F483605

General Info

Members Datasets Scaffolds Average Seq Length
855 665 1710 178

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10041145|JGI25153J46596_100411452
Length 181
Sequence MVKLLLTGLWVCIVTLGAVYFAVQMSAAPAPVDEAARRKELLELVRGESITIPMIADGAITGYFLSRVSFMMDKEKIKNTKLPITELTTDELFTLLIGNRMVDLSKPGAFDIEKFRTSIKDDFNKKLGDGLVAEVLVEQLDYLSKEDIRNNASRGNKNPNPGKKIVEGVKIEDPKAAPAGH

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
40 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
44 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
45 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
46 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
47 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
48 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
49 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
50 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
73 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
85 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
86 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
87 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
88 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
89 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
92 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
93 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
94 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
95 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
96 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
97 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
98 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
99 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
100 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
101 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
102 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
103 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
104 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
105 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
178 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
179 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
180 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
181 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
182 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
185 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
189 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
190 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
191 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
192 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
193 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
196 2509276019 Ensifer aridi TW10 Isolate Nodule
197 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
198 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
199 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
200 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
201 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
202 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
203 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
204 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
205 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
206 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
207 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
208 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
209 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
210 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
211 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
212 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
213 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
214 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
215 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
216 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
217 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
218 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
219 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
220 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
221 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
222 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
223 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
224 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
225 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
226 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
227 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
228 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
229 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
230 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
231 2516143018 Ensifer sp. BR816 Isolate Nodule
232 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
233 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
234 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
235 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
236 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
237 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
238 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
239 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
240 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
241 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
242 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
243 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
244 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
245 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
246 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
247 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
248 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
249 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
250 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
251 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
252 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
253 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
254 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
255 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
256 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
257 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
258 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
259 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
260 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
261 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
262 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
263 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
264 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
265 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
266 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
267 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
268 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
269 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
270 2643221557 Ensifer sp. Root558 Isolate Unclassified
271 2643221558 Rhizobium sp. Root149 Isolate Unclassified
272 2643221599 Rhizobium sp. Root708 Isolate Unclassified
273 2643221607 Rhizobium sp. Root73 Isolate Unclassified
274 2643221610 Ensifer sp. Root74 Isolate Unclassified
275 2643221618 Ensifer sp. Root231 Isolate Unclassified
276 2643221626 Ensifer sp. Root31 Isolate Unclassified
277 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
278 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
279 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
280 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
281 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
282 2643221655 Ensifer sp. Root1252 Isolate Unclassified
283 2643221659 Ensifer sp. Root127 Isolate Unclassified
284 2643221668 Ensifer sp. Root423 Isolate Unclassified
285 2643221675 Ensifer sp. Root1298 Isolate Unclassified
286 2643221680 Ensifer sp. Root1312 Isolate Unclassified
287 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
288 2643221688 Rhizobium sp. Root482 Isolate Unclassified
289 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
290 2643221698 Ensifer sp. Root142 Isolate Unclassified
291 2643221712 Ensifer sp. Root258 Isolate Unclassified
292 2643221718 Rhizobium sp. Root268 Isolate Unclassified
293 2643221719 Rhizobium sp. Root274 Isolate Unclassified
294 2643221723 Ensifer sp. Root278 Isolate Unclassified
295 2643221726 Ensifer sp. Root954 Isolate Unclassified
296 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
297 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
298 2718217882 Rhizobium sp. N741 Isolate Nodule
299 2718217927 Rhizobium sp. N324 Isolate Nodule
300 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
301 2718218009 Rhizobium sp. N561 Isolate Nodule
302 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
303 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
304 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
305 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
306 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
307 2718218363 Rhizobium sp. N113 Isolate Nodule
308 2718218365 Rhizobium sp. N731 Isolate Nodule
309 2718218366 Rhizobium sp. N621 Isolate Nodule
310 2718218423 Rhizobium sp. N941 Isolate Nodule
311 2721755514 Rhizobium sp. N6212 Isolate Nodule
312 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
313 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
314 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
315 2721755809 Rhizobium sp. N541 Isolate Nodule
316 2721755810 Rhizobium sp. N871 Isolate Nodule
317 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
318 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
319 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
320 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
321 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
322 2728369365 Rhizobium sp. N1341 Isolate Nodule
323 2728369397 Rhizobium sp. N1314 Isolate Nodule
324 2738541293 Rhizobium sp. GV031 Isolate Unclassified
325 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
326 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
327 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
328 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
329 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
330 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
331 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
332 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
333 2791355256 Rhizobium sp. M10 Isolate Nodule
334 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
335 2791355260 Rhizobium sp. L9 Isolate Nodule
336 2791355261 Rhizobium sp. J15 Isolate Nodule
337 2791355262 Rhizobium sp. M1 Isolate Nodule
338 2791355263 Rhizobium chutanense C5 Isolate Nodule
339 2791355264 Rhizobium sp. S9 Isolate Nodule
340 2791355265 Rhizobium sp. H4 Isolate Nodule
341 2791355266 Rhizobium sp. L43 Isolate Nodule
342 2791355267 Rhizobium sp. L18 Isolate Nodule
343 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
344 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
345 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
346 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
347 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
348 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
349 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
350 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
351 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
352 2802429633 Rhizobium anhuiense J3 Isolate Nodule
353 2802429634 Rhizobium anhuiense S10 Isolate Nodule
354 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
355 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
356 2802429637 Rhizobium anhuiense C15 Isolate Nodule
357 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
358 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
359 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
360 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
361 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
362 2838048938 Rhizobium pisi 27/80 Isolate Nodule
363 2838061910 Rhizobium phaseoli L15 Isolate Nodule
364 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
365 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
366 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
367 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
368 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
369 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
370 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
371 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
372 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
373 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
374 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
375 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
376 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
377 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
378 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
379 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
380 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
381 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
382 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
383 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
384 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
385 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
386 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
387 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
388 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
389 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
390 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
391 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
392 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
393 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
394 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
395 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
396 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
397 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
398 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
399 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
400 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
401 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
402 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
403 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
404 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
405 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
406 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
407 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
408 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
409 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
410 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
411 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
412 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
413 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
414 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
415 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
416 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
417 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
418 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
419 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
420 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
421 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
422 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
423 2844163670 Ensifer sp. 1H6 Isolate Unclassified
424 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
425 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
426 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
427 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
428 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
429 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
430 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
431 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
432 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
433 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
434 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
435 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
436 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
437 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
438 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
439 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
440 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
441 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
442 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
443 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
444 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
445 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
446 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
447 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
448 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
449 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
450 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
451 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
452 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
453 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
454 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
455 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
456 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
457 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
458 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
459 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
460 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
461 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
462 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
463 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
464 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
465 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
466 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
467 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
468 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
469 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
470 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
471 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
472 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
473 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
474 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
475 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
476 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
477 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
478 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
479 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
480 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
481 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
482 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
483 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
484 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
485 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
486 2933599457 Rhizobium phaseoli M3 Isolate Nodule
487 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
488 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
489 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
490 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
491 2936381700 Rhizobium chutanense C16 Isolate Unclassified
492 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
493 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
494 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
495 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
496 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
497 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
498 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
499 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
500 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
501 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
502 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
503 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
504 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
505 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
506 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
507 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
508 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
509 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
510 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
511 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
512 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
513 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
514 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
515 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
516 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
517 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
518 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
519 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
520 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
521 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
522 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
523 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
524 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
525 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
526 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
527 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
528 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
529 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
530 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
531 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
532 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
533 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
534 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
535 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
536 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
537 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
538 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
539 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
540 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
541 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
542 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
543 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
544 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
545 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
546 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
547 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
548 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
549 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
550 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
551 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
552 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
553 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
554 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
555 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
556 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
557 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
558 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
559 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
560 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
561 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
562 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
563 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
564 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
565 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
566 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
567 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
568 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
569 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
570 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
571 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
572 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
573 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
574 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
575 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
576 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
577 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
578 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
579 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
580 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
581 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
582 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
583 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
584 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
585 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
586 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
587 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
588 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
589 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
590 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
591 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
592 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
593 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
594 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
595 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
596 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
597 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
598 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
599 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
600 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
601 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
602 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
603 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
604 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
605 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
606 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
607 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
608 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
609 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
610 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
611 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
612 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
613 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
614 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
615 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
616 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
617 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
618 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
619 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
620 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
621 2996887358 Rhizobium sp. R711 Isolate Nodule
622 2996893221 Rhizobium sp. R635 Isolate Nodule
623 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
624 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
625 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
626 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
627 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
628 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
629 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
630 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
631 8005258706 Rhizobium sp. R693 Isolate Nodule
632 8005275841 Rhizobium sp. N4311 Isolate Nodule
633 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
634 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
635 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
636 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
637 8005321885 Rhizobium sp. R72 Isolate Nodule
638 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
639 8005382845 Rhizobium sp. R634 Isolate Nodule
640 8005395548 Rhizobium sp. R339 Isolate Nodule
641 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
642 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
643 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
644 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
645 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
646 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
647 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
648 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
649 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
650 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
651 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
652 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
653 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
654 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
655 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
656 8018176218 Rhizobium sp. N122 Isolate Nodule
657 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
658 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
659 8024501048 Rhizobium sp. H4 Isolate Nodule
660 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
661 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
662 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
663 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
664 8056382006 Rhizobium croatiense 13T Isolate Nodule
665 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.68
Metatranscriptomes 0.23
Isolates 55.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.47
Nodule 46.43
Rhizoplane 1.52
Rhizosphere 17.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10041145 3300003215 Bacteria 1425
2 JGI25158J39367_1000337 3300002739 Bacteria 10344
3 JGI25152J39213_1000622 3300002773 Bacteria 18865
4 JGI25152J39213_1001653 3300002773 Bacteria 9283
5 JGI25152J39213_1002790 3300002773 Bacteria 6316
6 JGI25152J39213_1004728 3300002773 Bacteria 4203
7 JGI25152J39213_1005519 3300002773 Bacteria 3661
8 JGI25152J39213_1017826 3300002773 Bacteria 1328
9 JGI25150J39212_1000012 3300002774 Bacteria 182468
10 JGI25150J39212_1004398 3300002774 Bacteria 3138
11 JGI25159J45721_1000016 3300002987 Bacteria 139656
12 JGI25159J45721_1000234 3300002987 Bacteria 26222
13 JGI25151J46595_10000025 3300003187 Bacteria 213302
14 JGI25151J46595_10000346 3300003187 Bacteria 49745
15 JGI25151J46595_10001380 3300003187 Bacteria 16763
16 JGI25151J46595_10009441 3300003187 Bacteria 4617
17 JGI25151J46595_10018819 3300003187 Bacteria 2952
18 JGI25153J46596_10002170 3300003215 Bacteria 11459
19 JGI25153J46596_10005707 3300003215 Bacteria 6490
20 JGI25153J46596_10005987 3300003215 Bacteria 6255
21 JGI25153J46596_10010429 3300003215 Bacteria 4203
22 JGI25153J46596_10012490 3300003215 Bacteria 3661
23 rootH1_10066558 3300003316 Bacteria 1460
24 rootH2_10250578 3300003320 Bacteria 1644
25 rootL2_10244022 3300003322 Bacteria 1057
26 rootL2_10351773 3300003322 Bacteria 1149
27 rootH1_10119258 3300003323 Bacteria 5237
28 rootH1_10170722 3300003323 Bacteria 3196
29 JGI25160J50197_1000002 3300003354 Bacteria 561707
30 JGI25160J50197_1002495 3300003354 Bacteria 8555
31 JGI25160J50197_1007334 3300003354 Bacteria 4331
32 JGI25161J50226_1000382 3300003374 Bacteria 22288
33 JGI25161J50226_1003195 3300003374 Bacteria 3860
34 Ga0055526_1000624 3300003771 Bacteria 27522
35 Ga0055526_1004061 3300003771 Bacteria 8979
36 Ga0055526_1009033 3300003771 Bacteria 4866
37 Ga0055526_1012412 3300003771 Bacteria 3720
38 Ga0055524_1002525 3300003775 Bacteria 9378
39 Ga0055524_1002822 3300003775 Bacteria 8728
40 Ga0055524_1015211 3300003775 Bacteria 2816
41 Ga0055536_1013337 3300003781 Bacteria 2977
42 Ga0055528_1001607 3300003790 Bacteria 13359
43 Ga0055528_1004149 3300003790 Bacteria 7057
44 Ga0055528_1004778 3300003790 Bacteria 6450
45 Ga0055528_1014048 3300003790 Bacteria 2989
46 Ga0055528_1014392 3300003790 Bacteria 2928
47 Ga0055528_1035253 3300003790 Bacteria 1218
48 Ga0055530_10033657 3300003791 Bacteria 1319
49 Ga0055540_1001619 3300003792 Bacteria 13110
50 Ga0055540_1001855 3300003792 Bacteria 11904
51 Ga0055540_1002138 3300003792 Bacteria 10768
52 Ga0055540_1031798 3300003792 Bacteria 1210
53 Ga0055531_10001338 3300003794 Bacteria 18408
54 Ga0055531_10023875 3300003794 Bacteria 2275
55 Ga0055543_1000022 3300004625 Bacteria 140745
56 Ga0055543_1000141 3300004625 Bacteria 60055
57 Ga0065165_1000058 3300005262 Bacteria 184784
58 Ga0065165_1006213 3300005262 Bacteria 6366
59 Ga0065165_1010889 3300005262 Bacteria 3868
60 Ga0070682_100285154 3300005337 Bacteria 1205
61 Ga0070668_100343485 3300005347 Bacteria 1262
62 Ga0070669_100023818 3300005353 Bacteria 4387
63 Ga0070671_100028688 3300005355 Bacteria 4585
64 Ga0070665_100173561 3300005548 Bacteria 2157
65 Ga0070665_100654362 3300005548 Bacteria 1064
66 Ga0068864_101831559 3300005618 Bacteria 612
67 Ga0075365_10006954 3300006038 Bacteria 6286
68 Ga0075363_100212864 3300006048 Bacteria 1106
69 Ga0075364_10011216 3300006051 Bacteria 5441
70 Ga0075362_10290957 3300006177 Bacteria 809
71 Ga0075367_10011574 3300006178 Bacteria 4675
72 Ga0075367_10123788 3300006178 Bacteria 1595
73 Ga0075367_10146287 3300006178 Bacteria 1466
74 Ga0075367_10607132 3300006178 Bacteria 695
75 Ga0075369_10068494 3300006186 Bacteria 1560
76 Ga0075369_10172895 3300006186 Bacteria 992
77 Ga0075366_10251777 3300006195 Bacteria 1077
78 Ga0075370_10033361 3300006353 Bacteria 2882
79 Ga0079104_1002673 3300006946 Bacteria 9205
80 Ga0079104_1002890 3300006946 Bacteria 8573
81 Ga0105238_10908930 3300009551 Bacteria 899
82 Ga0105249_10179949 3300009553 Bacteria 2056
83 Ga0123341_1000192 3300009765 Bacteria 31290
84 Ga0123342_1011318 3300009766 Bacteria 9808
85 Ga0123342_1032521 3300009766 Bacteria 2438
86 Ga0105239_10294577 3300010375 Bacteria 1827
87 Ga0105246_10109562 3300011119 Bacteria 2026
88 Ga0157322_1006393 3300012490 Bacteria 842
89 Ga0171463_1001 3300013249 Bacteria 1406070
90 Ga0183363_1012 3300015690 Bacteria 90054
91 Ga0214544_1000012 3300021320 Bacteria 229808
92 Ga0214542_1000011 3300021321 Bacteria 238260
93 Ga0214543_1000004 3300021327 Bacteria 527190
94 Ga0214543_1000256 3300021327 Bacteria 82084
95 Ga0228711_1000019 3300022739 Bacteria 111795
96 Ga0228710_1000022 3300022740 Bacteria 111795
97 Ga0209436_100051 3300025208 Bacteria 64359
98 Ga0209436_100142 3300025208 Bacteria 34468
99 Ga0207425_1000012 3300025245 Bacteria 528324
100 Ga0207425_1004637 3300025245 Bacteria 4071
101 Ga0207425_1005834 3300025245 Bacteria 3449
102 Ga0207425_1008001 3300025245 Bacteria 2741
103 Ga0209129_1000081 3300025258 Bacteria 183694
104 Ga0209129_1000545 3300025258 Bacteria 26086
105 Ga0209129_1001854 3300025258 Bacteria 11184
106 Ga0209129_1002362 3300025258 Bacteria 9314
107 Ga0209129_1005076 3300025258 Bacteria 4829
108 Ga0209129_1005100 3300025258 Bacteria 4814
109 Ga0209129_1009094 3300025258 Bacteria 2667
110 Ga0209565_1017257 3300025263 Bacteria 1586
111 Ga0209673_1000704 3300025273 Bacteria 47438
112 Ga0209673_1000999 3300025273 Bacteria 34430
113 Ga0209673_1001226 3300025273 Bacteria 27049
114 Ga0209673_1001868 3300025273 Bacteria 17068
115 Ga0209673_1002467 3300025273 Bacteria 12788
116 Ga0209673_1005127 3300025273 Bacteria 6709
117 Ga0209673_1034978 3300025273 Bacteria 1510
118 Ga0209673_1050436 3300025273 Bacteria 1105
119 Ga0209130_1000002 3300025284 Bacteria 722648
120 Ga0209130_1000008 3300025284 Bacteria 581232
121 Ga0209130_1029041 3300025284 Bacteria 1156
122 Ga0209676_1004653 3300025292 Bacteria 7538
123 Ga0209676_1008588 3300025292 Bacteria 4530
124 Ga0209025_1000024 3300025294 Bacteria 528324
125 Ga0209025_1000631 3300025294 Bacteria 62429
126 Ga0209025_1000970 3300025294 Bacteria 43006
127 Ga0209025_1008764 3300025294 Bacteria 7200
128 Ga0209025_1009867 3300025294 Bacteria 6572
129 Ga0209025_1039413 3300025294 Bacteria 2060
130 Ga0209025_1140551 3300025294 Bacteria 684
131 Ga0209564_1000091 3300025295 Bacteria 249103
132 Ga0209564_1000382 3300025295 Bacteria 81070
133 Ga0209564_1000576 3300025295 Bacteria 58256
134 Ga0209564_1000811 3300025295 Bacteria 42680
135 Ga0209564_1026253 3300025295 Bacteria 1930
136 Ga0209758_1000046 3300025297 Bacteria 364931
137 Ga0209758_1000349 3300025297 Bacteria 84164
138 Ga0209758_1000575 3300025297 Bacteria 57471
139 Ga0209758_1001043 3300025297 Bacteria 36278
140 Ga0209758_1001705 3300025297 Bacteria 24677
141 Ga0209758_1003657 3300025297 Bacteria 13703
142 Ga0209758_1005259 3300025297 Bacteria 10125
143 Ga0209758_1007186 3300025297 Bacteria 7677
144 Ga0209758_1113169 3300025297 Bacteria 747
145 Ga0209050_1010411 3300025298 Bacteria 4590
146 Ga0209050_1013811 3300025298 Bacteria 3547
147 Ga0209256_1000180 3300025299 Bacteria 123687
148 Ga0209256_1000541 3300025299 Bacteria 54431
149 Ga0209256_1002684 3300025299 Bacteria 13946
150 Ga0209256_1002790 3300025299 Bacteria 13386
151 Ga0209256_1006334 3300025299 Bacteria 6318
152 Ga0209256_1007071 3300025299 Bacteria 5674
153 Ga0209256_1015202 3300025299 Bacteria 2708
154 Ga0209256_1082927 3300025299 Bacteria 697
155 Ga0207426_1000013 3300025302 Bacteria 721897
156 Ga0207426_1000016 3300025302 Bacteria 581232
157 Ga0207426_1000063 3300025302 Bacteria 358920
158 Ga0207426_1000172 3300025302 Bacteria 163690
159 Ga0207426_1001476 3300025302 Bacteria 19329
160 Ga0209051_1000084 3300025303 Bacteria 190324
161 Ga0209051_1002292 3300025303 Bacteria 13969
162 Ga0209051_1002483 3300025303 Bacteria 13165
163 Ga0209051_1013199 3300025303 Bacteria 3946
164 Ga0209051_1025349 3300025303 Bacteria 2415
165 Ga0209051_1030757 3300025303 Bacteria 2078
166 Ga0209257_1003740 3300025304 Bacteria 12615
167 Ga0209257_1008498 3300025304 Bacteria 5816
168 Ga0209257_1011440 3300025304 Bacteria 4271
169 Ga0209257_1011610 3300025304 Bacteria 4213
170 Ga0209257_1024523 3300025304 Bacteria 2086
171 Ga0207681_10092022 3300025923 Bacteria 2167
172 Ga0207694_11138027 3300025924 Bacteria 660
173 Ga0207644_10245743 3300025931 Bacteria 1426
174 Ga0207712_10258878 3300025961 Bacteria 1410
175 Ga0207668_10428012 3300025972 Bacteria 1125
176 Ga0207678_10258272 3300026067 Bacteria 1493
177 Ga0209281_1000192 3300027111 Bacteria 140252
178 Ga0209281_1000200 3300027111 Bacteria 135685
179 Ga0209281_1000227 3300027111 Bacteria 119329
180 Ga0209282_1000042 3300027666 Bacteria 119329
181 Ga0268266_10141407 3300028379 Bacteria 2160
182 Ga0268266_10977481 3300028379 Bacteria 819
183 Ga0307515_10000023 3300028794 Bacteria 400846
184 Ga0307513_10001791 3300031456 Bacteria 30530
185 Ga0307513_10048998 3300031456 Bacteria 4579
186 Ga0307408_100097451 3300031548 Bacteria 2234
187 Ga0307405_10002493 3300031731 Bacteria 8135
188 Ga0307405_10167101 3300031731 Bacteria 1565
189 Ga0307405_10200073 3300031731 Bacteria 1450
190 Ga0307405_10627506 3300031731 Bacteria 881
191 Ga0307406_10231026 3300031901 Bacteria 1381
192 Ga0307412_10034792 3300031911 Bacteria 3213
193 Ga0307412_11191914 3300031911 Bacteria 681
194 Ga0315914_1000009 3300031967 Bacteria 182444
195 Ga0307409_100693090 3300031995 Bacteria 1017
196 Ga0307414_10033827 3300032004 Bacteria 3382
197 Ga0315913_1000015 3300033430 Bacteria 119325
198 Ga0315915_1000013 3300033464 Bacteria 182438
199 Ga0439436_0005341 3300041404 Bacteria 3940
200 Ga0439465_0002635 3300041413 Bacteria 5860
201 Ga0439465_0026178 3300041413 Bacteria 1843
202 Ga0439465_0193343 3300041413 Bacteria 739
203 Ga0451787_118315 3300041441 Bacteria 769
204 Ga0451789_1135835 3300041443 Bacteria 514
205 Ga0451791_0704102 3300041451 Bacteria 1395
206 Ga0451793_0629204 3300041452 Bacteria 3152
207 Ga0451795_0904357 3300041456 Bacteria 1098
208 Ga0451804_0896021 3300041463 Bacteria 1576
209 Ga0451833_0730851 3300041491 Bacteria 835
210 Ga0451835_1216422 3300041492 Bacteria 780
211 Ga0451841_1050487 3300041498 Bacteria 730
212 Ga0451846_65326 3300041502 Bacteria 657
213 Ga0451847_0593829 3300041503 Bacteria 917
214 Ga0451850_44672 3300041506 Bacteria 529
215 Ga0451851_1210286 3300041507 Bacteria 949
216 Ga0439452_042525 3300042010 Bacteria 1064
217 Ga0439462_0036507 3300042015 Bacteria 1308
218 Ga0439462_0170124 3300042015 Bacteria 616
219 Ga0450920_028619 3300042122 Bacteria 1092
220 Ga0450907_012612 3300042146 Bacteria 1408
221 Ga0439459_0079743 3300042438 Bacteria 771
222 Ga0495627_069314 3300046453 Bacteria 1032
223 Ga0495590_0096766 3300046457 Bacteria 1047
224 Ga0495650_0039186 3300046471 Bacteria 2046
225 Ga0495605_0143325 3300046474 Bacteria 1070
226 Ga0495585_0003512 3300046492 Bacteria 10572
227 Ga0495585_0035807 3300046492 Bacteria 2803
228 Ga0495607_0192824 3300046501 Bacteria 1014
229 Ga0495583_0007330 3300046506 Bacteria 6959
230 Ga0495583_0098449 3300046506 Bacteria 1250
231 Ga0495583_0111171 3300046506 Bacteria 1161
232 Ga0495606_0003012 3300046507 Bacteria 18453
233 Ga0495606_0036404 3300046507 Bacteria 3352
234 Ga0495606_0313212 3300046507 Bacteria 846
235 Ga0495610_0003654 3300046512 Bacteria 11836
236 Ga0495610_0022409 3300046512 Bacteria 3456
237 Ga0495620_0024662 3300046515 Bacteria 2856
238 Ga0495620_0040479 3300046515 Bacteria 2050
239 Ga0495631_0003768 3300046518 Bacteria 8247
240 Ga0495632_0004427 3300046519 Bacteria 9548
241 Ga0495632_0008553 3300046519 Bacteria 6262
242 Ga0495632_0034243 3300046519 Bacteria 2601
243 Ga0495632_0121521 3300046519 Bacteria 1220
244 Ga0495643_0036130 3300046522 Bacteria 2716
245 Ga0495643_0091623 3300046522 Bacteria 1567
246 Ga0495648_0021121 3300046524 Bacteria 4519
247 Ga0495648_0287811 3300046524 Bacteria 776
248 Ga0495654_0003217 3300046530 Bacteria 10104
249 Ga0495654_0170242 3300046530 Bacteria 950
250 Ga0495654_0173647 3300046530 Bacteria 938
251 Ga0495609_0049848 3300046538 Bacteria 1868
252 Ga0495597_0040474 3300046542 Bacteria 2083
253 Ga0495633_0090166 3300046558 Bacteria 1425
254 Ga0495633_0442190 3300046558 Bacteria 587
255 Ga0495668_0023235 3300046616 Bacteria 3539
256 Ga0495625_0008316 3300046660 Bacteria 8864
257 Ga0495625_0017657 3300046660 Bacteria 5584
258 Ga0495625_0252433 3300046660 Bacteria 1144
259 Ga0495625_0336738 3300046660 Bacteria 957
260 Ga0495588_0147732 3300046674 Bacteria 1242
261 Ga0495588_0156673 3300046674 Bacteria 1204
262 Ga0495670_0061445 3300046691 Bacteria 1889
263 Ga0495671_0048012 3300046692 Bacteria 2131
264 Ga0495671_0120513 3300046692 Bacteria 1280
265 Ga0495649_0055253 3300046694 Bacteria 2146
266 Ga0495649_0082531 3300046694 Bacteria 1718
267 Ga0495589_0040831 3300046794 Bacteria 2316
268 Ga0495660_0013348 3300046810 Bacteria 4760
269 Ga0495672_0159440 3300047320 Bacteria 1161
270 Ga0495673_0018772 3300047469 Bacteria 3480
271 Ga0495681_0138313 3300047470 Bacteria 1031
272 Ga0495686_0000458 3300047472 Bacteria 61256
273 Ga0495686_0007642 3300047472 Bacteria 8070
274 Ga0495686_0012239 3300047472 Bacteria 6009
275 Ga0495686_0136790 3300047472 Bacteria 1448
276 Ga0495615_0004004 3300048090 Bacteria 2529
277 Ga0495615_0072522 3300048090 Bacteria 930
278 Ga0495626_0085456 3300048091 Bacteria 1395
279 Ga0496102_0480399 3300048905 Bacteria 1164
280 Ga0496106_0008234 3300048909 Bacteria 7709
281 Ga0496110_0181518 3300048913 Bacteria 1911
282 Ga0496111_0006294 3300048914 Bacteria 7699
283 Ga0496116_0012667 3300048919 Bacteria 6864
284 Ga0496116_0014264 3300048919 Bacteria 6355
285 Ga0496116_0015539 3300048919 Bacteria 6013
286 Ga0496116_0028316 3300048919 Bacteria 4062
287 Ga0496116_0256017 3300048919 Bacteria 867
288 Ga0496117_0013528 3300048920 Bacteria 7113
289 Ga0496117_0144056 3300048920 Bacteria 1422
290 Ga0496117_0221784 3300048920 Bacteria 1052
291 Ga0496118_0018735 3300048921 Bacteria 6222
292 Ga0496118_0020924 3300048921 Bacteria 5783
293 Ga0496118_0022254 3300048921 Bacteria 5550
294 Ga0496121_0002195 3300048924 Bacteria 30520
295 Ga0496121_0032017 3300048924 Bacteria 4789
296 Ga0496121_0150623 3300048924 Bacteria 1712
297 Ga0496121_0242591 3300048924 Bacteria 1254
298 Ga0496121_0262749 3300048924 Bacteria 1191
299 Ga0496121_0279866 3300048924 Bacteria 1142
300 Ga0496121_0298429 3300048924 Bacteria 1094
301 Ga0496121_0605477 3300048924 Bacteria 675
302 Ga0496122_0002476 3300048925 Bacteria 26097
303 Ga0496122_0018439 3300048925 Bacteria 6447
304 Ga0496122_0035074 3300048925 Bacteria 4092
305 Ga0496122_0262101 3300048925 Bacteria 958
306 Ga0496123_0004863 3300048926 Bacteria 13829
307 Ga0496123_0054595 3300048926 Bacteria 2629
308 Ga0496123_0059496 3300048926 Bacteria 2469
309 Ga0496123_0135548 3300048926 Bacteria 1355
310 Ga0496124_0013299 3300048927 Bacteria 8042
311 Ga0496124_0031000 3300048927 Bacteria 4736
312 Ga0496124_0031580 3300048927 Bacteria 4687
313 Ga0496124_0053359 3300048927 Bacteria 3427
314 Ga0496124_0296102 3300048927 Bacteria 1171
315 Ga0496124_0298424 3300048927 Bacteria 1165
316 Ga0496125_0019902 3300048928 Bacteria 6311
317 Ga0496125_0026135 3300048928 Bacteria 5331
318 Ga0496126_0114297 3300048929 Bacteria 2349
319 Ga0496126_0167690 3300048929 Bacteria 1873
320 Ga0496126_0232722 3300048929 Bacteria 1543
321 Ga0496126_0687300 3300048929 Bacteria 797
322 Ga0495678_022777 3300049459 Bacteria 2734
323 Ga0495678_114603 3300049459 Bacteria 914
324 Ga0501031_0102371 3300049568 Bacteria 1869
325 Ga0501033_0390929 3300049570 Bacteria 971
326 Ga0501034_0284544 3300049571 Bacteria 1592
327 Ga0501034_0735065 3300049571 Bacteria 883
328 Ga0501036_0161756 3300049572 Bacteria 1887
329 Ga0501037_0459891 3300049573 Bacteria 867
330 Ga0501038_0513600 3300049574 Bacteria 915
331 Ga0501038_0565279 3300049574 Bacteria 864
332 Ga0501039_0044887 3300049575 Bacteria 3414
333 Ga0501043_0049175 3300049579 Bacteria 3315
334 Ga0501043_0500552 3300049579 Bacteria 908
335 Ga0501046_0400796 3300049580 Bacteria 991
336 Ga0501047_0311957 3300049581 Bacteria 1413
337 Ga0501047_0325437 3300049581 Bacteria 1376
338 Ga0501068_0044379 3300049584 Bacteria 2677
339 Ga0501068_0051238 3300049584 Bacteria 2497
340 Ga0501073_0025745 3300049589 Bacteria 4216
341 Ga0501238_020352 3300049671 Bacteria 935
342 Ga0501080_0136345 3300049742 Bacteria 2271
343 Ga0501083_0086977 3300049744 Bacteria 2067
344 Ga0501083_0090898 3300049744 Bacteria 2015
345 Ga0501241_018247 3300049758 Bacteria 1285
346 Ga0501035_0200700 3300049822 Bacteria 1711
347 Ga0501044_0050384 3300049823 Bacteria 4296
348 nmdc:mga03683_58705_c1 3300050489 Bacteria 1622
349 nmdc:mga00v17_39_c1 3300050491 Bacteria 82050
350 nmdc:mga0yw44_1121_c1 3300050492 Bacteria 10348
351 nmdc:mga0yw44_32116_c1 3300050492 Bacteria 3057
352 nmdc:mga0k408_107222_c1 3300050493 Bacteria 1650
353 nmdc:mga06z11_123973_c1 3300050494 Bacteria 1444
354 nmdc:mga07m45_14422_c1 3300050496 Bacteria 4209
355 nmdc:mga0sz30_104893_c1 3300050516 Bacteria 1236
356 Ga0500646_0117336 3300053090 Bacteria 852
357 Ga0500569_003823 3300053109 Bacteria 3117
358 Ga0500572_049499 3300053111 Bacteria 1247
359 Ga0500572_065243 3300053111 Bacteria 1114
360 Ga0500594_0206133 3300053118 Bacteria 647
361 Ga0500618_000434 3300053125 Bacteria 27616
362 Ga0500618_002225 3300053125 Bacteria 7564
363 Ga0500618_051322 3300053125 Bacteria 933
364 Ga0500658_0000858 3300053134 Bacteria 12470
365 Ga0500658_0006781 3300053134 Bacteria 4235
366 Ga0500658_0112992 3300053134 Bacteria 1197
367 Ga0500568_0004279 3300053139 Bacteria 7669
368 Ga0500568_0013154 3300053139 Bacteria 3778
369 Ga0500577_0058204 3300053142 Bacteria 1478
370 Ga0500604_0070875 3300053151 Bacteria 1111
371 Ga0500616_0000817 3300053153 Bacteria 35314
372 Ga0500616_0002214 3300053153 Bacteria 16646
373 Ga0500616_0089321 3300053153 Bacteria 1529
374 Ga0500622_0005736 3300053156 Bacteria 7376
375 Ga0500622_0105081 3300053156 Bacteria 1386
376 Ga0500624_021274 3300053157 Bacteria 1046
377 Ga0500627_0048928 3300053158 Bacteria 1838
378 Ga0500627_0081303 3300053158 Bacteria 1445
379 Ga0500633_0001309 3300053160 Bacteria 4611
380 Ga0500636_0000010 3300053177 Bacteria 145932
381 Ga0500636_0015452 3300053177 Bacteria 4499
382 Ga0500611_075197 3300053727 Bacteria 832
383 Ga0500609_051817 3300053731 Bacteria 571
384 Ga0501082_0035073 3300060353 Bacteria 4324
385 2509107015 2508501122 Bacteria 6292184
386 2509375029 2509276019 Bacteria 6802256
387 2509388467 2509276021 Bacteria 7634384
388 2509444015 2509276033 Bacteria 7180565
389 2510131386 2510065019 Bacteria 6903379
390 2510308593 2510065057 Bacteria 6649661
391 2510839794 2510461069 Bacteria 5505000
392 2510897740 2510461076 Bacteria 8618824
393 2511169603 2510917026 Bacteria 7046020
394 2511184760 2510917028 Bacteria 6185411
395 2511199484 2510917030 Bacteria 7460662
396 2511500499 2511231052 Bacteria 6974333
397 2512531961 2512047086 Bacteria 6850303
398 2512972713 2512875026 Bacteria 6861065
399 2513570605 2513237084 Bacteria 7231967
400 2513580242 2513237085 Bacteria 7695351
401 2513587829 2513237086 Bacteria 7265287
402 2513596707 2513237088 Bacteria 6927906
403 2513602898 2513237089 Bacteria 6553624
404 2513620548 2513237091 Bacteria 6900273
405 2513634223 2513237093 Bacteria 7545552
406 2513713218 2513237103 Bacteria 7647401
407 2513864878 2513237138 Bacteria 7368160
408 2513880505 2513237140 Bacteria 7076289
409 2513906839 2513237143 Bacteria 6664116
410 2513910325 2513237144 Bacteria 7530820
411 2513987664 2513237156 Bacteria 6402557
412 2513996736 2513237159 Bacteria 6810126
413 2514005150 2513237160 Bacteria 6650282
414 2514020274 2513237162 Bacteria 7468464
415 2515110339 2515075009 Bacteria 7288508
416 2515607698 2515154107 Bacteria 6795637
417 2515634547 2515154113 Bacteria 7807172
418 2515643772 2515154114 Bacteria 7848616
419 2515657170 2515154116 Bacteria 7552979
420 2515743329 2515154134 Bacteria 7220242
421 2516204364 2516143018 Bacteria 6951533
422 2516891830 2516653046 Bacteria 6989037
423 2517039024 2516653077 Bacteria 7555578
424 2517079290 2516653085 Bacteria 7346596
425 2517093219 2517093000 Bacteria 7412387
426 2517409488 2517287029 Bacteria 6905599
427 2517568628 2517487022 Bacteria 7227575
428 2524449868 2524023207 Bacteria 6813453
429 2530647849 2529292951 Bacteria 6916614
430 2535515069 2534681796 Bacteria 7146037
431 2551682823 2551306084 Bacteria 8942552
432 2551689832 2551306085 Bacteria 7347181
433 2551694865 2551306086 Bacteria 6843938
434 2551701317 2551306087 Bacteria 7351905
435 2551710068 2551306089 Bacteria 7162724
436 2551719781 2551306090 Bacteria 7953713
437 2551725308 2551306091 Bacteria 7086830
438 2551739046 2551306092 Bacteria 6992595
439 2551744490 2551306093 Bacteria 7064773
440 2558866030 2558860100 Bacteria 8458965
441 2585164970 2582581283 Bacteria 6030556
442 2585203645 2582581294 Bacteria 6626667
443 2585227047 2582581298 Bacteria 7315509
444 2585229800 2582581299 Bacteria 6518058
445 2585269513 2582581306 Bacteria 6450535
446 2585385519 2582581865 Bacteria 6644329
447 2585398578 2582581867 Bacteria 7184437
448 2585529293 2585427526 Bacteria 7258840
449 2585539655 2585427528 Bacteria 6842387
450 2585550528 2585427529 Bacteria 7395659
451 2585819272 2585427590 Bacteria 6824633
452 2585837612 2585427593 Bacteria 7141551
453 2585844178 2585427594 Bacteria 6180594
454 2585994374 2585427633 Bacteria 6413184
455 2585998832 2585427634 Bacteria 6455027
456 2599332984 2599185156 Bacteria 5403036
457 2599719574 2599185236 Bacteria 6875203
458 2600191423 2599185352 Bacteria 7228948
459 2616297089 2615840624 Bacteria 6557588
460 2643806262 2643221557 Bacteria 7184309
461 2643812886 2643221558 Bacteria 5460675
462 2644007291 2643221599 Bacteria 6292121
463 2644047155 2643221607 Bacteria 6314006
464 2644070136 2643221610 Bacteria 7480339
465 2644103272 2643221618 Bacteria 7717186
466 2644151856 2643221626 Bacteria 8069654
467 2644190559 2643221634 Bacteria 6705461
468 2644203406 2643221636 Bacteria 6583769
469 2644206735 2643221637 Bacteria 5345260
470 2644241575 2643221643 Bacteria 5749658
471 2644297665 2643221653 Bacteria 4569637
472 2644306200 2643221655 Bacteria 7722067
473 2644330450 2643221659 Bacteria 7890716
474 2644381107 2643221668 Bacteria 7306521
475 2644415013 2643221675 Bacteria 7473456
476 2644448670 2643221680 Bacteria 7473610
477 2644479944 2643221686 Bacteria 6310811
478 2644492274 2643221688 Bacteria 5260751
479 2644496783 2643221689 Bacteria 6042950
480 2644542804 2643221698 Bacteria 7756764
481 2644618850 2643221712 Bacteria 7729434
482 2644650382 2643221718 Bacteria 5345506
483 2644655918 2643221719 Bacteria 4568197
484 2644674058 2643221723 Bacteria 7095460
485 2644689022 2643221726 Bacteria 7455827
486 2657681871 2657244999 Bacteria 5946535
487 2692317282 2690316117 Bacteria 6800650
488 2719179541 2718217882 Bacteria 6556348
489 2719384095 2718217927 Bacteria 6972593
490 2719663886 2718217997 Bacteria 6740740
491 2719730211 2718218009 Bacteria 6478651
492 2720490305 2718218199 Bacteria 6740745
493 2720611682 2718218232 Bacteria 6720332
494 2720618531 2718218233 Bacteria 6662049
495 2720629939 2718218235 Bacteria 6630699
496 2720773634 2718218269 Bacteria 6906114
497 2721145634 2718218363 Bacteria 6524337
498 2721157151 2718218365 Bacteria 6274507
499 2721162513 2718218366 Bacteria 6425255
500 2721397865 2718218423 Bacteria 6438183
501 2722838683 2721755514 Bacteria 6424414
502 2723025305 2721755556 Bacteria 6745503
503 2723558890 2721755684 Bacteria 6859907
504 2723565460 2721755685 Bacteria 6704835
505 2724036675 2721755809 Bacteria 6438790
506 2724042967 2721755810 Bacteria 6479005
507 2724088241 2721755819 Bacteria 6906405
508 2724102725 2721755822 Bacteria 6726041
509 2724108621 2721755823 Bacteria 6752556
510 2725948965 2724679232 Bacteria 7646494
511 2730106241 2728369352 Bacteria 6745171
512 2730162778 2728369365 Bacteria 6555560
513 2730296783 2728369397 Bacteria 6274511
514 2738801269 2738541293 Bacteria 7065685
515 2738948277 2738541317 Bacteria 5340176
516 2739037045 2738541333 Bacteria 7106503
517 2753461320 2751185821 Bacteria 6189929
518 2766066595 2765235942 Bacteria 7445910
519 2792582947 2791355082 Bacteria 5973319
520 2792623834 2791355091 Bacteria 6135441
521 2792629786 2791355092 Bacteria 6248105
522 2792638119 2791355094 Bacteria 7011481
523 2793295238 2791355256 Bacteria 6798008
524 2793316358 2791355259 Bacteria 7254731
525 2793323410 2791355260 Bacteria 6598818
526 2793326196 2791355261 Bacteria 6661293
527 2793334256 2791355262 Bacteria 6774204
528 2793341834 2791355263 Bacteria 6872478
529 2793348171 2791355264 Bacteria 6429314
530 2793355761 2791355265 Bacteria 6539969
531 2793361540 2791355266 Bacteria 7116587
532 2793364646 2791355267 Bacteria 7222458
533 2802720339 2802428858 Bacteria 6636079
534 2802726159 2802428859 Bacteria 6667919
535 2802731677 2802428860 Bacteria 6525526
536 2802739428 2802428861 Bacteria 6534206
537 2802742570 2802428862 Bacteria 6633353
538 2802749275 2802428863 Bacteria 6410669
539 2804750891 2802429268 Bacteria 6094027
540 2805929341 2802429605 Bacteria 6875453
541 2805932400 2802429606 Bacteria 6346811
542 2806047573 2802429633 Bacteria 7341974
543 2806054992 2802429634 Bacteria 7083200
544 2806062106 2802429635 Bacteria 7650140
545 2806067168 2802429636 Bacteria 7597525
546 2806076489 2802429637 Bacteria 7067217
547 2819245293 2818991272 Bacteria 4622173
548 2821123603 2821123053 Bacteria 7836056
549 2838020254 2838016132 Bacteria 6577831
550 2838025773 2838022645 Bacteria 6494267
551 2838044457 2838042994 Bacteria 6046894
552 2838051530 2838048938 Bacteria 6044578
553 2838064005 2838061910 Bacteria 6794874
554 2838071080 2838068647 Bacteria 6208656
555 2838075345 2838074704 Bacteria 6785777
556 2838672425 2838668709 Bacteria 6671819
557 2838680554 2838680041 Bacteria 6545511
558 2838691613 2838686498 Bacteria 7807632
559 2838695413 2838694306 Bacteria 6853137
560 2838703833 2838701080 Bacteria 6669771
561 2838708790 2838707686 Bacteria 6619912
562 2838733903 2838729681 Bacteria 7400765
563 2838739363 2838736955 Bacteria 5760694
564 2838747033 2838742623 Bacteria 7396178
565 2841843261 2841840854 Bacteria 5761912
566 2841856174 2841851746 Bacteria 7532261
567 2841866843 2841864319 Bacteria 6742987
568 2842079975 2842077413 Bacteria 6508645
569 2842112179 2842110456 Bacteria 7656360
570 2842120594 2842118031 Bacteria 7033875
571 2842143043 2842140634 Bacteria 5759631
572 2842148375 2842146304 Bacteria 5957337
573 2842161962 2842156927 Bacteria 6894975
574 2842169662 2842163707 Bacteria 6916235
575 2842185804 2842180545 Bacteria 6888678
576 2842192855 2842192696 Bacteria 6147454
577 2842202924 2842198810 Bacteria 6608673
578 2842206982 2842205361 Bacteria 6340321
579 2842218825 2842217011 Bacteria 7497767
580 2842235332 2842229732 Bacteria 7475766
581 2842238201 2842237096 Bacteria 6620661
582 2842248213 2842243621 Bacteria 7421798
583 2842253441 2842250916 Bacteria 6579627
584 2842262193 2842257432 Bacteria 7401195
585 2842268792 2842264693 Bacteria 6472963
586 2842276586 2842271015 Bacteria 7807131
587 2842280325 2842278818 Bacteria 6340002
588 2842286807 2842285085 Bacteria 6011953
589 2842293636 2842291075 Bacteria 7076806
590 2842306532 2842304105 Bacteria 7023636
591 2842312652 2842311132 Bacteria 6616990
592 2842322483 2842317721 Bacteria 6793725
593 2842343105 2842341865 Bacteria 7003929
594 2842367170 2842363717 Bacteria 6844742
595 2842371017 2842370503 Bacteria 7038661
596 2842380033 2842377471 Bacteria 7140707
597 2842387104 2842384541 Bacteria 7057858
598 2842399217 2842395702 Bacteria 6780583
599 2842403640 2842402390 Bacteria 6681310
600 2842410658 2842409023 Bacteria 6687331
601 2842417304 2842415677 Bacteria 6596907
602 2842424696 2842422224 Bacteria 6239196
603 2842433008 2842428310 Bacteria 6767288
604 2842439313 2842434925 Bacteria 6502746
605 2842445942 2842441272 Bacteria 6769273
606 2842451877 2842447887 Bacteria 6754142
607 2842467128 2842462802 Bacteria 6588055
608 2842473844 2842469257 Bacteria 6752936
609 2842492491 2842489311 Bacteria 6620893
610 2842500071 2842495871 Bacteria 6820686
611 2842521667 2842521101 Bacteria 6569494
612 2842923292 2842922631 Bacteria 5824079
613 2844170786 2844163670 Bacteria 7266046
614 2844456022 2844454524 Bacteria 7952546
615 2847417650 2847417321 Bacteria 6913799
616 2848992455 2848992105 Bacteria 6810864
617 2850079951 2850079185 Bacteria 6848280
618 2854898240 2854896431 Bacteria 5869725
619 2854919922 2854916844 Bacteria 5725939
620 2855831746 2855825444 Bacteria 6785811
621 2855839970 2855839649 Bacteria 7135830
622 2855874562 2855872281 Bacteria 6964271
623 2857523470 2857516855 Bacteria 7787325
624 2857531167 2857531043 Bacteria 6754041
625 2858803943 2858800743 Bacteria 6603254
626 2896391581 2896384573 Bacteria 7700774
627 2899805332 2899803654 Bacteria 5577784
628 2913298018 2913295892 Bacteria 6333755
629 2913313381 2913308742 Bacteria 5350706
630 2915980758 2915980308 Bacteria 6624279
631 2915987509 2915986958 Bacteria 6739310
632 2915999713 2915993759 Bacteria 7016183
633 2916002025 2916000859 Bacteria 6865702
634 2916008016 2916007675 Bacteria 6898660
635 2916015450 2916014648 Bacteria 6946486
636 2916022119 2916021584 Bacteria 6854472
637 2916031059 2916028427 Bacteria 6748433
638 2916040771 2916035215 Bacteria 6755766
639 2916045598 2916041962 Bacteria 6820487
640 2916050215 2916048683 Bacteria 6543552
641 2916057377 2916055098 Bacteria 6758838
642 2916063675 2916061851 Bacteria 6737736
643 2916074169 2916068649 Bacteria 6943657
644 2916081856 2916076590 Bacteria 6596108
645 2919101380 2919100787 Bacteria 7710546
646 2919172116 2919171160 Bacteria 6499771
647 2920763421 2920760137 Bacteria 7427611
648 2920823344 2920822456 Bacteria 6897201
649 2921205214 2921201388 Bacteria 6926299
650 2921209123 2921208531 Bacteria 6745326
651 2921244039 2921237296 Bacteria 6876710
652 2921250348 2921244191 Bacteria 6568419
653 2921257184 2921250672 Bacteria 6677771
654 2921260373 2921257292 Bacteria 6808382
655 2921266452 2921263974 Bacteria 6864552
656 2921288379 2921282425 Bacteria 6826397
657 2921289926 2921289301 Bacteria 7316391
658 2921300072 2921296804 Bacteria 7176999
659 2923557115 2923556063 Bacteria 6793593
660 2924150102 2924144063 Bacteria 6883928
661 2924154408 2924150972 Bacteria 7169444
662 2924163468 2924158325 Bacteria 7188855
663 2924166348 2924165586 Bacteria 7260590
664 2924177981 2924172951 Bacteria 6749356
665 2924180889 2924179722 Bacteria 6843264
666 2924192621 2924186466 Bacteria 6876637
667 2924194318 2924193448 Bacteria 6955718
668 2924202663 2924200457 Bacteria 6757188
669 2924213272 2924207177 Bacteria 6917007
670 2924221173 2924214083 Bacteria 7080103
671 2924222399 2924221636 Bacteria 7113495
672 2924234804 2924228884 Bacteria 6633132
673 2933020390 2933016740 Bacteria 6355406
674 2933573601 2933570622 Bacteria 7023390
675 2933587508 2933586486 Bacteria 7667493
676 2933601879 2933599457 Bacteria 5858799
677 2935895937 2935894831 Bacteria 6620579
678 2935907195 2935901341 Bacteria 7341747
679 2936368959 2936367885 Bacteria 7324495
680 2936378425 2936375103 Bacteria 6652732
681 2936383713 2936381700 Bacteria 7006523
682 2936997905 2936996657 Bacteria 6298727
683 2937009313 2937002841 Bacteria 6934057
684 2937015776 2937009748 Bacteria 6746052
685 2937018740 2937016420 Bacteria 6782579
686 2937023794 2937023124 Bacteria 6815156
687 2937034554 2937029754 Bacteria 6424026
688 2937041285 2937036028 Bacteria 6846469
689 2937047565 2937042894 Bacteria 6741576
690 2937054023 2937049772 Bacteria 6757901
691 2937060630 2937056579 Bacteria 7107896
692 2937064650 2937063883 Bacteria 7199456
693 2937078032 2937071275 Bacteria 6984483
694 2937078766 2937078374 Bacteria 6610289
695 2937085903 2937084907 Bacteria 6618516
696 2937096899 2937091812 Bacteria 6979387
697 2937103475 2937098957 Bacteria 7249374
698 2937111546 2937106411 Bacteria 6947143
699 2937114702 2937113482 Bacteria 6505872
700 2937125174 2937119839 Bacteria 6597547
701 2937132322 2937126314 Bacteria 6771275
702 2941500743 2941499720 Bacteria 7599444
703 2957382082 2957375807 Bacteria 6425588
704 2957387613 2957382221 Bacteria 6737050
705 2957394041 2957388812 Bacteria 6778072
706 2957396154 2957395598 Bacteria 6822399
707 2957407932 2957402308 Bacteria 6741770
708 2957414595 2957408893 Bacteria 6558585
709 2957421538 2957415311 Bacteria 6991633
710 2957429651 2957422303 Bacteria 7172205
711 2957436991 2957430029 Bacteria 7022557
712 2957442613 2957437181 Bacteria 6568994
713 2957447153 2957443900 Bacteria 6869977
714 2957457303 2957450854 Bacteria 6765715
715 2957458117 2957457609 Bacteria 6967680
716 2957466289 2957464669 Bacteria 6568877
717 2957471425 2957471148 Bacteria 6797643
718 2957479758 2957478035 Bacteria 6756658
719 2957485091 2957484790 Bacteria 6703082
720 2957497766 2957491536 Bacteria 6695180
721 2957505113 2957498199 Bacteria 7126688
722 2957505976 2957505466 Bacteria 7253085
723 2960584407 2960584000 Bacteria 6864594
724 2960594741 2960591022 Bacteria 6622873
725 2960603111 2960597568 Bacteria 6550735
726 2960609358 2960603979 Bacteria 6898737
727 2960616903 2960610863 Bacteria 6691244
728 2960621671 2960617483 Bacteria 6727748
729 2960630949 2960624210 Bacteria 6875384
730 2960637482 2960631154 Bacteria 6732508
731 2960643544 2960637947 Bacteria 7296468
732 2960645800 2960645483 Bacteria 7211087
733 2960658318 2960652885 Bacteria 7083688
734 2960660437 2960660292 Bacteria 7041660
735 2960672912 2960667422 Bacteria 6763020
736 2960675263 2960674078 Bacteria 6609048
737 2960686586 2960680706 Bacteria 6624464
738 2960690297 2960687367 Bacteria 6535474
739 2960698849 2960693952 Bacteria 6749742
740 2964615213 2964607997 Bacteria 7101408
741 2964619783 2964615318 Bacteria 6809089
742 2964622366 2964621998 Bacteria 6834995
743 2964636042 2964628898 Bacteria 7083044
744 2964636434 2964636051 Bacteria 7091832
745 2964649269 2964643177 Bacteria 6820887
746 2964650306 2964649959 Bacteria 6675118
747 2964659439 2964656573 Bacteria 7100150
748 2964669675 2964663802 Bacteria 7019362
749 2964675805 2964670856 Bacteria 6851364
750 2964678722 2964678106 Bacteria 6792020
751 2964685472 2964685014 Bacteria 6839111
752 2964698041 2964691889 Bacteria 6802758
753 2964705343 2964698721 Bacteria 6765331
754 2964707159 2964705432 Bacteria 7114648
755 2964719261 2964712639 Bacteria 6695970
756 2964719955 2964719344 Bacteria 7286602
757 2967667648 2967664464 Bacteria 6948836
758 2967671911 2967671571 Bacteria 7021409
759 2967684932 2967678726 Bacteria 7264382
760 2967691500 2967686174 Bacteria 6678622
761 2967695044 2967693043 Bacteria 6804451
762 2967701161 2967699805 Bacteria 6854538
763 2967707407 2967706974 Bacteria 7186053
764 2967714638 2967714385 Bacteria 7000047
765 2967722487 2967721400 Bacteria 7073753
766 2967730533 2967728569 Bacteria 6641507
767 2967740762 2967735183 Bacteria 6827012
768 2967743844 2967742019 Bacteria 6794534
769 2967754574 2967748971 Bacteria 6733771
770 2967761272 2967755722 Bacteria 6814706
771 2967762714 2967762386 Bacteria 6923502
772 2967772808 2967769361 Bacteria 6587838
773 2967782489 2967775926 Bacteria 6738189
774 2970023347 2970019648 Bacteria 7072033
775 2970030554 2970026789 Bacteria 6785236
776 2970040396 2970033650 Bacteria 7118744
777 2970045464 2970040964 Bacteria 6731123
778 2970052655 2970047711 Bacteria 7088379
779 2970059745 2970054988 Bacteria 6611507
780 2970061995 2970061556 Bacteria 7099761
781 2970073368 2970068827 Bacteria 7123112
782 2970082247 2970076120 Bacteria 6697332
783 2970087726 2970082768 Bacteria 6183754
784 2970094799 2970088815 Bacteria 6933825
785 2970101488 2970095765 Bacteria 6936963
786 2970103340 2970102677 Bacteria 6812532
787 2970115823 2970109326 Bacteria 6863976
788 2970118590 2970116247 Bacteria 6501857
789 2970126272 2970122695 Bacteria 6625855
790 2970131542 2970129317 Bacteria 6806560
791 2970137557 2970136068 Bacteria 7207982
792 2970148515 2970143518 Bacteria 6446480
793 2970156609 2970149975 Bacteria 6779706
794 2970157544 2970156795 Bacteria 7168044
795 2970169531 2970164137 Bacteria 6861252
796 2970176539 2970170962 Bacteria 6876229
797 2970181925 2970177841 Bacteria 6768001
798 2970188482 2970184632 Bacteria 7054431
799 2970198593 2970191845 Bacteria 7032787
800 2977517375 2977516862 Bacteria 6940108
801 2977529159 2977523885 Bacteria 6960446
802 2977535836 2977530762 Bacteria 6951399
803 2977542100 2977537788 Bacteria 6929320
804 2977549490 2977544691 Bacteria 6875412
805 2977553652 2977551784 Bacteria 7125765
806 2977559460 2977558990 Bacteria 6863948
807 2977572003 2977565890 Bacteria 6901543
808 2977579223 2977572785 Bacteria 6763888
809 2977580412 2977579622 Bacteria 6772100
810 2989777393 2989776772 Bacteria 4843317
811 2996888484 2996887358 Bacteria 5795980
812 2996893403 2996893221 Bacteria 5823108
813 3005446152 3005445848 Bacteria 6906074
814 3005452812 3005452660 Bacteria 5889319
815 639646618 639633055 Bacteria 7751309
816 643824514 643692032 Bacteria 6891900
817 648740880 648276728 Bacteria 6968865
818 8003992422 8003992118 Bacteria 7266902
819 8003999751 8003999396 Bacteria 7063185
820 8005247419 8005246636 Bacteria 4933972
821 8005263448 8005258706 Bacteria 6184835
822 8005278806 8005275841 Bacteria 6929066
823 8005289040 8005282627 Bacteria 6675747
824 8005291114 8005289223 Bacteria 6634003
825 8005301519 8005301065 Bacteria 6614431
826 8005309225 8005307578 Bacteria 7395396
827 8005323011 8005321885 Bacteria 5795980
828 8005377465 8005376324 Bacteria 6590079
829 8005387328 8005382845 Bacteria 6732062
830 8005400095 8005395548 Bacteria 6806915
831 8005432900 8005430974 Bacteria 6689030
832 8005460978 8005460587 Bacteria 7157962
833 8005498630 8005497431 Bacteria 6477605
834 8005543740 8005542996 Bacteria 7077758
835 8005560591 8005556819 Bacteria 6908598
836 8005563950 8005563573 Bacteria 7153261
837 8005576890 8005570704 Bacteria 6957481
838 8005619822 8005619151 Bacteria 7030230
839 8005628394 8005626139 Bacteria 6534237
840 8005670041 8005668836 Bacteria 6953162
841 8005690235 8005688590 Bacteria 6610080
842 8005699285 8005695170 Bacteria 6912330
843 8018133093 8018127388 Bacteria 7351159
844 8018153065 8018150411 Bacteria 5549903
845 8018168993 8018163183 Bacteria 7277977
846 8018178832 8018176218 Bacteria 6896178
847 8023684272 8023680758 Bacteria 7729763
848 8024480245 8024479707 Bacteria 6954785
849 8024501634 8024501048 Bacteria 6427847
850 8049293447 8049293176 Bacteria 6128433
851 8054461288 8054460903 Bacteria 4872905
852 8055433457 8055431914 Bacteria 4551896
853 8056375603 8056375014 Bacteria 7006639
854 8056385917 8056382006 Bacteria 6408074
855 8057876017 8057874678 Bacteria 7494653
856 JGI25153J46596_10041145
857 JGI25158J39367_1000337
858 JGI25152J39213_1000622
859 JGI25152J39213_1001653
860 JGI25152J39213_1002790
861 JGI25152J39213_1004728
862 JGI25152J39213_1005519
863 JGI25152J39213_1017826
864 JGI25150J39212_1000012
865 JGI25150J39212_1004398
866 JGI25159J45721_1000016
867 JGI25159J45721_1000234
868 JGI25151J46595_10000025
869 JGI25151J46595_10000346
870 JGI25151J46595_10001380
871 JGI25151J46595_10009441
872 JGI25151J46595_10018819
873 JGI25153J46596_10002170
874 JGI25153J46596_10005707
875 JGI25153J46596_10005987
876 JGI25153J46596_10010429
877 JGI25153J46596_10012490
878 rootH1_10066558
879 rootH2_10250578
880 rootL2_10244022
881 rootL2_10351773
882 rootH1_10119258
883 rootH1_10170722
884 JGI25160J50197_1000002
885 JGI25160J50197_1002495
886 JGI25160J50197_1007334
887 JGI25161J50226_1000382
888 JGI25161J50226_1003195
889 Ga0055526_1000624
890 Ga0055526_1004061
891 Ga0055526_1009033
892 Ga0055526_1012412
893 Ga0055524_1002525
894 Ga0055524_1002822
895 Ga0055524_1015211
896 Ga0055536_1013337
897 Ga0055528_1001607
898 Ga0055528_1004149
899 Ga0055528_1004778
900 Ga0055528_1014048
901 Ga0055528_1014392
902 Ga0055528_1035253
903 Ga0055530_10033657
904 Ga0055540_1001619
905 Ga0055540_1001855
906 Ga0055540_1002138
907 Ga0055540_1031798
908 Ga0055531_10001338
909 Ga0055531_10023875
910 Ga0055543_1000022
911 Ga0055543_1000141
912 Ga0065165_1000058
913 Ga0065165_1006213
914 Ga0065165_1010889
915 Ga0070682_100285154
916 Ga0070668_100343485
917 Ga0070669_100023818
918 Ga0070671_100028688
919 Ga0070665_100173561
920 Ga0070665_100654362
921 Ga0068864_101831559
922 Ga0075365_10006954
923 Ga0075363_100212864
924 Ga0075364_10011216
925 Ga0075362_10290957
926 Ga0075367_10011574
927 Ga0075367_10123788
928 Ga0075367_10146287
929 Ga0075367_10607132
930 Ga0075369_10068494
931 Ga0075369_10172895
932 Ga0075366_10251777
933 Ga0075370_10033361
934 Ga0079104_1002673
935 Ga0079104_1002890
936 Ga0105238_10908930
937 Ga0105249_10179949
938 Ga0123341_1000192
939 Ga0123342_1011318
940 Ga0123342_1032521
941 Ga0105239_10294577
942 Ga0105246_10109562
943 Ga0157322_1006393
944 Ga0171463_1001
945 Ga0183363_1012
946 Ga0214544_1000012
947 Ga0214542_1000011
948 Ga0214543_1000004
949 Ga0214543_1000256
950 Ga0228711_1000019
951 Ga0228710_1000022
952 Ga0209436_100051
953 Ga0209436_100142
954 Ga0207425_1000012
955 Ga0207425_1004637
956 Ga0207425_1005834
957 Ga0207425_1008001
958 Ga0209129_1000081
959 Ga0209129_1000545
960 Ga0209129_1001854
961 Ga0209129_1002362
962 Ga0209129_1005076
963 Ga0209129_1005100
964 Ga0209129_1009094
965 Ga0209565_1017257
966 Ga0209673_1000704
967 Ga0209673_1000999
968 Ga0209673_1001226
969 Ga0209673_1001868
970 Ga0209673_1002467
971 Ga0209673_1005127
972 Ga0209673_1034978
973 Ga0209673_1050436
974 Ga0209130_1000002
975 Ga0209130_1000008
976 Ga0209130_1029041
977 Ga0209676_1004653
978 Ga0209676_1008588
979 Ga0209025_1000024
980 Ga0209025_1000631
981 Ga0209025_1000970
982 Ga0209025_1008764
983 Ga0209025_1009867
984 Ga0209025_1039413
985 Ga0209025_1140551
986 Ga0209564_1000091
987 Ga0209564_1000382
988 Ga0209564_1000576
989 Ga0209564_1000811
990 Ga0209564_1026253
991 Ga0209758_1000046
992 Ga0209758_1000349
993 Ga0209758_1000575
994 Ga0209758_1001043
995 Ga0209758_1001705
996 Ga0209758_1003657
997 Ga0209758_1005259
998 Ga0209758_1007186
999 Ga0209758_1113169
1000 Ga0209050_1010411
1001 Ga0209050_1013811
1002 Ga0209256_1000180
1003 Ga0209256_1000541
1004 Ga0209256_1002684
1005 Ga0209256_1002790
1006 Ga0209256_1006334
1007 Ga0209256_1007071
1008 Ga0209256_1015202
1009 Ga0209256_1082927
1010 Ga0207426_1000013
1011 Ga0207426_1000016
1012 Ga0207426_1000063
1013 Ga0207426_1000172
1014 Ga0207426_1001476
1015 Ga0209051_1000084
1016 Ga0209051_1002292
1017 Ga0209051_1002483
1018 Ga0209051_1013199
1019 Ga0209051_1025349
1020 Ga0209051_1030757
1021 Ga0209257_1003740
1022 Ga0209257_1008498
1023 Ga0209257_1011440
1024 Ga0209257_1011610
1025 Ga0209257_1024523
1026 Ga0207681_10092022
1027 Ga0207694_11138027
1028 Ga0207644_10245743
1029 Ga0207712_10258878
1030 Ga0207668_10428012
1031 Ga0207678_10258272
1032 Ga0209281_1000192
1033 Ga0209281_1000200
1034 Ga0209281_1000227
1035 Ga0209282_1000042
1036 Ga0268266_10141407
1037 Ga0268266_10977481
1038 Ga0307515_10000023
1039 Ga0307513_10001791
1040 Ga0307513_10048998
1041 Ga0307408_100097451
1042 Ga0307405_10002493
1043 Ga0307405_10167101
1044 Ga0307405_10200073
1045 Ga0307405_10627506
1046 Ga0307406_10231026
1047 Ga0307412_10034792
1048 Ga0307412_11191914
1049 Ga0315914_1000009
1050 Ga0307409_100693090
1051 Ga0307414_10033827
1052 Ga0315913_1000015
1053 Ga0315915_1000013
1054 Ga0439436_0005341
1055 Ga0439465_0002635
1056 Ga0439465_0026178
1057 Ga0439465_0193343
1058 Ga0451787_118315
1059 Ga0451789_1135835
1060 Ga0451791_0704102
1061 Ga0451793_0629204
1062 Ga0451795_0904357
1063 Ga0451804_0896021
1064 Ga0451833_0730851
1065 Ga0451835_1216422
1066 Ga0451841_1050487
1067 Ga0451846_65326
1068 Ga0451847_0593829
1069 Ga0451850_44672
1070 Ga0451851_1210286
1071 Ga0439452_042525
1072 Ga0439462_0036507
1073 Ga0439462_0170124
1074 Ga0450920_028619
1075 Ga0450907_012612
1076 Ga0439459_0079743
1077 Ga0495627_069314
1078 Ga0495590_0096766
1079 Ga0495650_0039186
1080 Ga0495605_0143325
1081 Ga0495585_0003512
1082 Ga0495585_0035807
1083 Ga0495607_0192824
1084 Ga0495583_0007330
1085 Ga0495583_0098449
1086 Ga0495583_0111171
1087 Ga0495606_0003012
1088 Ga0495606_0036404
1089 Ga0495606_0313212
1090 Ga0495610_0003654
1091 Ga0495610_0022409
1092 Ga0495620_0024662
1093 Ga0495620_0040479
1094 Ga0495631_0003768
1095 Ga0495632_0004427
1096 Ga0495632_0008553
1097 Ga0495632_0034243
1098 Ga0495632_0121521
1099 Ga0495643_0036130
1100 Ga0495643_0091623
1101 Ga0495648_0021121
1102 Ga0495648_0287811
1103 Ga0495654_0003217
1104 Ga0495654_0170242
1105 Ga0495654_0173647
1106 Ga0495609_0049848
1107 Ga0495597_0040474
1108 Ga0495633_0090166
1109 Ga0495633_0442190
1110 Ga0495668_0023235
1111 Ga0495625_0008316
1112 Ga0495625_0017657
1113 Ga0495625_0252433
1114 Ga0495625_0336738
1115 Ga0495588_0147732
1116 Ga0495588_0156673
1117 Ga0495670_0061445
1118 Ga0495671_0048012
1119 Ga0495671_0120513
1120 Ga0495649_0055253
1121 Ga0495649_0082531
1122 Ga0495589_0040831
1123 Ga0495660_0013348
1124 Ga0495672_0159440
1125 Ga0495673_0018772
1126 Ga0495681_0138313
1127 Ga0495686_0000458
1128 Ga0495686_0007642
1129 Ga0495686_0012239
1130 Ga0495686_0136790
1131 Ga0495615_0004004
1132 Ga0495615_0072522
1133 Ga0495626_0085456
1134 Ga0496102_0480399
1135 Ga0496106_0008234
1136 Ga0496110_0181518
1137 Ga0496111_0006294
1138 Ga0496116_0012667
1139 Ga0496116_0014264
1140 Ga0496116_0015539
1141 Ga0496116_0028316
1142 Ga0496116_0256017
1143 Ga0496117_0013528
1144 Ga0496117_0144056
1145 Ga0496117_0221784
1146 Ga0496118_0018735
1147 Ga0496118_0020924
1148 Ga0496118_0022254
1149 Ga0496121_0002195
1150 Ga0496121_0032017
1151 Ga0496121_0150623
1152 Ga0496121_0242591
1153 Ga0496121_0262749
1154 Ga0496121_0279866
1155 Ga0496121_0298429
1156 Ga0496121_0605477
1157 Ga0496122_0002476
1158 Ga0496122_0018439
1159 Ga0496122_0035074
1160 Ga0496122_0262101
1161 Ga0496123_0004863
1162 Ga0496123_0054595
1163 Ga0496123_0059496
1164 Ga0496123_0135548
1165 Ga0496124_0013299
1166 Ga0496124_0031000
1167 Ga0496124_0031580
1168 Ga0496124_0053359
1169 Ga0496124_0296102
1170 Ga0496124_0298424
1171 Ga0496125_0019902
1172 Ga0496125_0026135
1173 Ga0496126_0114297
1174 Ga0496126_0167690
1175 Ga0496126_0232722
1176 Ga0496126_0687300
1177 Ga0495678_022777
1178 Ga0495678_114603
1179 Ga0501031_0102371
1180 Ga0501033_0390929
1181 Ga0501034_0284544
1182 Ga0501034_0735065
1183 Ga0501036_0161756
1184 Ga0501037_0459891
1185 Ga0501038_0513600
1186 Ga0501038_0565279
1187 Ga0501039_0044887
1188 Ga0501043_0049175
1189 Ga0501043_0500552
1190 Ga0501046_0400796
1191 Ga0501047_0311957
1192 Ga0501047_0325437
1193 Ga0501068_0044379
1194 Ga0501068_0051238
1195 Ga0501073_0025745
1196 Ga0501238_020352
1197 Ga0501080_0136345
1198 Ga0501083_0086977
1199 Ga0501083_0090898
1200 Ga0501241_018247
1201 Ga0501035_0200700
1202 Ga0501044_0050384
1203 nmdc:mga03683_58705_c1
1204 nmdc:mga00v17_39_c1
1205 nmdc:mga0yw44_1121_c1
1206 nmdc:mga0yw44_32116_c1
1207 nmdc:mga0k408_107222_c1
1208 nmdc:mga06z11_123973_c1
1209 nmdc:mga07m45_14422_c1
1210 nmdc:mga0sz30_104893_c1
1211 Ga0500646_0117336
1212 Ga0500569_003823
1213 Ga0500572_049499
1214 Ga0500572_065243
1215 Ga0500594_0206133
1216 Ga0500618_000434
1217 Ga0500618_002225
1218 Ga0500618_051322
1219 Ga0500658_0000858
1220 Ga0500658_0006781
1221 Ga0500658_0112992
1222 Ga0500568_0004279
1223 Ga0500568_0013154
1224 Ga0500577_0058204
1225 Ga0500604_0070875
1226 Ga0500616_0000817
1227 Ga0500616_0002214
1228 Ga0500616_0089321
1229 Ga0500622_0005736
1230 Ga0500622_0105081
1231 Ga0500624_021274
1232 Ga0500627_0048928
1233 Ga0500627_0081303
1234 Ga0500633_0001309
1235 Ga0500636_0000010
1236 Ga0500636_0015452
1237 Ga0500611_075197
1238 Ga0500609_051817
1239 Ga0501082_0035073
1240 2509107015
1241 2509375029
1242 2509388467
1243 2509444015
1244 2510131386
1245 2510308593
1246 2510839794
1247 2510897740
1248 2511169603
1249 2511184760
1250 2511199484
1251 2511500499
1252 2512531961
1253 2512972713
1254 2513570605
1255 2513580242
1256 2513587829
1257 2513596707
1258 2513602898
1259 2513620548
1260 2513634223
1261 2513713218
1262 2513864878
1263 2513880505
1264 2513906839
1265 2513910325
1266 2513987664
1267 2513996736
1268 2514005150
1269 2514020274
1270 2515110339
1271 2515607698
1272 2515634547
1273 2515643772
1274 2515657170
1275 2515743329
1276 2516204364
1277 2516891830
1278 2517039024
1279 2517079290
1280 2517093219
1281 2517409488
1282 2517568628
1283 2524449868
1284 2530647849
1285 2535515069
1286 2551682823
1287 2551689832
1288 2551694865
1289 2551701317
1290 2551710068
1291 2551719781
1292 2551725308
1293 2551739046
1294 2551744490
1295 2558866030
1296 2585164970
1297 2585203645
1298 2585227047
1299 2585229800
1300 2585269513
1301 2585385519
1302 2585398578
1303 2585529293
1304 2585539655
1305 2585550528
1306 2585819272
1307 2585837612
1308 2585844178
1309 2585994374
1310 2585998832
1311 2599332984
1312 2599719574
1313 2600191423
1314 2616297089
1315 2643806262
1316 2643812886
1317 2644007291
1318 2644047155
1319 2644070136
1320 2644103272
1321 2644151856
1322 2644190559
1323 2644203406
1324 2644206735
1325 2644241575
1326 2644297665
1327 2644306200
1328 2644330450
1329 2644381107
1330 2644415013
1331 2644448670
1332 2644479944
1333 2644492274
1334 2644496783
1335 2644542804
1336 2644618850
1337 2644650382
1338 2644655918
1339 2644674058
1340 2644689022
1341 2657681871
1342 2692317282
1343 2719179541
1344 2719384095
1345 2719663886
1346 2719730211
1347 2720490305
1348 2720611682
1349 2720618531
1350 2720629939
1351 2720773634
1352 2721145634
1353 2721157151
1354 2721162513
1355 2721397865
1356 2722838683
1357 2723025305
1358 2723558890
1359 2723565460
1360 2724036675
1361 2724042967
1362 2724088241
1363 2724102725
1364 2724108621
1365 2725948965
1366 2730106241
1367 2730162778
1368 2730296783
1369 2738801269
1370 2738948277
1371 2739037045
1372 2753461320
1373 2766066595
1374 2792582947
1375 2792623834
1376 2792629786
1377 2792638119
1378 2793295238
1379 2793316358
1380 2793323410
1381 2793326196
1382 2793334256
1383 2793341834
1384 2793348171
1385 2793355761
1386 2793361540
1387 2793364646
1388 2802720339
1389 2802726159
1390 2802731677
1391 2802739428
1392 2802742570
1393 2802749275
1394 2804750891
1395 2805929341
1396 2805932400
1397 2806047573
1398 2806054992
1399 2806062106
1400 2806067168
1401 2806076489
1402 2819245293
1403 2821123603
1404 2838020254
1405 2838025773
1406 2838044457
1407 2838051530
1408 2838064005
1409 2838071080
1410 2838075345
1411 2838672425
1412 2838680554
1413 2838691613
1414 2838695413
1415 2838703833
1416 2838708790
1417 2838733903
1418 2838739363
1419 2838747033
1420 2841843261
1421 2841856174
1422 2841866843
1423 2842079975
1424 2842112179
1425 2842120594
1426 2842143043
1427 2842148375
1428 2842161962
1429 2842169662
1430 2842185804
1431 2842192855
1432 2842202924
1433 2842206982
1434 2842218825
1435 2842235332
1436 2842238201
1437 2842248213
1438 2842253441
1439 2842262193
1440 2842268792
1441 2842276586
1442 2842280325
1443 2842286807
1444 2842293636
1445 2842306532
1446 2842312652
1447 2842322483
1448 2842343105
1449 2842367170
1450 2842371017
1451 2842380033
1452 2842387104
1453 2842399217
1454 2842403640
1455 2842410658
1456 2842417304
1457 2842424696
1458 2842433008
1459 2842439313
1460 2842445942
1461 2842451877
1462 2842467128
1463 2842473844
1464 2842492491
1465 2842500071
1466 2842521667
1467 2842923292
1468 2844170786
1469 2844456022
1470 2847417650
1471 2848992455
1472 2850079951
1473 2854898240
1474 2854919922
1475 2855831746
1476 2855839970
1477 2855874562
1478 2857523470
1479 2857531167
1480 2858803943
1481 2896391581
1482 2899805332
1483 2913298018
1484 2913313381
1485 2915980758
1486 2915987509
1487 2915999713
1488 2916002025
1489 2916008016
1490 2916015450
1491 2916022119
1492 2916031059
1493 2916040771
1494 2916045598
1495 2916050215
1496 2916057377
1497 2916063675
1498 2916074169
1499 2916081856
1500 2919101380
1501 2919172116
1502 2920763421
1503 2920823344
1504 2921205214
1505 2921209123
1506 2921244039
1507 2921250348
1508 2921257184
1509 2921260373
1510 2921266452
1511 2921288379
1512 2921289926
1513 2921300072
1514 2923557115
1515 2924150102
1516 2924154408
1517 2924163468
1518 2924166348
1519 2924177981
1520 2924180889
1521 2924192621
1522 2924194318
1523 2924202663
1524 2924213272
1525 2924221173
1526 2924222399
1527 2924234804
1528 2933020390
1529 2933573601
1530 2933587508
1531 2933601879
1532 2935895937
1533 2935907195
1534 2936368959
1535 2936378425
1536 2936383713
1537 2936997905
1538 2937009313
1539 2937015776
1540 2937018740
1541 2937023794
1542 2937034554
1543 2937041285
1544 2937047565
1545 2937054023
1546 2937060630
1547 2937064650
1548 2937078032
1549 2937078766
1550 2937085903
1551 2937096899
1552 2937103475
1553 2937111546
1554 2937114702
1555 2937125174
1556 2937132322
1557 2941500743
1558 2957382082
1559 2957387613
1560 2957394041
1561 2957396154
1562 2957407932
1563 2957414595
1564 2957421538
1565 2957429651
1566 2957436991
1567 2957442613
1568 2957447153
1569 2957457303
1570 2957458117
1571 2957466289
1572 2957471425
1573 2957479758
1574 2957485091
1575 2957497766
1576 2957505113
1577 2957505976
1578 2960584407
1579 2960594741
1580 2960603111
1581 2960609358
1582 2960616903
1583 2960621671
1584 2960630949
1585 2960637482
1586 2960643544
1587 2960645800
1588 2960658318
1589 2960660437
1590 2960672912
1591 2960675263
1592 2960686586
1593 2960690297
1594 2960698849
1595 2964615213
1596 2964619783
1597 2964622366
1598 2964636042
1599 2964636434
1600 2964649269
1601 2964650306
1602 2964659439
1603 2964669675
1604 2964675805
1605 2964678722
1606 2964685472
1607 2964698041
1608 2964705343
1609 2964707159
1610 2964719261
1611 2964719955
1612 2967667648
1613 2967671911
1614 2967684932
1615 2967691500
1616 2967695044
1617 2967701161
1618 2967707407
1619 2967714638
1620 2967722487
1621 2967730533
1622 2967740762
1623 2967743844
1624 2967754574
1625 2967761272
1626 2967762714
1627 2967772808
1628 2967782489
1629 2970023347
1630 2970030554
1631 2970040396
1632 2970045464
1633 2970052655
1634 2970059745
1635 2970061995
1636 2970073368
1637 2970082247
1638 2970087726
1639 2970094799
1640 2970101488
1641 2970103340
1642 2970115823
1643 2970118590
1644 2970126272
1645 2970131542
1646 2970137557
1647 2970148515
1648 2970156609
1649 2970157544
1650 2970169531
1651 2970176539
1652 2970181925
1653 2970188482
1654 2970198593
1655 2977517375
1656 2977529159
1657 2977535836
1658 2977542100
1659 2977549490
1660 2977553652
1661 2977559460
1662 2977572003
1663 2977579223
1664 2977580412
1665 2989777393
1666 2996888484
1667 2996893403
1668 3005446152
1669 3005452812
1670 639646618
1671 643824514
1672 648740880
1673 8003992422
1674 8003999751
1675 8005247419
1676 8005263448
1677 8005278806
1678 8005289040
1679 8005291114
1680 8005301519
1681 8005309225
1682 8005323011
1683 8005377465
1684 8005387328
1685 8005400095
1686 8005432900
1687 8005460978
1688 8005498630
1689 8005543740
1690 8005560591
1691 8005563950
1692 8005576890
1693 8005619822
1694 8005628394
1695 8005670041
1696 8005690235
1697 8005699285
1698 8018133093
1699 8018153065
1700 8018168993
1701 8018178832
1702 8023684272
1703 8024480245
1704 8024501634
1705 8049293447
1706 8054461288
1707 8055433457
1708 8056375603
1709 8056385917
1710 8057876017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map