F483604

General Info

Members Datasets Scaffolds Average Seq Length
855 349 1710 139

Family's Representative Sequence

Representative Sequence 3300001991|JGI24743J22301_10089387|JGI24743J22301_100893871
Length 162
Sequence VRIAARNERGPERAGVEKLSYAGDVTPEEAWKLLNDNPEAVLVDCRTDAEWRFVGVPDLSSLQRNVVYVEWNTTDGKHNDNFVDDLVTAGVTPDVGPRASRGRPVVFLCRSGNRSIGAAEAATEAGIAPSYNVLDGFEGNLDEHKHRGGTGWKAVGLPWKQS

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
181 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
182 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
209 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
210 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
211 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
212 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
213 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
214 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
215 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
219 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
222 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
318 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
319 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
328 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
331 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
332 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
333 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
334 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
335 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
338 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
341 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
342 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
343 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
344 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
345 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
346 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
347 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
348 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
349 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.19
Nodule 0.12
Rhizoplane 12.16
Rhizosphere 63.04
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10089387 3300001991 Bacteria 656
2 CNXas_1018685 3300000545 Bacteria 510
3 LJNas_1005201 3300000546 Bacteria 1425
4 JGI24735J21928_10048099 3300002067 Bacteria 1235
5 JGI24735J21928_10182742 3300002067 Bacteria 607
6 JGI24738J21930_10015219 3300002075 Bacteria 1640
7 JGI24744J21845_10010735 3300002077 Bacteria 1875
8 JGI24742J22300_10003776 3300002244 Bacteria 2460
9 JGI24751J29686_10023482 3300002459 Bacteria 1279
10 rootL2_10108869 3300003322 Bacteria 3363
11 Ga0055528_1033033 3300003790 Bacteria 1306
12 Ga0055540_1003486 3300003792 Bacteria 7585
13 Ga0055540_1004511 3300003792 Bacteria 6239
14 Ga0055540_1008891 3300003792 Bacteria 3551
15 Ga0070683_101225773 3300005329 Bacteria 721
16 Ga0070690_100250380 3300005330 Bacteria 1253
17 Ga0068869_100154962 3300005334 Bacteria 1779
18 Ga0068869_100448496 3300005334 Bacteria 1069
19 Ga0068869_101991367 3300005334 Bacteria 521
20 Ga0070666_10027842 3300005335 Bacteria 3705
21 Ga0070666_10907299 3300005335 Bacteria 652
22 Ga0070680_100188665 3300005336 Bacteria 1737
23 Ga0070680_100411365 3300005336 Bacteria 1154
24 Ga0070682_100015676 3300005337 Bacteria 4395
25 Ga0070682_100027113 3300005337 Bacteria 3435
26 Ga0070682_100027323 3300005337 Bacteria 3423
27 Ga0070682_100097330 3300005337 Bacteria 1937
28 Ga0070682_100636591 3300005337 Bacteria 847
29 Ga0068868_100028777 3300005338 Bacteria 4251
30 Ga0068868_101248628 3300005338 Bacteria 688
31 Ga0068868_101699393 3300005338 Bacteria 595
32 Ga0070660_100298859 3300005339 Bacteria 1319
33 Ga0070689_100003461 3300005340 Bacteria 10501
34 Ga0070691_10060024 3300005341 Bacteria 1828
35 Ga0070687_100493807 3300005343 Bacteria 823
36 Ga0070692_10045366 3300005345 Bacteria 2267
37 Ga0070692_10857733 3300005345 Bacteria 624
38 Ga0070668_100000462 3300005347 Bacteria 26876
39 Ga0070668_100004524 3300005347 Bacteria 10315
40 Ga0070668_100025623 3300005347 Bacteria 4473
41 Ga0070668_100159528 3300005347 Bacteria 1829
42 Ga0070669_100002323 3300005353 Bacteria 13755
43 Ga0070669_100359508 3300005353 Bacteria 1183
44 Ga0070671_100001406 3300005355 Bacteria 17976
45 Ga0070671_100062717 3300005355 Bacteria 3095
46 Ga0070671_100200495 3300005355 Bacteria 1692
47 Ga0070674_100000247 3300005356 Bacteria 26778
48 Ga0070688_100029253 3300005365 Bacteria 3298
49 Ga0070688_101588201 3300005365 Bacteria 534
50 Ga0070659_100156436 3300005366 Bacteria 1862
51 Ga0070659_100907020 3300005366 Bacteria 770
52 Ga0070667_100000029 3300005367 Bacteria 178990
53 Ga0070667_100002517 3300005367 Bacteria 15986
54 Ga0070667_100010190 3300005367 Bacteria 7766
55 Ga0070667_100039485 3300005367 Bacteria 3956
56 Ga0070667_100436401 3300005367 Bacteria 1195
57 Ga0070667_100498879 3300005367 Bacteria 1116
58 Ga0070667_101750279 3300005367 Bacteria 585
59 Ga0070703_10177049 3300005406 Bacteria 821
60 Ga0070709_10053591 3300005434 Bacteria 2540
61 Ga0070709_10534573 3300005434 Bacteria 895
62 Ga0070714_100629157 3300005435 Bacteria 1032
63 Ga0070710_10007180 3300005437 Bacteria 5384
64 Ga0070710_10007878 3300005437 Bacteria 5174
65 Ga0070710_10036430 3300005437 Bacteria 2690
66 Ga0070710_10220597 3300005437 Bacteria 1206
67 Ga0070701_10015907 3300005438 Bacteria 3485
68 Ga0070701_10022767 3300005438 Bacteria 3008
69 Ga0070711_100004483 3300005439 Bacteria 8248
70 Ga0070711_100020820 3300005439 Bacteria 4233
71 Ga0070711_100381225 3300005439 Bacteria 1140
72 Ga0070705_100013796 3300005440 Bacteria 4140
73 Ga0070700_100005517 3300005441 Bacteria 6712
74 Ga0070694_100009143 3300005444 Bacteria 6077
75 Ga0070694_100122497 3300005444 Bacteria 1868
76 Ga0070663_100009400 3300005455 Bacteria 6051
77 Ga0070663_100012412 3300005455 Bacteria 5390
78 Ga0070663_100056713 3300005455 Bacteria 2808
79 Ga0070663_100712800 3300005455 Bacteria 854
80 Ga0070663_100758389 3300005455 Bacteria 829
81 Ga0070678_100030608 3300005456 Bacteria 3702
82 Ga0070678_100368847 3300005456 Bacteria 1239
83 Ga0070662_100014115 3300005457 Bacteria 5328
84 Ga0070662_100325385 3300005457 Bacteria 1254
85 Ga0070662_100662525 3300005457 Bacteria 881
86 Ga0070662_100945349 3300005457 Bacteria 737
87 Ga0068867_100003486 3300005459 Bacteria 11063
88 Ga0068867_100058371 3300005459 Bacteria 2859
89 Ga0070685_10039956 3300005466 Bacteria 2668
90 Ga0070685_10106072 3300005466 Bacteria 1723
91 Ga0070685_10126691 3300005466 Bacteria 1592
92 Ga0070685_10601012 3300005466 Bacteria 791
93 Ga0070706_100505156 3300005467 Bacteria 1125
94 Ga0070684_100132301 3300005535 Bacteria 2250
95 Ga0068853_100001016 3300005539 Bacteria 19753
96 Ga0068853_100007472 3300005539 Bacteria 8749
97 Ga0068853_101299421 3300005539 Bacteria 703
98 Ga0070672_100067718 3300005543 Bacteria 2830
99 Ga0070672_100073361 3300005543 Bacteria 2727
100 Ga0070686_100396854 3300005544 Bacteria 1048
101 Ga0070695_100011527 3300005545 Bacteria 5288
102 Ga0070696_100001192 3300005546 Bacteria 16870
103 Ga0070696_100019134 3300005546 Bacteria 4635
104 Ga0070693_100010464 3300005547 Bacteria 4650
105 Ga0070693_100017637 3300005547 Bacteria 3714
106 Ga0070665_100007011 3300005548 Bacteria 11452
107 Ga0070665_100010203 3300005548 Bacteria 9501
108 Ga0070665_100049031 3300005548 Bacteria 4239
109 Ga0070665_100248575 3300005548 Bacteria 1779
110 Ga0070665_100653404 3300005548 Bacteria 1065
111 Ga0070665_101197184 3300005548 Bacteria 770
112 Ga0070665_101414082 3300005548 Bacteria 705
113 Ga0070665_101504184 3300005548 Bacteria 682
114 Ga0070665_101806159 3300005548 Bacteria 618
115 Ga0070704_100003407 3300005549 Bacteria 9106
116 Ga0070704_100299850 3300005549 Bacteria 1338
117 Ga0070704_100421300 3300005549 Bacteria 1143
118 Ga0070664_101964451 3300005564 Bacteria 555
119 Ga0068854_100178670 3300005578 Bacteria 1657
120 Ga0068854_100194791 3300005578 Bacteria 1590
121 Ga0068854_100368287 3300005578 Bacteria 1181
122 Ga0068856_100366932 3300005614 Bacteria 1458
123 Ga0070702_100048118 3300005615 Bacteria 2426
124 Ga0070702_100442880 3300005615 Bacteria 940
125 Ga0068852_100374567 3300005616 Bacteria 1395
126 Ga0068859_100005413 3300005617 Bacteria 12977
127 Ga0068859_100075054 3300005617 Bacteria 3421
128 Ga0068859_100236019 3300005617 Bacteria 1917
129 Ga0068864_100203265 3300005618 Bacteria 1821
130 Ga0068866_10011394 3300005718 Bacteria 3846
131 Ga0068866_10014152 3300005718 Bacteria 3515
132 Ga0068861_100034771 3300005719 Bacteria 3728
133 Ga0068861_100999087 3300005719 Bacteria 798
134 Ga0068870_10879255 3300005840 Bacteria 631
135 Ga0068863_100000120 3300005841 Bacteria 82283
136 Ga0068863_100003571 3300005841 Bacteria 15344
137 Ga0068863_101803006 3300005841 Bacteria 622
138 Ga0068858_100033226 3300005842 Bacteria 4790
139 Ga0068858_100037717 3300005842 Bacteria 4482
140 Ga0068858_100143436 3300005842 Bacteria 2243
141 Ga0068858_100159965 3300005842 Bacteria 2120
142 Ga0068858_101728389 3300005842 Bacteria 618
143 Ga0068860_100000088 3300005843 Bacteria 154416
144 Ga0068860_100000994 3300005843 Bacteria 31355
145 Ga0068860_100328830 3300005843 Bacteria 1501
146 Ga0068860_101344154 3300005843 Bacteria 735
147 Ga0068862_100000056 3300005844 Bacteria 142257
148 Ga0068862_100008184 3300005844 Bacteria 8644
149 Ga0068862_100418063 3300005844 Bacteria 1258
150 Ga0081455_10132666 3300005937 Bacteria 1945
151 Ga0081455_10207898 3300005937 Bacteria 1460
152 Ga0081455_10737134 3300005937 Bacteria 624
153 Ga0081538_10170455 3300005981 Bacteria 951
154 Ga0075365_10036194 3300006038 Bacteria 3198
155 Ga0075365_10126005 3300006038 Bacteria 1770
156 Ga0075365_10150787 3300006038 Bacteria 1617
157 Ga0075365_10210905 3300006038 Bacteria 1362
158 Ga0075365_10336275 3300006038 Bacteria 1064
159 Ga0075365_10358656 3300006038 Bacteria 1028
160 Ga0075365_11125554 3300006038 Bacteria 553
161 Ga0075368_10084186 3300006042 Bacteria 1296
162 Ga0075368_10151785 3300006042 Bacteria 968
163 Ga0075363_100006998 3300006048 Bacteria 5158
164 Ga0075363_100007378 3300006048 Bacteria 5049
165 Ga0075363_100011078 3300006048 Bacteria 4307
166 Ga0075363_100014700 3300006048 Bacteria 3833
167 Ga0075363_100021605 3300006048 Bacteria 3245
168 Ga0075363_100023915 3300006048 Bacteria 3102
169 Ga0075363_100078216 3300006048 Bacteria 1806
170 Ga0075363_100106496 3300006048 Bacteria 1555
171 Ga0075363_100136745 3300006048 Bacteria 1377
172 Ga0075363_100167423 3300006048 Bacteria 1246
173 Ga0075363_100275943 3300006048 Bacteria 972
174 Ga0075364_10015620 3300006051 Bacteria 4711
175 Ga0075364_10017894 3300006051 Bacteria 4432
176 Ga0075364_10022143 3300006051 Bacteria 4010
177 Ga0075364_10090410 3300006051 Bacteria 2031
178 Ga0075364_10109279 3300006051 Bacteria 1844
179 Ga0075364_10162684 3300006051 Bacteria 1507
180 Ga0075364_10255102 3300006051 Bacteria 1192
181 Ga0075364_10342971 3300006051 Bacteria 1018
182 Ga0075364_10382711 3300006051 Bacteria 960
183 Ga0075364_10467399 3300006051 Bacteria 862
184 Ga0075364_10555493 3300006051 Bacteria 785
185 Ga0075364_10629837 3300006051 Bacteria 733
186 Ga0070715_10002914 3300006163 Bacteria 5340
187 Ga0070716_100011324 3300006173 Bacteria 4491
188 Ga0070716_100017829 3300006173 Bacteria 3689
189 Ga0070716_100079418 3300006173 Bacteria 1953
190 Ga0070712_100001019 3300006175 Bacteria 16902
191 Ga0070712_100002736 3300006175 Bacteria 10890
192 Ga0070712_100398620 3300006175 Bacteria 1136
193 Ga0075362_10017919 3300006177 Bacteria 2924
194 Ga0075362_10047691 3300006177 Bacteria 1909
195 Ga0075362_10122555 3300006177 Bacteria 1232
196 Ga0075362_10175586 3300006177 Bacteria 1036
197 Ga0075362_10318856 3300006177 Bacteria 774
198 Ga0075367_10007201 3300006178 Bacteria 5680
199 Ga0075367_10096508 3300006178 Bacteria 1803
200 Ga0075369_10000916 3300006186 Bacteria 9759
201 Ga0075369_10002820 3300006186 Bacteria 6252
202 Ga0075369_10004917 3300006186 Bacteria 4969
203 Ga0075369_10009210 3300006186 Bacteria 3829
204 Ga0075369_10010128 3300006186 Bacteria 3682
205 Ga0075369_10050697 3300006186 Bacteria 1796
206 Ga0075369_10055837 3300006186 Bacteria 1716
207 Ga0075369_10066553 3300006186 Bacteria 1581
208 Ga0075369_10117237 3300006186 Bacteria 1203
209 Ga0075369_10334247 3300006186 Bacteria 710
210 Ga0075369_10474380 3300006186 Bacteria 593
211 Ga0075366_10094924 3300006195 Bacteria 1788
212 Ga0075366_10341806 3300006195 Bacteria 918
213 Ga0097621_100227724 3300006237 Bacteria 1627
214 Ga0097621_100390316 3300006237 Bacteria 1245
215 Ga0075370_10003029 3300006353 Bacteria 7922
216 Ga0075370_10016337 3300006353 Bacteria 3992
217 Ga0075370_10025220 3300006353 Bacteria 3287
218 Ga0075370_10123782 3300006353 Bacteria 1506
219 Ga0075370_10333897 3300006353 Bacteria 904
220 Ga0068871_100096685 3300006358 Bacteria 2468
221 Ga0075428_100176672 3300006844 Bacteria 2312
222 Ga0075430_100461243 3300006846 Bacteria 1048
223 Ga0075431_100067717 3300006847 Bacteria 3686
224 Ga0075434_101931969 3300006871 Bacteria 596
225 Ga0068865_100018103 3300006881 Bacteria 4541
226 Ga0068865_100470273 3300006881 Bacteria 1043
227 Ga0068865_100993486 3300006881 Bacteria 734
228 Ga0097620_100005413 3300006931 Bacteria 12977
229 Ga0097620_100075054 3300006931 Bacteria 3421
230 Ga0097620_100236011 3300006931 Bacteria 1917
231 Ga0099795_10269403 3300007788 Bacteria 740
232 Ga0105250_10096628 3300009092 Bacteria 1204
233 Ga0105250_10432325 3300009092 Bacteria 588
234 Ga0111539_12621995 3300009094 Bacteria 584
235 Ga0111539_12921527 3300009094 Bacteria 553
236 Ga0111539_13480656 3300009094 Bacteria 506
237 Ga0105245_10051678 3300009098 Bacteria 3684
238 Ga0105245_10451542 3300009098 Bacteria 1294
239 Ga0105245_10596352 3300009098 Bacteria 1131
240 Ga0105247_10000008 3300009101 Bacteria 391450
241 Ga0105247_10000186 3300009101 Bacteria 60603
242 Ga0105247_10077469 3300009101 Bacteria 2089
243 Ga0105247_11026253 3300009101 Bacteria 646
244 Ga0105247_11055390 3300009101 Bacteria 638
245 Ga0105247_11112341 3300009101 Bacteria 624
246 Ga0114129_10218060 3300009147 Bacteria 2576
247 Ga0105243_10001206 3300009148 Bacteria 23278
248 Ga0105243_10321001 3300009148 Bacteria 1411
249 Ga0105243_10329365 3300009148 Bacteria 1394
250 Ga0105243_12501826 3300009148 Bacteria 555
251 Ga0105243_12992631 3300009148 Bacteria 512
252 Ga0105241_10031781 3300009174 Bacteria 3953
253 Ga0105241_10171301 3300009174 Bacteria 1793
254 Ga0105242_10001196 3300009176 Bacteria 20492
255 Ga0105242_10308325 3300009176 Bacteria 1447
256 Ga0105242_11712771 3300009176 Bacteria 665
257 Ga0105248_10000051 3300009177 Bacteria 150288
258 Ga0105248_10043948 3300009177 Bacteria 5011
259 Ga0105248_10097929 3300009177 Bacteria 3305
260 Ga0105248_10133106 3300009177 Bacteria 2805
261 Ga0105237_10001908 3300009545 Bacteria 26595
262 Ga0105237_10072761 3300009545 Bacteria 3431
263 Ga0105237_10579830 3300009545 Bacteria 1129
264 Ga0105237_11152121 3300009545 Bacteria 782
265 Ga0105238_10326521 3300009551 Bacteria 1521
266 Ga0105238_10573330 3300009551 Bacteria 1134
267 Ga0105249_10000040 3300009553 Bacteria 196153
268 Ga0105249_10002736 3300009553 Bacteria 15253
269 Ga0105249_10053785 3300009553 Bacteria 3681
270 Ga0105249_10390140 3300009553 Bacteria 1420
271 Ga0105249_10915843 3300009553 Bacteria 944
272 Ga0105249_12617282 3300009553 Bacteria 577
273 Ga0105239_10005473 3300010375 Bacteria 14898
274 Ga0105239_10089309 3300010375 Bacteria 3398
275 Ga0105239_10195358 3300010375 Bacteria 2266
276 Ga0105239_11038205 3300010375 Bacteria 943
277 Ga0105239_11216140 3300010375 Bacteria 868
278 Ga0105246_10067029 3300011119 Bacteria 2515
279 Ga0105246_10451973 3300011119 Bacteria 1080
280 Ga0105246_11063505 3300011119 Bacteria 737
281 Ga0157369_10115901 3300013105 Bacteria 2845
282 Ga0157369_10834264 3300013105 Bacteria 946
283 Ga0157374_10075113 3300013296 Bacteria 3193
284 Ga0157374_10243766 3300013296 Bacteria 1768
285 Ga0157374_10891576 3300013296 Bacteria 907
286 Ga0157378_10001177 3300013297 Bacteria 23785
287 Ga0157378_10870401 3300013297 Bacteria 930
288 Ga0163162_10148647 3300013306 Bacteria 2460
289 Ga0163162_10320884 3300013306 Bacteria 1681
290 Ga0163162_10382250 3300013306 Bacteria 1541
291 Ga0163162_10732903 3300013306 Bacteria 1108
292 Ga0163162_10863541 3300013306 Bacteria 1020
293 Ga0157372_10023288 3300013307 Bacteria 6712
294 Ga0157372_10391649 3300013307 Bacteria 1619
295 Ga0157372_11129382 3300013307 Bacteria 906
296 Ga0157372_12917032 3300013307 Bacteria 547
297 Ga0157375_10006977 3300013308 Bacteria 9864
298 Ga0157375_10602909 3300013308 Bacteria 1257
299 Ga0157375_10888232 3300013308 Bacteria 1036
300 Ga0157375_11006061 3300013308 Bacteria 973
301 Ga0163163_10153841 3300014325 Bacteria 2343
302 Ga0163163_10339619 3300014325 Bacteria 1557
303 Ga0163163_10621280 3300014325 Bacteria 1144
304 Ga0163163_10822051 3300014325 Bacteria 993
305 Ga0157380_10013012 3300014326 Bacteria 6051
306 Ga0157380_10506600 3300014326 Bacteria 1174
307 Ga0157380_11072719 3300014326 Bacteria 843
308 Ga0157377_10203698 3300014745 Bacteria 1258
309 Ga0157377_10692154 3300014745 Bacteria 739
310 Ga0157379_10054366 3300014968 Bacteria 3577
311 Ga0157379_10480621 3300014968 Bacteria 1150
312 Ga0157376_10176099 3300014969 Bacteria 1951
313 Ga0157376_10446289 3300014969 Bacteria 1261
314 Ga0163161_10011503 3300017792 Bacteria 6141
315 Ga0163161_10042112 3300017792 Bacteria 3283
316 Ga0163161_10469990 3300017792 Bacteria 1019
317 Ga0163161_10881013 3300017792 Bacteria 757
318 Ga0213874_10013533 3300021377 Bacteria 2116
319 Ga0213876_10182830 3300021384 Bacteria 1115
320 Ga0213875_10025814 3300021388 Bacteria 2796
321 Ga0209673_1011534 3300025273 Bacteria 3637
322 Ga0209673_1107727 3300025273 Bacteria 588
323 Ga0209025_1093814 3300025294 Bacteria 972
324 Ga0209051_1000034 3300025303 Bacteria 371498
325 Ga0209051_1001438 3300025303 Bacteria 20303
326 Ga0209051_1010201 3300025303 Bacteria 4772
327 Ga0207696_1113253 3300025711 Bacteria 734
328 Ga0207653_10169152 3300025885 Bacteria 812
329 Ga0207692_10073075 3300025898 Bacteria 1813
330 Ga0207692_10144687 3300025898 Bacteria 1355
331 Ga0207692_10369764 3300025898 Bacteria 888
332 Ga0207642_10004554 3300025899 Bacteria 4476
333 Ga0207642_10132887 3300025899 Bacteria 1301
334 Ga0207710_10000006 3300025900 Bacteria 538831
335 Ga0207710_10004193 3300025900 Bacteria 6320
336 Ga0207688_10001999 3300025901 Bacteria 10939
337 Ga0207680_10027562 3300025903 Bacteria 3165
338 Ga0207680_10482176 3300025903 Bacteria 882
339 Ga0207647_10013619 3300025904 Bacteria 5631
340 Ga0207647_10034452 3300025904 Bacteria 3232
341 Ga0207685_10001725 3300025905 Bacteria 4741
342 Ga0207699_10018940 3300025906 Bacteria 3658
343 Ga0207645_10088457 3300025907 Bacteria 1991
344 Ga0207643_10153815 3300025908 Bacteria 1380
345 Ga0207654_10038655 3300025911 Bacteria 2679
346 Ga0207671_10005895 3300025914 Bacteria 11115
347 Ga0207671_10304957 3300025914 Bacteria 1258
348 Ga0207671_10471434 3300025914 Bacteria 1000
349 Ga0207693_10000172 3300025915 Bacteria 58877
350 Ga0207693_10005165 3300025915 Bacteria 10926
351 Ga0207663_10006921 3300025916 Bacteria 5842
352 Ga0207663_10068898 3300025916 Bacteria 2274
353 Ga0207663_10144203 3300025916 Bacteria 1663
354 Ga0207663_10711758 3300025916 Bacteria 796
355 Ga0207660_10179213 3300025917 Bacteria 1645
356 Ga0207660_10411007 3300025917 Bacteria 1091
357 Ga0207662_10418659 3300025918 Bacteria 911
358 Ga0207657_10079315 3300025919 Bacteria 2762
359 Ga0207649_10577408 3300025920 Bacteria 863
360 Ga0207652_10529588 3300025921 Bacteria 1060
361 Ga0207681_10002196 3300025923 Bacteria 12443
362 Ga0207681_10217232 3300025923 Bacteria 1477
363 Ga0207694_10254445 3300025924 Bacteria 1438
364 Ga0207694_10717336 3300025924 Bacteria 843
365 Ga0207687_10016603 3300025927 Bacteria 4836
366 Ga0207687_11358726 3300025927 Bacteria 611
367 Ga0207644_10038407 3300025931 Bacteria 3372
368 Ga0207644_10879478 3300025931 Bacteria 751
369 Ga0207644_11366941 3300025931 Bacteria 595
370 Ga0207690_10179915 3300025932 Bacteria 1591
371 Ga0207690_10196001 3300025932 Bacteria 1531
372 Ga0207690_10766804 3300025932 Bacteria 796
373 Ga0207706_10006699 3300025933 Bacteria 10652
374 Ga0207706_10015257 3300025933 Bacteria 6948
375 Ga0207686_10005979 3300025934 Bacteria 6533
376 Ga0207709_10043414 3300025935 Bacteria 2710
377 Ga0207709_11047648 3300025935 Bacteria 668
378 Ga0207670_10029249 3300025936 Bacteria 3508
379 Ga0207669_10175149 3300025937 Bacteria 1531
380 Ga0207669_10266832 3300025937 Bacteria 1283
381 Ga0207704_10004705 3300025938 Bacteria 6262
382 Ga0207704_10152466 3300025938 Bacteria 1633
383 Ga0207665_10014033 3300025939 Bacteria 5270
384 Ga0207665_10111155 3300025939 Bacteria 1926
385 Ga0207665_10164663 3300025939 Bacteria 1597
386 Ga0207691_10094538 3300025940 Bacteria 2674
387 Ga0207691_10389569 3300025940 Bacteria 1189
388 Ga0207711_10000095 3300025941 Bacteria 93602
389 Ga0207711_10037218 3300025941 Bacteria 4132
390 Ga0207711_10225730 3300025941 Bacteria 1714
391 Ga0207711_10363881 3300025941 Bacteria 1340
392 Ga0207689_10520552 3300025942 Bacteria 997
393 Ga0207689_10773289 3300025942 Bacteria 810
394 Ga0207661_10392225 3300025944 Bacteria 1258
395 Ga0207712_10000017 3300025961 Bacteria 337943
396 Ga0207712_10053789 3300025961 Bacteria 2826
397 Ga0207712_10519414 3300025961 Bacteria 1020
398 Ga0207712_11386031 3300025961 Bacteria 629
399 Ga0207668_10000524 3300025972 Bacteria 24019
400 Ga0207668_10039411 3300025972 Bacteria 3180
401 Ga0207668_10078890 3300025972 Bacteria 2379
402 Ga0207668_10576907 3300025972 Bacteria 977
403 Ga0207640_10063315 3300025981 Bacteria 2457
404 Ga0207640_11194409 3300025981 Bacteria 676
405 Ga0207640_11198653 3300025981 Bacteria 675
406 Ga0207640_11506267 3300025981 Bacteria 604
407 Ga0207658_10000016 3300025986 Bacteria 215618
408 Ga0207658_10003613 3300025986 Bacteria 10929
409 Ga0207658_10007529 3300025986 Bacteria 7415
410 Ga0207658_10062181 3300025986 Bacteria 2793
411 Ga0207658_10176182 3300025986 Bacteria 1766
412 Ga0207658_10314127 3300025986 Bacteria 1354
413 Ga0207658_10593343 3300025986 Bacteria 995
414 Ga0207658_10652038 3300025986 Bacteria 949
415 Ga0207677_10023595 3300026023 Bacteria 3804
416 Ga0207677_10428783 3300026023 Bacteria 1128
417 Ga0207677_10550546 3300026023 Bacteria 1005
418 Ga0207677_11650499 3300026023 Bacteria 594
419 Ga0207703_10076636 3300026035 Bacteria 2774
420 Ga0207703_10158199 3300026035 Bacteria 1982
421 Ga0207703_10184854 3300026035 Bacteria 1841
422 Ga0207703_10338086 3300026035 Bacteria 1383
423 Ga0207639_10009642 3300026041 Bacteria 6671
424 Ga0207639_10107602 3300026041 Bacteria 2265
425 Ga0207639_10175786 3300026041 Bacteria 1817
426 Ga0207678_10027200 3300026067 Bacteria 4988
427 Ga0207678_10060930 3300026067 Bacteria 3245
428 Ga0207678_10098175 3300026067 Bacteria 2502
429 Ga0207678_10219081 3300026067 Bacteria 1629
430 Ga0207708_10007759 3300026075 Bacteria 7946
431 Ga0207708_10027012 3300026075 Bacteria 4346
432 Ga0207708_10619293 3300026075 Bacteria 918
433 Ga0207641_10000670 3300026088 Bacteria 37268
434 Ga0207641_10065834 3300026088 Bacteria 3100
435 Ga0207641_10317554 3300026088 Bacteria 1476
436 Ga0207648_10156999 3300026089 Bacteria 2008
437 Ga0207648_10299172 3300026089 Bacteria 1443
438 Ga0207648_11070261 3300026089 Bacteria 756
439 Ga0207676_11182805 3300026095 Bacteria 757
440 Ga0207676_11821188 3300026095 Bacteria 607
441 Ga0207675_100016784 3300026118 Bacteria 6839
442 Ga0207675_100404658 3300026118 Bacteria 1345
443 Ga0207683_10001213 3300026121 Bacteria 23363
444 Ga0207683_10093476 3300026121 Bacteria 2680
445 Ga0207683_10398442 3300026121 Bacteria 1266
446 Ga0209813_10178644 3300027866 Bacteria 775
447 Ga0268266_10035003 3300028379 Bacteria 4272
448 Ga0268266_10119833 3300028379 Bacteria 2341
449 Ga0268266_10327296 3300028379 Bacteria 1435
450 Ga0268266_10374491 3300028379 Bacteria 1342
451 Ga0268266_10401658 3300028379 Bacteria 1296
452 Ga0268265_10000068 3300028380 Bacteria 142272
453 Ga0268265_10011543 3300028380 Bacteria 5972
454 Ga0268264_10000056 3300028381 Bacteria 310339
455 Ga0268264_10005096 3300028381 Bacteria 11134
456 Ga0268264_10371029 3300028381 Bacteria 1368
457 Ga0268264_10667704 3300028381 Bacteria 1030
458 Ga0265327_10000125 3300031251 Bacteria 167832
459 Ga0265327_10000954 3300031251 Bacteria 41614
460 Ga0265327_10174156 3300031251 Bacteria 987
461 Ga0316576_10088120 3300031727 Bacteria 2310
462 Ga0316578_10010569 3300031728 Bacteria 4796
463 Ga0316578_10116938 3300031728 Bacteria 1602
464 Ga0316577_10103316 3300031733 Bacteria 1598
465 Ga0307407_10076157 3300031903 Bacteria 2014
466 Ga0307409_100531370 3300031995 Bacteria 1151
467 Ga0307415_100469017 3300032126 Bacteria 1093
468 Ga0307415_101818013 3300032126 Bacteria 590
469 Ga0373929_0213363 3300035085 Bacteria 546
470 Ga0373949_0284793 3300035090 Bacteria 520
471 Ga0373952_0061977 3300035092 Bacteria 917
472 Ga0373923_0346175 3300035111 Bacteria 709
473 Ga0373932_0095363 3300035112 Bacteria 961
474 Ga0373939_0036345 3300035114 Bacteria 1457
475 Ga0373960_0107656 3300035121 Bacteria 911
476 Ga0373955_0621686 3300035172 Bacteria 662
477 Ga0373942_0088345 3300035207 Bacteria 930
478 Ga0316574_0199241 3300035398 Bacteria 1286
479 Ga0373935_0526801 3300035692 Bacteria 860
480 Ga0373947_0494263 3300035725 Unclassified 831
481 Ga0316582_0218888 3300036647 Bacteria 1302
482 Ga0316584_0011233 3300036712 Bacteria 6286
483 Ga0373925_0053561 3300037068 Bacteria 3017
484 Ga0373925_1313205 3300037068 Unclassified 593
485 Ga0395900_1615010 3300037418 Bacteria 560
486 Ga0395898_1833038 3300037466 Bacteria 527
487 Ga0436364_0431515 3300037853 Bacteria 745
488 Ga0436364_0893513 3300037853 Bacteria 905
489 Ga0436364_1449180 3300037853 Bacteria 22956
490 Ga0436365_0938521 3300039437 Bacteria 2266
491 Ga0436365_1123290 3300039437 Bacteria 1991
492 Ga0436363_1542843 3300039450 Bacteria 4117
493 Ga0436363_1625962 3300039450 Bacteria 1243
494 Ga0439461_0018179 3300041410 Bacteria 1374
495 Ga0439465_0009767 3300041413 Bacteria 3023
496 Ga0439465_0015519 3300041413 Bacteria 2377
497 Ga0439465_0043363 3300041413 Bacteria 1459
498 Ga0439465_0055575 3300041413 Bacteria 1303
499 Ga0451793_0083890 3300041452 Bacteria 872
500 Ga0451793_0389020 3300041452 Bacteria 820
501 Ga0451793_0983776 3300041452 Bacteria 813
502 Ga0451795_1712713 3300041456 Bacteria 2041
503 Ga0451800_1544174 3300041459 Bacteria 694
504 Ga0451800_1660493 3300041459 Bacteria 618
505 Ga0451802_0123910 3300041460 Bacteria 846
506 Ga0451802_0341210 3300041460 Bacteria 1212
507 Ga0451833_0244844 3300041491 Bacteria 817
508 Ga0451841_0568569 3300041498 Bacteria 1164
509 Ga0451843_0189076 3300041509 Bacteria 544
510 Ga0451855_0985586 3300041511 Bacteria 835
511 Ga0451853_0688837 3300041512 Bacteria 829
512 Ga0439431_0014543 3300041997 Bacteria 1825
513 Ga0439442_013544 3300042002 Bacteria 1673
514 Ga0439445_0015326 3300042004 Bacteria 1876
515 Ga0439445_0135111 3300042004 Bacteria 713
516 Ga0439448_0054011 3300042005 Bacteria 1319
517 Ga0439434_0002857 3300042435 Bacteria 5042
518 Ga0439459_0017821 3300042438 Bacteria 1328
519 Ga0466969_0012634 3300044656 Bacteria 4450
520 Ga0466972_0032829 3300044658 Bacteria 2548
521 Ga0466972_0208745 3300044658 Bacteria 914
522 Ga0466972_0236558 3300044658 Bacteria 854
523 Ga0466972_0343545 3300044658 Bacteria 698
524 Ga0466965_0012902 3300044683 Bacteria 3935
525 Ga0466966_0006599 3300044684 Bacteria 7683
526 Ga0466966_0111805 3300044684 Bacteria 1683
527 Ga0466966_0399532 3300044684 Bacteria 826
528 Ga0466961_0006592 3300044693 Bacteria 7379
529 Ga0466961_0351222 3300044693 Bacteria 897
530 Ga0466963_0108745 3300044694 Bacteria 1902
531 Ga0466964_0005886 3300044706 Bacteria 4566
532 Ga0466971_0175177 3300044719 Bacteria 1007
533 Ga0466968_0007473 3300044735 Bacteria 4156
534 Ga0466970_0040853 3300044765 Bacteria 2463
535 Ga0466970_0067348 3300044765 Bacteria 1923
536 Ga0466957_0001193 3300044842 Bacteria 13528
537 Ga0466957_0035946 3300044842 Bacteria 2975
538 Ga0466960_0000854 3300044901 Bacteria 10757
539 Ga0466960_0032106 3300044901 Bacteria 2428
540 Ga0466960_0682047 3300044901 Bacteria 615
541 Ga0466959_0062006 3300045049 Bacteria 2718
542 Ga0466959_0084423 3300045049 Bacteria 2286
543 Ga0466958_0007115 3300045836 Bacteria 6128
544 Ga0466958_0112050 3300045836 Bacteria 1703
545 Ga0466967_0074954 3300045976 Bacteria 3040
546 Ga0466967_0118858 3300045976 Bacteria 2439
547 Ga0466967_0286744 3300045976 Bacteria 1581
548 Ga0466967_0381839 3300045976 Bacteria 1368
549 Ga0466967_0534430 3300045976 Bacteria 1153
550 Ga0466967_0646684 3300045976 Bacteria 1045
551 Ga0466967_0755456 3300045976 Bacteria 964
552 Ga0466967_1070563 3300045976 Bacteria 803
553 Ga0466967_1790633 3300045976 Bacteria 611
554 Ga0495603_0269028 3300046455 Bacteria 980
555 Ga0495590_0163153 3300046457 Bacteria 811
556 Ga0495590_0180698 3300046457 Bacteria 771
557 Ga0495629_0021920 3300046459 Bacteria 4559
558 Ga0495638_0063695 3300046460 Bacteria 2272
559 Ga0495582_0057986 3300046473 Bacteria 2135
560 Ga0495582_0086225 3300046473 Bacteria 1747
561 Ga0495639_0383455 3300046475 Bacteria 708
562 Ga0495662_0323082 3300046476 Bacteria 759
563 Ga0495583_0105709 3300046506 Bacteria 1197
564 Ga0495606_0039160 3300046507 Bacteria 3199
565 Ga0495620_0225414 3300046515 Bacteria 717
566 Ga0495630_0312127 3300046517 Bacteria 1202
567 Ga0495632_0261388 3300046519 Bacteria 774
568 Ga0495648_0002641 3300046524 Bacteria 16273
569 Ga0495654_0032747 3300046530 Bacteria 2634
570 Ga0495665_0002660 3300046531 Bacteria 9644
571 Ga0495640_0028474 3300046533 Bacteria 4022
572 Ga0495668_0016376 3300046616 Bacteria 4309
573 Ga0495668_0642163 3300046616 Bacteria 587
574 Ga0495611_0026174 3300046648 Bacteria 2545
575 Ga0495635_0032138 3300046663 Bacteria 3642
576 Ga0495635_0087185 3300046663 Bacteria 2136
577 Ga0495588_0446443 3300046674 Unclassified 679
578 Ga0495658_0167946 3300046683 Bacteria 1356
579 Ga0495670_0430530 3300046691 Bacteria 714
580 Ga0495649_0028756 3300046694 Bacteria 3081
581 Ga0495649_0081149 3300046694 Bacteria 1734
582 Ga0495649_0203032 3300046694 Bacteria 1029
583 Ga0495649_0543124 3300046694 Bacteria 576
584 Ga0495581_0178864 3300047315 Bacteria 1240
585 Ga0495672_0006644 3300047320 Bacteria 8886
586 Ga0495672_0143281 3300047320 Bacteria 1246
587 Ga0495672_0185629 3300047320 Bacteria 1050
588 Ga0495672_0278171 3300047320 Bacteria 801
589 Ga0495672_0395761 3300047320 Bacteria 633
590 Ga0495673_0004474 3300047469 Bacteria 8728
591 Ga0495686_0003415 3300047472 Bacteria 13810
592 Ga0495686_0487065 3300047472 Bacteria 651
593 Ga0495593_0045183 3300047673 Bacteria 2352
594 Ga0496100_0000201 3300048903 Bacteria 32813
595 Ga0496100_0000801 3300048903 Bacteria 15028
596 Ga0496100_0000951 3300048903 Bacteria 13867
597 Ga0496100_0004830 3300048903 Bacteria 7200
598 Ga0496100_0063818 3300048903 Bacteria 2435
599 Ga0496100_0084745 3300048903 Bacteria 2149
600 Ga0496100_0273035 3300048903 Bacteria 1258
601 Ga0496100_0447005 3300048903 Bacteria 990
602 Ga0496100_0466409 3300048903 Bacteria 970
603 Ga0496100_0536209 3300048903 Bacteria 904
604 Ga0496100_0731130 3300048903 Bacteria 773
605 Ga0496101_0000115 3300048904 Bacteria 79334
606 Ga0496101_0000167 3300048904 Bacteria 55044
607 Ga0496101_0007954 3300048904 Bacteria 6909
608 Ga0496101_0013614 3300048904 Bacteria 5455
609 Ga0496101_0018577 3300048904 Bacteria 4730
610 Ga0496101_0344366 3300048904 Bacteria 1171
611 Ga0496101_0344776 3300048904 Bacteria 1170
612 Ga0496101_0417023 3300048904 Bacteria 1058
613 Ga0496101_0655357 3300048904 Bacteria 829
614 Ga0496102_0000009 3300048905 Bacteria 344149
615 Ga0496102_0000274 3300048905 Bacteria 65634
616 Ga0496102_0001208 3300048905 Bacteria 23450
617 Ga0496102_0051718 3300048905 Bacteria 3742
618 Ga0496102_0105833 3300048905 Bacteria 2617
619 Ga0496102_0115765 3300048905 Bacteria 2501
620 Ga0496102_0173300 3300048905 Bacteria 2031
621 Ga0496102_0294308 3300048905 Bacteria 1530
622 Ga0496102_0376593 3300048905 Bacteria 1336
623 Ga0496102_0599642 3300048905 Bacteria 1024
624 Ga0496103_0000051 3300048906 Bacteria 150397
625 Ga0496103_0000288 3300048906 Bacteria 47116
626 Ga0496103_0000858 3300048906 Bacteria 22173
627 Ga0496103_0002248 3300048906 Bacteria 12227
628 Ga0496103_0085512 3300048906 Bacteria 1987
629 Ga0496104_0008927 3300048907 Bacteria 8909
630 Ga0496104_0475943 3300048907 Bacteria 1160
631 Ga0496104_1082599 3300048907 Bacteria 705
632 Ga0496105_0010964 3300048908 Bacteria 7142
633 Ga0496105_0496606 3300048908 Bacteria 958
634 Ga0496105_1019571 3300048908 Bacteria 618
635 Ga0496106_0001133 3300048909 Bacteria 19719
636 Ga0496106_0005821 3300048909 Bacteria 9114
637 Ga0496106_0007827 3300048909 Bacteria 7909
638 Ga0496106_0017521 3300048909 Bacteria 5300
639 Ga0496106_0243335 3300048909 Bacteria 1437
640 Ga0496106_0309025 3300048909 Bacteria 1268
641 Ga0496106_0742445 3300048909 Bacteria 781
642 Ga0496107_0001733 3300048910 Bacteria 13707
643 Ga0496107_0002511 3300048910 Bacteria 11931
644 Ga0496107_0023543 3300048910 Bacteria 4354
645 Ga0496107_0054563 3300048910 Bacteria 2884
646 Ga0496107_0069886 3300048910 Bacteria 2549
647 Ga0496107_0097471 3300048910 Bacteria 2153
648 Ga0496107_0163844 3300048910 Bacteria 1648
649 Ga0496107_0959574 3300048910 Bacteria 622
650 Ga0496108_0007595 3300048911 Bacteria 8780
651 Ga0496108_0164014 3300048911 Bacteria 1921
652 Ga0496108_0197636 3300048911 Bacteria 1744
653 Ga0496109_0000213 3300048912 Bacteria 56907
654 Ga0496109_0020271 3300048912 Bacteria 5873
655 Ga0496109_0097489 3300048912 Bacteria 2725
656 Ga0496109_0156818 3300048912 Bacteria 2132
657 Ga0496109_0546754 3300048912 Bacteria 1092
658 Ga0496110_0003827 3300048913 Bacteria 11592
659 Ga0496110_0054778 3300048913 Bacteria 3508
660 Ga0496110_0138331 3300048913 Bacteria 2201
661 Ga0496110_0170213 3300048913 Bacteria 1976
662 Ga0496110_0480096 3300048913 Bacteria 1132
663 Ga0496110_0835326 3300048913 Bacteria 826
664 Ga0496110_1806913 3300048913 Bacteria 521
665 Ga0496111_0001874 3300048914 Bacteria 12431
666 Ga0496111_0277025 3300048914 Bacteria 1244
667 Ga0496111_0867684 3300048914 Bacteria 651
668 Ga0496112_0003640 3300048915 Bacteria 12838
669 Ga0496112_0043057 3300048915 Bacteria 4419
670 Ga0496112_0193615 3300048915 Bacteria 1994
671 Ga0496112_0382098 3300048915 Bacteria 1349
672 Ga0496112_0437518 3300048915 Bacteria 1246
673 Ga0496112_0602545 3300048915 Bacteria 1030
674 Ga0496113_0038192 3300048916 Bacteria 3530
675 Ga0496113_0117035 3300048916 Bacteria 2080
676 Ga0496113_0404772 3300048916 Bacteria 1096
677 Ga0496114_0001210 3300048917 Bacteria 19511
678 Ga0496114_0001402 3300048917 Bacteria 18316
679 Ga0496114_0007733 3300048917 Bacteria 8504
680 Ga0496114_0166962 3300048917 Bacteria 1916
681 Ga0496114_0168397 3300048917 Bacteria 1908
682 Ga0496114_0348844 3300048917 Bacteria 1309
683 Ga0496114_0926726 3300048917 Bacteria 753
684 Ga0496115_0006966 3300048918 Bacteria 8303
685 Ga0496115_0017756 3300048918 Bacteria 5446
686 Ga0496115_0020890 3300048918 Bacteria 5053
687 Ga0496115_0046028 3300048918 Bacteria 3485
688 Ga0496115_0319665 3300048918 Bacteria 1270
689 Ga0496115_0826542 3300048918 Bacteria 719
690 Ga0496116_0000141 3300048919 Bacteria 150405
691 Ga0496116_0004338 3300048919 Bacteria 13566
692 Ga0496116_0044981 3300048919 Bacteria 2992
693 Ga0496117_0000019 3300048920 Bacteria 469256
694 Ga0496117_0000631 3300048920 Bacteria 57010
695 Ga0496117_0008374 3300048920 Bacteria 9833
696 Ga0496117_0152839 3300048920 Bacteria 1363
697 Ga0496118_0000020 3300048921 Bacteria 470521
698 Ga0496118_0053305 3300048921 Bacteria 3076
699 Ga0496118_0074375 3300048921 Bacteria 2429
700 Ga0496118_0181385 3300048921 Bacteria 1271
701 Ga0496118_0267419 3300048921 Bacteria 960
702 Ga0496119_0006223 3300048922 Bacteria 11153
703 Ga0496119_0011207 3300048922 Bacteria 7462
704 Ga0496119_0019498 3300048922 Bacteria 4992
705 Ga0496119_0040044 3300048922 Bacteria 3003
706 Ga0496119_0073112 3300048922 Bacteria 2000
707 Ga0496120_0005805 3300048923 Bacteria 9675
708 Ga0496120_0008927 3300048923 Bacteria 7179
709 Ga0496120_0062749 3300048923 Bacteria 2069
710 Ga0496121_0000002 3300048924 Bacteria 1494588
711 Ga0496121_0000510 3300048924 Bacteria 74197
712 Ga0496121_0002244 3300048924 Bacteria 30111
713 Ga0496122_0000639 3300048925 Bacteria 71085
714 Ga0496122_0001930 3300048925 Bacteria 31280
715 Ga0496122_0087761 3300048925 Bacteria 2135
716 Ga0496123_0071046 3300048926 Bacteria 2174
717 Ga0496124_0000002 3300048927 Bacteria 1494588
718 Ga0496124_0429479 3300048927 Bacteria 907
719 Ga0496125_0000002 3300048928 Bacteria 1480920
720 Ga0496125_0000066 3300048928 Bacteria 249043
721 Ga0496125_0021763 3300048928 Bacteria 5967
722 Ga0496125_0208245 3300048928 Bacteria 1273
723 Ga0496125_0377640 3300048928 Bacteria 837
724 Ga0496125_0384178 3300048928 Bacteria 826
725 Ga0496126_0000009 3300048929 Bacteria 750350
726 Ga0496126_0006902 3300048929 Bacteria 12577
727 Ga0496126_0019767 3300048929 Bacteria 6626
728 Ga0496126_0029306 3300048929 Bacteria 5230
729 Ga0496126_0033215 3300048929 Bacteria 4855
730 Ga0496126_0293454 3300048929 Bacteria 1344
731 Ga0501032_0013304 3300049569 Bacteria 5857
732 Ga0501033_0087619 3300049570 Bacteria 2278
733 Ga0501034_0011255 3300049571 Bacteria 9287
734 Ga0501034_0092023 3300049571 Bacteria 3030
735 Ga0501034_0241556 3300049571 Bacteria 1752
736 Ga0501034_0445584 3300049571 Bacteria 1213
737 Ga0501036_0262880 3300049572 Bacteria 1445
738 Ga0501037_0002187 3300049573 Bacteria 14141
739 Ga0501038_0079087 3300049574 Bacteria 2773
740 Ga0501039_0000790 3300049575 Bacteria 22773
741 Ga0501043_0001034 3300049579 Bacteria 24438
742 Ga0501046_0673657 3300049580 Bacteria 730
743 Ga0501047_0216510 3300049581 Bacteria 1772
744 Ga0501048_0660854 3300049582 Bacteria 750
745 Ga0501067_0091648 3300049583 Bacteria 1687
746 Ga0501070_0002430 3300049586 Bacteria 16333
747 Ga0501070_0164172 3300049586 Bacteria 1830
748 Ga0501071_0679032 3300049587 Bacteria 793
749 Ga0501072_1054124 3300049588 Bacteria 633
750 Ga0501077_0476989 3300049593 Bacteria 799
751 Ga0501080_0144555 3300049742 Bacteria 2199
752 Ga0501083_1107743 3300049744 Bacteria 515
753 Ga0501035_0000121 3300049822 Bacteria 94497
754 Ga0501044_0016394 3300049823 Bacteria 7955
755 Ga0501044_0295462 3300049823 Bacteria 1550
756 nmdc:mga03683_110883_c1 3300050489 Bacteria 1213
757 nmdc:mga03683_14418_c1 3300050489 Bacteria 2924
758 nmdc:mga03683_311136_c1 3300050489 Bacteria 740
759 nmdc:mga03683_4882_c2 3300050489 Bacteria 2398
760 nmdc:mga03683_68738_c1 3300050489 Bacteria 1510
761 nmdc:mga03n38_11240_c1 3300050490 Bacteria 3327
762 nmdc:mga03n38_147715_c1 3300050490 Bacteria 1180
763 nmdc:mga03n38_159670_c1 3300050490 Bacteria 1141
764 nmdc:mga03n38_20150_c1 3300050490 Bacteria 2663
765 nmdc:mga03n38_21173_c1 3300050490 Bacteria 2613
766 nmdc:mga03n38_211972_c1 3300050490 Bacteria 1007
767 nmdc:mga03n38_23444_c1 3300050490 Bacteria 2511
768 nmdc:mga03n38_25970_c1 3300050490 Bacteria 2413
769 nmdc:mga03n38_72749_c1 3300050490 Bacteria 1595
770 nmdc:mga03n38_797200_c1 3300050490 Bacteria 550
771 nmdc:mga03n38_853081_c1 3300050490 Bacteria 533
772 nmdc:mga00v17_1034920_c1 3300050491 Bacteria 516
773 nmdc:mga00v17_118596_c1 3300050491 Bacteria 1684
774 nmdc:mga00v17_14374_c1 3300050491 Bacteria 4416
775 nmdc:mga00v17_212183_c1 3300050491 Bacteria 1253
776 nmdc:mga00v17_24256_c1 3300050491 Bacteria 3516
777 nmdc:mga00v17_289882_c1 3300050491 Bacteria 1063
778 nmdc:mga00v17_338581_c1 3300050491 Bacteria 978
779 nmdc:mga00v17_4100_c1 3300050491 Bacteria 7543
780 nmdc:mga00v17_426952_c1 3300050491 Bacteria 861
781 nmdc:mga00v17_465057_c1 3300050491 Bacteria 821
782 nmdc:mga00v17_470480_c1 3300050491 Bacteria 815
783 nmdc:mga00v17_551994_c1 3300050491 Bacteria 745
784 nmdc:mga00v17_58396_c1 3300050491 Bacteria 2364
785 nmdc:mga00v17_7528_c1 3300050491 Bacteria 5813
786 nmdc:mga00v17_85269_c1 3300050491 Bacteria 1978
787 nmdc:mga0yw44_100062_c1 3300050492 Bacteria 1845
788 nmdc:mga0yw44_1134989_c1 3300050492 Bacteria 528
789 nmdc:mga0yw44_132791_c1 3300050492 Bacteria 1613
790 nmdc:mga0yw44_304606_c1 3300050492 Bacteria 1068
791 nmdc:mga0yw44_40430_c1 3300050492 Bacteria 2770
792 nmdc:mga0yw44_4348_c1 3300050492 Bacteria 6476
793 nmdc:mga0yw44_5308_c1 3300050492 Bacteria 6059
794 nmdc:mga0yw44_543128_c1 3300050492 Bacteria 789
795 nmdc:mga0yw44_97623_c1 3300050492 Bacteria 1867
796 nmdc:mga0k408_350474_c1 3300050493 Bacteria 880
797 nmdc:mga0k408_370215_c1 3300050493 Bacteria 854
798 nmdc:mga0k408_43052_c1 3300050493 Bacteria 2600
799 nmdc:mga06z11_137593_c1 3300050494 Bacteria 1377
800 nmdc:mga06z11_29136_c1 3300050494 Bacteria 2656
801 nmdc:mga06z11_409391_c1 3300050494 Bacteria 817
802 nmdc:mga06z11_740209_c1 3300050494 Bacteria 599
803 nmdc:mga04h51_125173_c1 3300050495 Bacteria 961
804 nmdc:mga04h51_98857_c1 3300050495 Bacteria 1061
805 nmdc:mga07m45_11220_c1 3300050496 Bacteria 4703
806 nmdc:mga07m45_180684_c1 3300050496 Bacteria 1227
807 nmdc:mga07m45_18588_c1 3300050496 Bacteria 3755
808 nmdc:mga07m45_342_c1 3300050496 Bacteria 18938
809 nmdc:mga07m45_88637_c1 3300050496 Bacteria 1771
810 nmdc:mga05p37_70878_c1 3300050507 Bacteria 1143
811 nmdc:mga09592_1024478_c1 3300050508 Bacteria 689
812 nmdc:mga0qj67_366012_c1 3300050509 Bacteria 1165
813 nmdc:mga06r32_24981_c1 3300050510 Bacteria 5551
814 nmdc:mga08y16_2139980_c1 3300050511 Bacteria 507
815 nmdc:mga08x19_739864_c1 3300050514 Bacteria 698
816 nmdc:mga0sz30_112848_c1 3300050516 Bacteria 1192
817 nmdc:mga0sz30_136076_c1 3300050516 Bacteria 1084
818 nmdc:mga0sz30_1522_c1 3300050516 Bacteria 8256
819 nmdc:mga0sz30_255888_c1 3300050516 Bacteria 779
820 nmdc:mga0sz30_273888_c1 3300050516 Bacteria 752
821 nmdc:mga0sz30_294083_c1 3300050516 Bacteria 724
822 nmdc:mga0sz30_3041_c1 3300050516 Bacteria 6005
823 nmdc:mga0sz30_3402_c1 3300050516 Bacteria 5729
824 nmdc:mga0sz30_37862_c1 3300050516 Bacteria 2020
825 nmdc:mga0sz30_4050_c1 3300050516 Bacteria 5276
826 nmdc:mga0sz30_429065_c1 3300050516 Bacteria 593
827 nmdc:mga0sz30_44584_c1 3300050516 Bacteria 1869
828 nmdc:mga0sz30_53050_c1 3300050516 Bacteria 1722
829 nmdc:mga0sz30_57197_c2 3300050516 Bacteria 1014
830 Ga0495655_0009523 3300053083 Bacteria 1887
831 Ga0495655_0103057 3300053083 Bacteria 848
832 Ga0495619_0062029 3300053085 Bacteria 2489
833 Ga0500556_0032165 3300053104 Bacteria 1790
834 Ga0500562_111639 3300053108 Bacteria 745
835 Ga0500652_001800 3300053131 Bacteria 6493
836 Ga0500561_0005532 3300053137 Bacteria 2355
837 Ga0500568_0146031 3300053139 Bacteria 876
838 Ga0500588_0216471 3300053146 Bacteria 713
839 Ga0500616_0020249 3300053153 Bacteria 3739
840 Ga0500616_0117216 3300053153 Bacteria 1277
841 Ga0500620_116666 3300053155 Bacteria 935
842 Ga0500620_138596 3300053155 Bacteria 850
843 Ga0500645_000163 3300053730 Bacteria 51808
844 Ga0466962_0042818 3300061719 Bacteria 2167
845 Ga0466962_0338141 3300061719 Bacteria 748
846 2644487437 2643221687 Bacteria 6500351
847 2644639041 2643221715 Bacteria 6671032
848 2738665693 2738541264 Bacteria 5935393
849 2739144827 2738541356 Bacteria 5935017
850 2744957828 2744054611 Bacteria 5611514
851 2842135231 2842134933 Bacteria 5847019
852 2902794337 2902792274 Bacteria 7270173
853 2902839534 2902837492 Bacteria 6697721
854 2929213056 2929212328 Bacteria 7708288
855 2939587175 2939582691 Bacteria 7088898
856 JGI24743J22301_10089387
857 CNXas_1018685
858 LJNas_1005201
859 JGI24735J21928_10048099
860 JGI24735J21928_10182742
861 JGI24738J21930_10015219
862 JGI24744J21845_10010735
863 JGI24742J22300_10003776
864 JGI24751J29686_10023482
865 rootL2_10108869
866 Ga0055528_1033033
867 Ga0055540_1003486
868 Ga0055540_1004511
869 Ga0055540_1008891
870 Ga0070683_101225773
871 Ga0070690_100250380
872 Ga0068869_100154962
873 Ga0068869_100448496
874 Ga0068869_101991367
875 Ga0070666_10027842
876 Ga0070666_10907299
877 Ga0070680_100188665
878 Ga0070680_100411365
879 Ga0070682_100015676
880 Ga0070682_100027113
881 Ga0070682_100027323
882 Ga0070682_100097330
883 Ga0070682_100636591
884 Ga0068868_100028777
885 Ga0068868_101248628
886 Ga0068868_101699393
887 Ga0070660_100298859
888 Ga0070689_100003461
889 Ga0070691_10060024
890 Ga0070687_100493807
891 Ga0070692_10045366
892 Ga0070692_10857733
893 Ga0070668_100000462
894 Ga0070668_100004524
895 Ga0070668_100025623
896 Ga0070668_100159528
897 Ga0070669_100002323
898 Ga0070669_100359508
899 Ga0070671_100001406
900 Ga0070671_100062717
901 Ga0070671_100200495
902 Ga0070674_100000247
903 Ga0070688_100029253
904 Ga0070688_101588201
905 Ga0070659_100156436
906 Ga0070659_100907020
907 Ga0070667_100000029
908 Ga0070667_100002517
909 Ga0070667_100010190
910 Ga0070667_100039485
911 Ga0070667_100436401
912 Ga0070667_100498879
913 Ga0070667_101750279
914 Ga0070703_10177049
915 Ga0070709_10053591
916 Ga0070709_10534573
917 Ga0070714_100629157
918 Ga0070710_10007180
919 Ga0070710_10007878
920 Ga0070710_10036430
921 Ga0070710_10220597
922 Ga0070701_10015907
923 Ga0070701_10022767
924 Ga0070711_100004483
925 Ga0070711_100020820
926 Ga0070711_100381225
927 Ga0070705_100013796
928 Ga0070700_100005517
929 Ga0070694_100009143
930 Ga0070694_100122497
931 Ga0070663_100009400
932 Ga0070663_100012412
933 Ga0070663_100056713
934 Ga0070663_100712800
935 Ga0070663_100758389
936 Ga0070678_100030608
937 Ga0070678_100368847
938 Ga0070662_100014115
939 Ga0070662_100325385
940 Ga0070662_100662525
941 Ga0070662_100945349
942 Ga0068867_100003486
943 Ga0068867_100058371
944 Ga0070685_10039956
945 Ga0070685_10106072
946 Ga0070685_10126691
947 Ga0070685_10601012
948 Ga0070706_100505156
949 Ga0070684_100132301
950 Ga0068853_100001016
951 Ga0068853_100007472
952 Ga0068853_101299421
953 Ga0070672_100067718
954 Ga0070672_100073361
955 Ga0070686_100396854
956 Ga0070695_100011527
957 Ga0070696_100001192
958 Ga0070696_100019134
959 Ga0070693_100010464
960 Ga0070693_100017637
961 Ga0070665_100007011
962 Ga0070665_100010203
963 Ga0070665_100049031
964 Ga0070665_100248575
965 Ga0070665_100653404
966 Ga0070665_101197184
967 Ga0070665_101414082
968 Ga0070665_101504184
969 Ga0070665_101806159
970 Ga0070704_100003407
971 Ga0070704_100299850
972 Ga0070704_100421300
973 Ga0070664_101964451
974 Ga0068854_100178670
975 Ga0068854_100194791
976 Ga0068854_100368287
977 Ga0068856_100366932
978 Ga0070702_100048118
979 Ga0070702_100442880
980 Ga0068852_100374567
981 Ga0068859_100005413
982 Ga0068859_100075054
983 Ga0068859_100236019
984 Ga0068864_100203265
985 Ga0068866_10011394
986 Ga0068866_10014152
987 Ga0068861_100034771
988 Ga0068861_100999087
989 Ga0068870_10879255
990 Ga0068863_100000120
991 Ga0068863_100003571
992 Ga0068863_101803006
993 Ga0068858_100033226
994 Ga0068858_100037717
995 Ga0068858_100143436
996 Ga0068858_100159965
997 Ga0068858_101728389
998 Ga0068860_100000088
999 Ga0068860_100000994
1000 Ga0068860_100328830
1001 Ga0068860_101344154
1002 Ga0068862_100000056
1003 Ga0068862_100008184
1004 Ga0068862_100418063
1005 Ga0081455_10132666
1006 Ga0081455_10207898
1007 Ga0081455_10737134
1008 Ga0081538_10170455
1009 Ga0075365_10036194
1010 Ga0075365_10126005
1011 Ga0075365_10150787
1012 Ga0075365_10210905
1013 Ga0075365_10336275
1014 Ga0075365_10358656
1015 Ga0075365_11125554
1016 Ga0075368_10084186
1017 Ga0075368_10151785
1018 Ga0075363_100006998
1019 Ga0075363_100007378
1020 Ga0075363_100011078
1021 Ga0075363_100014700
1022 Ga0075363_100021605
1023 Ga0075363_100023915
1024 Ga0075363_100078216
1025 Ga0075363_100106496
1026 Ga0075363_100136745
1027 Ga0075363_100167423
1028 Ga0075363_100275943
1029 Ga0075364_10015620
1030 Ga0075364_10017894
1031 Ga0075364_10022143
1032 Ga0075364_10090410
1033 Ga0075364_10109279
1034 Ga0075364_10162684
1035 Ga0075364_10255102
1036 Ga0075364_10342971
1037 Ga0075364_10382711
1038 Ga0075364_10467399
1039 Ga0075364_10555493
1040 Ga0075364_10629837
1041 Ga0070715_10002914
1042 Ga0070716_100011324
1043 Ga0070716_100017829
1044 Ga0070716_100079418
1045 Ga0070712_100001019
1046 Ga0070712_100002736
1047 Ga0070712_100398620
1048 Ga0075362_10017919
1049 Ga0075362_10047691
1050 Ga0075362_10122555
1051 Ga0075362_10175586
1052 Ga0075362_10318856
1053 Ga0075367_10007201
1054 Ga0075367_10096508
1055 Ga0075369_10000916
1056 Ga0075369_10002820
1057 Ga0075369_10004917
1058 Ga0075369_10009210
1059 Ga0075369_10010128
1060 Ga0075369_10050697
1061 Ga0075369_10055837
1062 Ga0075369_10066553
1063 Ga0075369_10117237
1064 Ga0075369_10334247
1065 Ga0075369_10474380
1066 Ga0075366_10094924
1067 Ga0075366_10341806
1068 Ga0097621_100227724
1069 Ga0097621_100390316
1070 Ga0075370_10003029
1071 Ga0075370_10016337
1072 Ga0075370_10025220
1073 Ga0075370_10123782
1074 Ga0075370_10333897
1075 Ga0068871_100096685
1076 Ga0075428_100176672
1077 Ga0075430_100461243
1078 Ga0075431_100067717
1079 Ga0075434_101931969
1080 Ga0068865_100018103
1081 Ga0068865_100470273
1082 Ga0068865_100993486
1083 Ga0097620_100005413
1084 Ga0097620_100075054
1085 Ga0097620_100236011
1086 Ga0099795_10269403
1087 Ga0105250_10096628
1088 Ga0105250_10432325
1089 Ga0111539_12621995
1090 Ga0111539_12921527
1091 Ga0111539_13480656
1092 Ga0105245_10051678
1093 Ga0105245_10451542
1094 Ga0105245_10596352
1095 Ga0105247_10000008
1096 Ga0105247_10000186
1097 Ga0105247_10077469
1098 Ga0105247_11026253
1099 Ga0105247_11055390
1100 Ga0105247_11112341
1101 Ga0114129_10218060
1102 Ga0105243_10001206
1103 Ga0105243_10321001
1104 Ga0105243_10329365
1105 Ga0105243_12501826
1106 Ga0105243_12992631
1107 Ga0105241_10031781
1108 Ga0105241_10171301
1109 Ga0105242_10001196
1110 Ga0105242_10308325
1111 Ga0105242_11712771
1112 Ga0105248_10000051
1113 Ga0105248_10043948
1114 Ga0105248_10097929
1115 Ga0105248_10133106
1116 Ga0105237_10001908
1117 Ga0105237_10072761
1118 Ga0105237_10579830
1119 Ga0105237_11152121
1120 Ga0105238_10326521
1121 Ga0105238_10573330
1122 Ga0105249_10000040
1123 Ga0105249_10002736
1124 Ga0105249_10053785
1125 Ga0105249_10390140
1126 Ga0105249_10915843
1127 Ga0105249_12617282
1128 Ga0105239_10005473
1129 Ga0105239_10089309
1130 Ga0105239_10195358
1131 Ga0105239_11038205
1132 Ga0105239_11216140
1133 Ga0105246_10067029
1134 Ga0105246_10451973
1135 Ga0105246_11063505
1136 Ga0157369_10115901
1137 Ga0157369_10834264
1138 Ga0157374_10075113
1139 Ga0157374_10243766
1140 Ga0157374_10891576
1141 Ga0157378_10001177
1142 Ga0157378_10870401
1143 Ga0163162_10148647
1144 Ga0163162_10320884
1145 Ga0163162_10382250
1146 Ga0163162_10732903
1147 Ga0163162_10863541
1148 Ga0157372_10023288
1149 Ga0157372_10391649
1150 Ga0157372_11129382
1151 Ga0157372_12917032
1152 Ga0157375_10006977
1153 Ga0157375_10602909
1154 Ga0157375_10888232
1155 Ga0157375_11006061
1156 Ga0163163_10153841
1157 Ga0163163_10339619
1158 Ga0163163_10621280
1159 Ga0163163_10822051
1160 Ga0157380_10013012
1161 Ga0157380_10506600
1162 Ga0157380_11072719
1163 Ga0157377_10203698
1164 Ga0157377_10692154
1165 Ga0157379_10054366
1166 Ga0157379_10480621
1167 Ga0157376_10176099
1168 Ga0157376_10446289
1169 Ga0163161_10011503
1170 Ga0163161_10042112
1171 Ga0163161_10469990
1172 Ga0163161_10881013
1173 Ga0213874_10013533
1174 Ga0213876_10182830
1175 Ga0213875_10025814
1176 Ga0209673_1011534
1177 Ga0209673_1107727
1178 Ga0209025_1093814
1179 Ga0209051_1000034
1180 Ga0209051_1001438
1181 Ga0209051_1010201
1182 Ga0207696_1113253
1183 Ga0207653_10169152
1184 Ga0207692_10073075
1185 Ga0207692_10144687
1186 Ga0207692_10369764
1187 Ga0207642_10004554
1188 Ga0207642_10132887
1189 Ga0207710_10000006
1190 Ga0207710_10004193
1191 Ga0207688_10001999
1192 Ga0207680_10027562
1193 Ga0207680_10482176
1194 Ga0207647_10013619
1195 Ga0207647_10034452
1196 Ga0207685_10001725
1197 Ga0207699_10018940
1198 Ga0207645_10088457
1199 Ga0207643_10153815
1200 Ga0207654_10038655
1201 Ga0207671_10005895
1202 Ga0207671_10304957
1203 Ga0207671_10471434
1204 Ga0207693_10000172
1205 Ga0207693_10005165
1206 Ga0207663_10006921
1207 Ga0207663_10068898
1208 Ga0207663_10144203
1209 Ga0207663_10711758
1210 Ga0207660_10179213
1211 Ga0207660_10411007
1212 Ga0207662_10418659
1213 Ga0207657_10079315
1214 Ga0207649_10577408
1215 Ga0207652_10529588
1216 Ga0207681_10002196
1217 Ga0207681_10217232
1218 Ga0207694_10254445
1219 Ga0207694_10717336
1220 Ga0207687_10016603
1221 Ga0207687_11358726
1222 Ga0207644_10038407
1223 Ga0207644_10879478
1224 Ga0207644_11366941
1225 Ga0207690_10179915
1226 Ga0207690_10196001
1227 Ga0207690_10766804
1228 Ga0207706_10006699
1229 Ga0207706_10015257
1230 Ga0207686_10005979
1231 Ga0207709_10043414
1232 Ga0207709_11047648
1233 Ga0207670_10029249
1234 Ga0207669_10175149
1235 Ga0207669_10266832
1236 Ga0207704_10004705
1237 Ga0207704_10152466
1238 Ga0207665_10014033
1239 Ga0207665_10111155
1240 Ga0207665_10164663
1241 Ga0207691_10094538
1242 Ga0207691_10389569
1243 Ga0207711_10000095
1244 Ga0207711_10037218
1245 Ga0207711_10225730
1246 Ga0207711_10363881
1247 Ga0207689_10520552
1248 Ga0207689_10773289
1249 Ga0207661_10392225
1250 Ga0207712_10000017
1251 Ga0207712_10053789
1252 Ga0207712_10519414
1253 Ga0207712_11386031
1254 Ga0207668_10000524
1255 Ga0207668_10039411
1256 Ga0207668_10078890
1257 Ga0207668_10576907
1258 Ga0207640_10063315
1259 Ga0207640_11194409
1260 Ga0207640_11198653
1261 Ga0207640_11506267
1262 Ga0207658_10000016
1263 Ga0207658_10003613
1264 Ga0207658_10007529
1265 Ga0207658_10062181
1266 Ga0207658_10176182
1267 Ga0207658_10314127
1268 Ga0207658_10593343
1269 Ga0207658_10652038
1270 Ga0207677_10023595
1271 Ga0207677_10428783
1272 Ga0207677_10550546
1273 Ga0207677_11650499
1274 Ga0207703_10076636
1275 Ga0207703_10158199
1276 Ga0207703_10184854
1277 Ga0207703_10338086
1278 Ga0207639_10009642
1279 Ga0207639_10107602
1280 Ga0207639_10175786
1281 Ga0207678_10027200
1282 Ga0207678_10060930
1283 Ga0207678_10098175
1284 Ga0207678_10219081
1285 Ga0207708_10007759
1286 Ga0207708_10027012
1287 Ga0207708_10619293
1288 Ga0207641_10000670
1289 Ga0207641_10065834
1290 Ga0207641_10317554
1291 Ga0207648_10156999
1292 Ga0207648_10299172
1293 Ga0207648_11070261
1294 Ga0207676_11182805
1295 Ga0207676_11821188
1296 Ga0207675_100016784
1297 Ga0207675_100404658
1298 Ga0207683_10001213
1299 Ga0207683_10093476
1300 Ga0207683_10398442
1301 Ga0209813_10178644
1302 Ga0268266_10035003
1303 Ga0268266_10119833
1304 Ga0268266_10327296
1305 Ga0268266_10374491
1306 Ga0268266_10401658
1307 Ga0268265_10000068
1308 Ga0268265_10011543
1309 Ga0268264_10000056
1310 Ga0268264_10005096
1311 Ga0268264_10371029
1312 Ga0268264_10667704
1313 Ga0265327_10000125
1314 Ga0265327_10000954
1315 Ga0265327_10174156
1316 Ga0316576_10088120
1317 Ga0316578_10010569
1318 Ga0316578_10116938
1319 Ga0316577_10103316
1320 Ga0307407_10076157
1321 Ga0307409_100531370
1322 Ga0307415_100469017
1323 Ga0307415_101818013
1324 Ga0373929_0213363
1325 Ga0373949_0284793
1326 Ga0373952_0061977
1327 Ga0373923_0346175
1328 Ga0373932_0095363
1329 Ga0373939_0036345
1330 Ga0373960_0107656
1331 Ga0373955_0621686
1332 Ga0373942_0088345
1333 Ga0316574_0199241
1334 Ga0373935_0526801
1335 Ga0373947_0494263
1336 Ga0316582_0218888
1337 Ga0316584_0011233
1338 Ga0373925_0053561
1339 Ga0373925_1313205
1340 Ga0395900_1615010
1341 Ga0395898_1833038
1342 Ga0436364_0431515
1343 Ga0436364_0893513
1344 Ga0436364_1449180
1345 Ga0436365_0938521
1346 Ga0436365_1123290
1347 Ga0436363_1542843
1348 Ga0436363_1625962
1349 Ga0439461_0018179
1350 Ga0439465_0009767
1351 Ga0439465_0015519
1352 Ga0439465_0043363
1353 Ga0439465_0055575
1354 Ga0451793_0083890
1355 Ga0451793_0389020
1356 Ga0451793_0983776
1357 Ga0451795_1712713
1358 Ga0451800_1544174
1359 Ga0451800_1660493
1360 Ga0451802_0123910
1361 Ga0451802_0341210
1362 Ga0451833_0244844
1363 Ga0451841_0568569
1364 Ga0451843_0189076
1365 Ga0451855_0985586
1366 Ga0451853_0688837
1367 Ga0439431_0014543
1368 Ga0439442_013544
1369 Ga0439445_0015326
1370 Ga0439445_0135111
1371 Ga0439448_0054011
1372 Ga0439434_0002857
1373 Ga0439459_0017821
1374 Ga0466969_0012634
1375 Ga0466972_0032829
1376 Ga0466972_0208745
1377 Ga0466972_0236558
1378 Ga0466972_0343545
1379 Ga0466965_0012902
1380 Ga0466966_0006599
1381 Ga0466966_0111805
1382 Ga0466966_0399532
1383 Ga0466961_0006592
1384 Ga0466961_0351222
1385 Ga0466963_0108745
1386 Ga0466964_0005886
1387 Ga0466971_0175177
1388 Ga0466968_0007473
1389 Ga0466970_0040853
1390 Ga0466970_0067348
1391 Ga0466957_0001193
1392 Ga0466957_0035946
1393 Ga0466960_0000854
1394 Ga0466960_0032106
1395 Ga0466960_0682047
1396 Ga0466959_0062006
1397 Ga0466959_0084423
1398 Ga0466958_0007115
1399 Ga0466958_0112050
1400 Ga0466967_0074954
1401 Ga0466967_0118858
1402 Ga0466967_0286744
1403 Ga0466967_0381839
1404 Ga0466967_0534430
1405 Ga0466967_0646684
1406 Ga0466967_0755456
1407 Ga0466967_1070563
1408 Ga0466967_1790633
1409 Ga0495603_0269028
1410 Ga0495590_0163153
1411 Ga0495590_0180698
1412 Ga0495629_0021920
1413 Ga0495638_0063695
1414 Ga0495582_0057986
1415 Ga0495582_0086225
1416 Ga0495639_0383455
1417 Ga0495662_0323082
1418 Ga0495583_0105709
1419 Ga0495606_0039160
1420 Ga0495620_0225414
1421 Ga0495630_0312127
1422 Ga0495632_0261388
1423 Ga0495648_0002641
1424 Ga0495654_0032747
1425 Ga0495665_0002660
1426 Ga0495640_0028474
1427 Ga0495668_0016376
1428 Ga0495668_0642163
1429 Ga0495611_0026174
1430 Ga0495635_0032138
1431 Ga0495635_0087185
1432 Ga0495588_0446443
1433 Ga0495658_0167946
1434 Ga0495670_0430530
1435 Ga0495649_0028756
1436 Ga0495649_0081149
1437 Ga0495649_0203032
1438 Ga0495649_0543124
1439 Ga0495581_0178864
1440 Ga0495672_0006644
1441 Ga0495672_0143281
1442 Ga0495672_0185629
1443 Ga0495672_0278171
1444 Ga0495672_0395761
1445 Ga0495673_0004474
1446 Ga0495686_0003415
1447 Ga0495686_0487065
1448 Ga0495593_0045183
1449 Ga0496100_0000201
1450 Ga0496100_0000801
1451 Ga0496100_0000951
1452 Ga0496100_0004830
1453 Ga0496100_0063818
1454 Ga0496100_0084745
1455 Ga0496100_0273035
1456 Ga0496100_0447005
1457 Ga0496100_0466409
1458 Ga0496100_0536209
1459 Ga0496100_0731130
1460 Ga0496101_0000115
1461 Ga0496101_0000167
1462 Ga0496101_0007954
1463 Ga0496101_0013614
1464 Ga0496101_0018577
1465 Ga0496101_0344366
1466 Ga0496101_0344776
1467 Ga0496101_0417023
1468 Ga0496101_0655357
1469 Ga0496102_0000009
1470 Ga0496102_0000274
1471 Ga0496102_0001208
1472 Ga0496102_0051718
1473 Ga0496102_0105833
1474 Ga0496102_0115765
1475 Ga0496102_0173300
1476 Ga0496102_0294308
1477 Ga0496102_0376593
1478 Ga0496102_0599642
1479 Ga0496103_0000051
1480 Ga0496103_0000288
1481 Ga0496103_0000858
1482 Ga0496103_0002248
1483 Ga0496103_0085512
1484 Ga0496104_0008927
1485 Ga0496104_0475943
1486 Ga0496104_1082599
1487 Ga0496105_0010964
1488 Ga0496105_0496606
1489 Ga0496105_1019571
1490 Ga0496106_0001133
1491 Ga0496106_0005821
1492 Ga0496106_0007827
1493 Ga0496106_0017521
1494 Ga0496106_0243335
1495 Ga0496106_0309025
1496 Ga0496106_0742445
1497 Ga0496107_0001733
1498 Ga0496107_0002511
1499 Ga0496107_0023543
1500 Ga0496107_0054563
1501 Ga0496107_0069886
1502 Ga0496107_0097471
1503 Ga0496107_0163844
1504 Ga0496107_0959574
1505 Ga0496108_0007595
1506 Ga0496108_0164014
1507 Ga0496108_0197636
1508 Ga0496109_0000213
1509 Ga0496109_0020271
1510 Ga0496109_0097489
1511 Ga0496109_0156818
1512 Ga0496109_0546754
1513 Ga0496110_0003827
1514 Ga0496110_0054778
1515 Ga0496110_0138331
1516 Ga0496110_0170213
1517 Ga0496110_0480096
1518 Ga0496110_0835326
1519 Ga0496110_1806913
1520 Ga0496111_0001874
1521 Ga0496111_0277025
1522 Ga0496111_0867684
1523 Ga0496112_0003640
1524 Ga0496112_0043057
1525 Ga0496112_0193615
1526 Ga0496112_0382098
1527 Ga0496112_0437518
1528 Ga0496112_0602545
1529 Ga0496113_0038192
1530 Ga0496113_0117035
1531 Ga0496113_0404772
1532 Ga0496114_0001210
1533 Ga0496114_0001402
1534 Ga0496114_0007733
1535 Ga0496114_0166962
1536 Ga0496114_0168397
1537 Ga0496114_0348844
1538 Ga0496114_0926726
1539 Ga0496115_0006966
1540 Ga0496115_0017756
1541 Ga0496115_0020890
1542 Ga0496115_0046028
1543 Ga0496115_0319665
1544 Ga0496115_0826542
1545 Ga0496116_0000141
1546 Ga0496116_0004338
1547 Ga0496116_0044981
1548 Ga0496117_0000019
1549 Ga0496117_0000631
1550 Ga0496117_0008374
1551 Ga0496117_0152839
1552 Ga0496118_0000020
1553 Ga0496118_0053305
1554 Ga0496118_0074375
1555 Ga0496118_0181385
1556 Ga0496118_0267419
1557 Ga0496119_0006223
1558 Ga0496119_0011207
1559 Ga0496119_0019498
1560 Ga0496119_0040044
1561 Ga0496119_0073112
1562 Ga0496120_0005805
1563 Ga0496120_0008927
1564 Ga0496120_0062749
1565 Ga0496121_0000002
1566 Ga0496121_0000510
1567 Ga0496121_0002244
1568 Ga0496122_0000639
1569 Ga0496122_0001930
1570 Ga0496122_0087761
1571 Ga0496123_0071046
1572 Ga0496124_0000002
1573 Ga0496124_0429479
1574 Ga0496125_0000002
1575 Ga0496125_0000066
1576 Ga0496125_0021763
1577 Ga0496125_0208245
1578 Ga0496125_0377640
1579 Ga0496125_0384178
1580 Ga0496126_0000009
1581 Ga0496126_0006902
1582 Ga0496126_0019767
1583 Ga0496126_0029306
1584 Ga0496126_0033215
1585 Ga0496126_0293454
1586 Ga0501032_0013304
1587 Ga0501033_0087619
1588 Ga0501034_0011255
1589 Ga0501034_0092023
1590 Ga0501034_0241556
1591 Ga0501034_0445584
1592 Ga0501036_0262880
1593 Ga0501037_0002187
1594 Ga0501038_0079087
1595 Ga0501039_0000790
1596 Ga0501043_0001034
1597 Ga0501046_0673657
1598 Ga0501047_0216510
1599 Ga0501048_0660854
1600 Ga0501067_0091648
1601 Ga0501070_0002430
1602 Ga0501070_0164172
1603 Ga0501071_0679032
1604 Ga0501072_1054124
1605 Ga0501077_0476989
1606 Ga0501080_0144555
1607 Ga0501083_1107743
1608 Ga0501035_0000121
1609 Ga0501044_0016394
1610 Ga0501044_0295462
1611 nmdc:mga03683_110883_c1
1612 nmdc:mga03683_14418_c1
1613 nmdc:mga03683_311136_c1
1614 nmdc:mga03683_4882_c2
1615 nmdc:mga03683_68738_c1
1616 nmdc:mga03n38_11240_c1
1617 nmdc:mga03n38_147715_c1
1618 nmdc:mga03n38_159670_c1
1619 nmdc:mga03n38_20150_c1
1620 nmdc:mga03n38_21173_c1
1621 nmdc:mga03n38_211972_c1
1622 nmdc:mga03n38_23444_c1
1623 nmdc:mga03n38_25970_c1
1624 nmdc:mga03n38_72749_c1
1625 nmdc:mga03n38_797200_c1
1626 nmdc:mga03n38_853081_c1
1627 nmdc:mga00v17_1034920_c1
1628 nmdc:mga00v17_118596_c1
1629 nmdc:mga00v17_14374_c1
1630 nmdc:mga00v17_212183_c1
1631 nmdc:mga00v17_24256_c1
1632 nmdc:mga00v17_289882_c1
1633 nmdc:mga00v17_338581_c1
1634 nmdc:mga00v17_4100_c1
1635 nmdc:mga00v17_426952_c1
1636 nmdc:mga00v17_465057_c1
1637 nmdc:mga00v17_470480_c1
1638 nmdc:mga00v17_551994_c1
1639 nmdc:mga00v17_58396_c1
1640 nmdc:mga00v17_7528_c1
1641 nmdc:mga00v17_85269_c1
1642 nmdc:mga0yw44_100062_c1
1643 nmdc:mga0yw44_1134989_c1
1644 nmdc:mga0yw44_132791_c1
1645 nmdc:mga0yw44_304606_c1
1646 nmdc:mga0yw44_40430_c1
1647 nmdc:mga0yw44_4348_c1
1648 nmdc:mga0yw44_5308_c1
1649 nmdc:mga0yw44_543128_c1
1650 nmdc:mga0yw44_97623_c1
1651 nmdc:mga0k408_350474_c1
1652 nmdc:mga0k408_370215_c1
1653 nmdc:mga0k408_43052_c1
1654 nmdc:mga06z11_137593_c1
1655 nmdc:mga06z11_29136_c1
1656 nmdc:mga06z11_409391_c1
1657 nmdc:mga06z11_740209_c1
1658 nmdc:mga04h51_125173_c1
1659 nmdc:mga04h51_98857_c1
1660 nmdc:mga07m45_11220_c1
1661 nmdc:mga07m45_180684_c1
1662 nmdc:mga07m45_18588_c1
1663 nmdc:mga07m45_342_c1
1664 nmdc:mga07m45_88637_c1
1665 nmdc:mga05p37_70878_c1
1666 nmdc:mga09592_1024478_c1
1667 nmdc:mga0qj67_366012_c1
1668 nmdc:mga06r32_24981_c1
1669 nmdc:mga08y16_2139980_c1
1670 nmdc:mga08x19_739864_c1
1671 nmdc:mga0sz30_112848_c1
1672 nmdc:mga0sz30_136076_c1
1673 nmdc:mga0sz30_1522_c1
1674 nmdc:mga0sz30_255888_c1
1675 nmdc:mga0sz30_273888_c1
1676 nmdc:mga0sz30_294083_c1
1677 nmdc:mga0sz30_3041_c1
1678 nmdc:mga0sz30_3402_c1
1679 nmdc:mga0sz30_37862_c1
1680 nmdc:mga0sz30_4050_c1
1681 nmdc:mga0sz30_429065_c1
1682 nmdc:mga0sz30_44584_c1
1683 nmdc:mga0sz30_53050_c1
1684 nmdc:mga0sz30_57197_c2
1685 Ga0495655_0009523
1686 Ga0495655_0103057
1687 Ga0495619_0062029
1688 Ga0500556_0032165
1689 Ga0500562_111639
1690 Ga0500652_001800
1691 Ga0500561_0005532
1692 Ga0500568_0146031
1693 Ga0500588_0216471
1694 Ga0500616_0020249
1695 Ga0500616_0117216
1696 Ga0500620_116666
1697 Ga0500620_138596
1698 Ga0500645_000163
1699 Ga0466962_0042818
1700 Ga0466962_0338141
1701 2644487437
1702 2644639041
1703 2738665693
1704 2739144827
1705 2744957828
1706 2842135231
1707 2902794337
1708 2902839534
1709 2929213056
1710 2939587175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

26

142

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fsx-assembly1.cif.gz_A crystal structure of rv0390 from m. tuberculosis 0.955 2 137
2fsx-assembly1.cif.gz_A crystal structure of rv0390 from m. tuberculosis 0.948 2 137
2dcq-assembly1.cif.gz_A fully automated nmr structure determination of the rhodanese homology domain at4g01050(175-295) from arabidopsis thaliana 0.8782 1 136
1vee-assembly1.cif.gz_A nmr structure of the hypothetical rhodanese domain at4g01050 from arabidopsis thaliana 0.8495 1 135
3hix-assembly3.cif.gz_C crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.842 23 135
ID Description Score Start End Superfamily
2fsxA00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.955 2 137 3.40.250.10
2fsxA00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.948 2 137 3.40.250.10
af_Q56XR7_117_240_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9109 6 130 3.40.250.10
af_Q9M158_129_260_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8805 5 135 3.40.250.10
af_Q38853_56_181_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8352 2 135 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A4R8SHE4-F1-model_v4 Rhodanese domain-containing protein 0.9812 2 137
AF-A0A1S1KW04-F1-model_v4 Rhodanese-like domain-containing protein (Sulfurtransferase) 0.9807 1 137 GO:0016740
AF-A0A7Y2W1V1-F1-model_v4 deleted 0.975 3 137
AF-A0A1S1KW04-F1-model_v4 Rhodanese-like domain-containing protein (Sulfurtransferase) 0.9737 1 137 GO:0016740
AF-A0A1I0T5R9-F1-model_v4 Rhodanese-related sulfurtransferase 0.9694 3 137 GO:0016740

Map