Ga0496108_0003315_10992_11951 | 315 |
| 816 | 3300048911 | Ga0496108_0267431 | Ga0496108_0267431_129_1088 | 315 |
| 817 | 3300048912 | Ga0496109_0106658 | Ga0496109_0106658_53_1012 | 315 |
| 818 | 3300048913 | Ga0496110_0075816 | Ga0496110_0075816_1823_2782 | 315 |
| 819 | 3300048914 | Ga0496111_0030170 | Ga0496111_0030170_1329_2288 | 315 |
| 820 | 3300048917 | Ga0496114_0017697 | Ga0496114_0017697_3779_4738 | 315 |
| 821 | 3300002772 | JGI25164J39214_1002902 | JGI25164J39214_10029022 | 316 |
| 822 | 3300003214 | JGI25165J46597_1000030 | JGI25165J46597_1000030260 | 316 |
| 823 | 3300003751 | Ga0055538_1000017 | Ga0055538_100001741 | 316 |
| 824 | 3300003752 | Ga0055539_1000022 | Ga0055539_100002241 | 316 |
| 825 | 3300003756 | Ga0055533_1000030 | Ga0055533_100003041 | 316 |
| 826 | 3300003759 | Ga0055525_1000034 | Ga0055525_100003441 | 316 |
| 827 | 3300003841 | Ga0055541_1000015 | Ga0055541_100001541 | 316 |
| 828 | 3300014497 | Ga0182008_10034769 | Ga0182008_100347692 | 316 |
| 829 | 3300015261 | Ga0182006_1003224 | Ga0182006_10032247 | 316 |
| 830 | 3300015262 | Ga0182007_10004074 | Ga0182007_100040744 | 316 |
| 831 | 3300015265 | Ga0182005_1001051 | Ga0182005_10010515 | 316 |
| 832 | 3300025207 | Ga0209760_100791 | Ga0209760_1007913 | 316 |
| 833 | 3300025224 | Ga0209784_100034 | Ga0209784_100034258 | 316 |
| 834 | 3300025225 | Ga0209566_100038 | Ga0209566_10003841 | 316 |
| 835 | 3300025226 | Ga0209674_100056 | Ga0209674_100056258 | 316 |
| 836 | 3300025230 | Ga0209563_100057 | Ga0209563_10005741 | 316 |
| 837 | 3300025231 | Ga0207427_100288 | Ga0207427_10028831 | 316 |
| 838 | 3300025233 | Ga0209437_100071 | Ga0209437_10007141 | 316 |
| 839 | 3300025253 | Ga0209677_100035 | Ga0209677_100035258 | 316 |
| 840 | 3300025261 | Ga0209233_1000094 | Ga0209233_100009441 | 316 |
| 841 | 3300046454 | Ga0495592_0124457 | Ga0495592_0124457_297_1247 | 316 |
| 842 | 3300046462 | Ga0495651_0032726 | Ga0495651_0032726_414_1364 | 316 |
| 843 | 3300046462 | Ga0495651_0072865 | Ga0495651_0072865_1632_2582 | 316 |
| 844 | 3300046511 | Ga0495608_0005231 | Ga0495608_0005231_8211_9161 | 316 |
| 845 | 3300046516 | Ga0495628_0006680 | Ga0495628_0006680_5533_6483 | 316 |
| 846 | 3300046678 | Ga0495599_0012955 | Ga0495599_0012955_3137_4087 | 316 |
| 847 | 3300046679 | Ga0495623_0029623 | Ga0495623_0029623_2480_3430 | 316 |
| 848 | 3300046680 | Ga0495646_0011091 | Ga0495646_0011091_769_1719 | 316 |
| 849 | 3300046809 | Ga0495600_0021968 | Ga0495600_0021968_229_1179 | 316 |
| 850 | 3300047317 | Ga0495604_0036323 | Ga0495604_0036323_129_1079 | 316 |
| 851 | 3300048088 | Ga0495602_0079418 | Ga0495602_0079418_80_1030 | 316 |
| 852 | 3300053119 | Ga0500595_000447 | Ga0500595_000447_3147_4097 | 316 |
| 853 | 3300053141 | Ga0500574_002511 | Ga0500574_002511_1018_1968 | 316 |
| 854 | 3300053154 | Ga0500619_000959 | Ga0500619_000959_324_1274 | 316 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ddd-assembly1.cif.gz_A | crystal structure of an immunogenic protein from ehrlichia chaffeensis | 0.8591 | 24 | 316 |
| 4ddd-assembly1.cif.gz_A | crystal structure of an immunogenic protein from ehrlichia chaffeensis | 0.8385 | 24 | 316 |
| 1us5-assembly1.cif.gz_A | putative glur0 ligand binding core with l-glutamate | 0.8048 | 24 | 315 |
| 1us5-assembly1.cif.gz_A | putative glur0 ligand binding core with l-glutamate | 0.7908 | 24 | 315 |
| 2b99-assembly1.cif.gz_A | crystal structure of an archaeal pentameric riboflavin synthase complex with a substrate analog inhibitor | 0.7585 | 24 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1us4A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.959 | 114 | 249 | 3.40.190.10 |
| 1us4A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9389 | 114 | 249 | 3.40.190.10 |
| 4dddA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9307 | 114 | 249 | 3.40.190.10 |
| 4dddA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9116 | 114 | 249 | 3.40.190.10 |
| 1us4A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9034 | 24 | 316 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529Q1G6-F1-model_v4 | TAXI family TRAP transporter solute-binding subunit | 0.9377 | 86 | 209 |
|
| AF-X1W1P1-F1-model_v4 | Uncharacterized protein | 0.9375 | 111 | 250 |
|
| AF-S6HMX2-F1-model_v4 | Immunogenic protein | 0.9273 | 105 | 316 |
|
| AF-A0A644ZQ59-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.927 | 73 | 315 |
|
| AF-A0A660T6I0-F1-model_v4 | HTH gntR-type domain-containing protein | 0.9264 | 28 | 316 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar