F483632

General Info

Members Datasets Scaffolds Average Seq Length
855 362 773 295

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0005174|Ga0495583_0005174_4262_5311
Length 349
Sequence MWALACDADHSFYPAYRVDFIAGKPAPTHFMNNPSTLSPLPRTPRDSRMQAIITRSHSMFAGFQKDQCHVNGVDISYRKGGTGPGLLLLHGHPQTHVIWHKVAEQLAEHFTVVAADLRGYGDSSRPPANDHHTNYSKREMARDGVELMQALGFAQFSLLAHDRGARVAHRLALDHPEAVQRMVLLDIAPTLSMYAQTDEAFARAYWHWFFLIRPAPLPEALIESNPELYLRSVMGSRSAGLKPFTDEAFADYLRCLKLPGSATGICEDYRAAAGIDLEHDQADIDAGNHLNLPLLVMWGAEGTVGRCFEPLKEWQKVATDVRGKALPAGHYIAEEAPELLLGEVLAFLR

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2511231011 Pseudomonas sp. GM30 Isolate Nodule
4 2511231018 Pseudomonas sp. GM60 Isolate Nodule
5 2511231019 Pseudomonas sp. GM67 Isolate Nodule
6 2511231023 Pseudomonas sp. GM80 Isolate Nodule
7 2511231031 Pseudomonas sp. GM16 Isolate Nodule
8 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
9 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
10 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
11 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
12 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
13 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
14 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
15 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
16 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
17 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
18 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
19 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
20 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
21 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
22 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
23 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
24 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
25 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
26 2773857670 Pseudomonas sp. 478 Isolate Unclassified
27 2773857673 Pseudomonas sp. 443 Isolate Unclassified
28 2784132063 Pseudomonas sp. 424 Isolate Unclassified
29 2784132072 Pseudomonas sp. 460 Isolate Unclassified
30 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
31 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
32 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
33 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
34 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
35 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
36 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
37 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
38 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
39 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
40 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
41 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
42 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
43 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
44 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
45 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
46 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
47 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
48 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
49 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
50 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
51 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
52 2885266251 Ralstonia sp. SET104 Isolate Nodule
53 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
54 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
55 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
56 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
57 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
58 2919150387 Rahnella aceris 1817 Isolate Unclassified
59 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
60 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
61 2927143783 Rahnella sp. 2050 Isolate Unclassified
62 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
63 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
64 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
65 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
66 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
67 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
68 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
69 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
70 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
71 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
72 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
73 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
74 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
75 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
76 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
77 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
78 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
79 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
80 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
81 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
82 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
83 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
84 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
85 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
86 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
87 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
88 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
89 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
90 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
91 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
92 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
93 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
94 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
95 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
96 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
97 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
98 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
99 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
102 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
103 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
104 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
105 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
106 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
117 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
118 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
119 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
120 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
121 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
122 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
123 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
126 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
127 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
129 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
130 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
135 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
138 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
158 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
162 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
169 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
170 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
171 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
174 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
212 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
232 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
233 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
234 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
235 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
236 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
237 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
238 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
239 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
240 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
241 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
242 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
243 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
244 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
282 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
297 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
298 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
299 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
308 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
309 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
332 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
333 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
336 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
337 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
340 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
341 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
342 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
343 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
344 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
345 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
346 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
349 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
352 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
353 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
354 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
355 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
356 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
357 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
358 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
359 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
360 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
361 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
362 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.41
Metatranscriptomes 0
Isolates 9.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.24
Nodule 1.64
Rhizoplane 2.34
Rhizosphere 75.91
Stem 0
Stem Tuber 0
Unclassified 10.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000456 3300002704 Bacteria 10447
2 JGI25156J39149_1004331 3300002705 Bacteria 4353
3 JGI25154J39366_1000291 3300002738 Bacteria 30050
4 JGI25163J39215_1000003 3300002771 Bacteria 149140
5 JGI25164J39214_1000041 3300002772 Bacteria 127466
6 JGI25151J46595_10001449 3300003187 Bacteria 16081
7 Ga0055538_1000003 3300003751 Bacteria 663004
8 Ga0055539_1000003 3300003752 Bacteria 663004
9 Ga0055533_1000005 3300003756 Bacteria 663004
10 Ga0055525_1000005 3300003759 Bacteria 663004
11 Ga0055526_1000917 3300003771 Bacteria 21919
12 Ga0055526_1002371 3300003771 Bacteria 12763
13 Ga0055526_1008492 3300003771 Bacteria 5117
14 Ga0055526_1011889 3300003771 Bacteria 3862
15 Ga0055526_1013063 3300003771 Bacteria 3550
16 Ga0055524_1000557 3300003775 Bacteria 28144
17 Ga0055524_1012040 3300003775 Bacteria 3342
18 Ga0055536_1000031 3300003781 Bacteria 151112
19 Ga0055536_1000198 3300003781 Bacteria 49612
20 Ga0055534_1001179 3300003784 Bacteria 10987
21 Ga0055530_10000259 3300003791 Bacteria 47742
22 Ga0055540_1000105 3300003792 Bacteria 93593
23 Ga0055531_10000081 3300003794 Bacteria 103600
24 Ga0055541_1000003 3300003841 Bacteria 663004
25 Ga0055541_1008295 3300003841 Bacteria 1661
26 Ga0065714_10002505 3300005288 Bacteria 22372
27 Ga0065714_10067698 3300005288 Bacteria 5246
28 Ga0065714_10071937 3300005288 Bacteria 3465
29 Ga0065714_10098434 3300005288 Bacteria 1711
30 Ga0065714_10108719 3300005288 Bacteria 1511
31 Ga0070676_10275990 3300005328 Bacteria 1131
32 Ga0070670_100007654 3300005331 Bacteria 9179
33 Ga0068869_100071545 3300005334 Bacteria 2568
34 Ga0070668_100002511 3300005347 Bacteria 13515
35 Ga0070669_100006394 3300005353 Bacteria 8482
36 Ga0070669_100063928 3300005353 Bacteria 2709
37 Ga0070675_100111992 3300005354 Bacteria 2310
38 Ga0070674_100095734 3300005356 Bacteria 2153
39 Ga0070659_100001434 3300005366 Bacteria 17182
40 Ga0070667_100287197 3300005367 Bacteria 1478
41 Ga0070701_10167209 3300005438 Bacteria 1278
42 Ga0070700_100001656 3300005441 Bacteria 11153
43 Ga0070662_100019335 3300005457 Bacteria 4623
44 Ga0068867_100049492 3300005459 Bacteria 3094
45 Ga0068853_100048670 3300005539 Bacteria 3642
46 Ga0068853_100404867 3300005539 Bacteria 1278
47 Ga0070672_100078917 3300005543 Bacteria 2634
48 Ga0070672_100091113 3300005543 Bacteria 2460
49 Ga0070665_100013666 3300005548 Bacteria 8167
50 Ga0070665_100034111 3300005548 Bacteria 5118
51 Ga0070665_100345641 3300005548 Bacteria 1493
52 Ga0070664_100192217 3300005564 Bacteria 1819
53 Ga0068854_100079243 3300005578 Bacteria 2421
54 Ga0068852_100304461 3300005616 Bacteria 1544
55 Ga0068859_100056948 3300005617 Bacteria 3937
56 Ga0068861_100060140 3300005719 Bacteria 2911
57 Ga0068851_10000251 3300005834 Bacteria 25318
58 Ga0068851_10040259 3300005834 Bacteria 2349
59 Ga0068860_100139990 3300005843 Bacteria 2325
60 Ga0075365_10027755 3300006038 Bacteria 3605
61 Ga0075368_10002741 3300006042 Bacteria 5814
62 Ga0075363_100003970 3300006048 Bacteria 6394
63 Ga0075364_10019688 3300006051 Bacteria 4238
64 Ga0075362_10006218 3300006177 Bacteria 4436
65 Ga0075362_10045025 3300006177 Bacteria 1959
66 Ga0075367_10004049 3300006178 Bacteria 7090
67 Ga0075369_10008317 3300006186 Bacteria 3990
68 Ga0075366_10008293 3300006195 Bacteria 5772
69 Ga0075366_10025355 3300006195 Bacteria 3462
70 Ga0097621_100006028 3300006237 Bacteria 8568
71 Ga0075370_10044048 3300006353 Bacteria 2522
72 Ga0075428_100078978 3300006844 Bacteria 3591
73 Ga0075430_100079162 3300006846 Bacteria 2755
74 Ga0075429_100107193 3300006880 Bacteria 2441
75 Ga0068865_100123527 3300006881 Bacteria 1929
76 Ga0097620_100056947 3300006931 Bacteria 3937
77 Ga0079104_1002600 3300006946 Bacteria 9462
78 Ga0079104_1012703 3300006946 Bacteria 2630
79 Ga0099826_10000007 3300006948 Bacteria 393518
80 Ga0105251_10000032 3300009011 Bacteria 120825
81 Ga0105251_10000078 3300009011 Bacteria 93496
82 Ga0105251_10001024 3300009011 Bacteria 24532
83 Ga0105251_10007444 3300009011 Bacteria 6744
84 Ga0105251_10008460 3300009011 Bacteria 6188
85 Ga0105251_10015827 3300009011 Bacteria 4104
86 Ga0105251_10033813 3300009011 Bacteria 2534
87 Ga0105251_10088032 3300009011 Bacteria 1429
88 Ga0105244_10000190 3300009036 Bacteria 62853
89 Ga0105244_10001075 3300009036 Bacteria 22766
90 Ga0105244_10002651 3300009036 Bacteria 13407
91 Ga0105244_10002693 3300009036 Bacteria 13288
92 Ga0105244_10008972 3300009036 Bacteria 6188
93 Ga0105244_10034704 3300009036 Bacteria 2654
94 Ga0105244_10098827 3300009036 Bacteria 1429
95 Ga0105250_10000241 3300009092 Bacteria 45446
96 Ga0105250_10000265 3300009092 Bacteria 42626
97 Ga0105250_10000560 3300009092 Bacteria 25085
98 Ga0105250_10000898 3300009092 Bacteria 17524
99 Ga0105250_10004003 3300009092 Bacteria 6875
100 Ga0105250_10024377 3300009092 Bacteria 2438
101 Ga0105250_10086517 3300009092 Bacteria 1272
102 Ga0105250_10096169 3300009092 Bacteria 1207
103 Ga0105240_10000250 3300009093 Bacteria 107111
104 Ga0111539_10034048 3300009094 Bacteria 6180
105 Ga0105243_10000103 3300009148 Bacteria 97091
106 Ga0105243_10041967 3300009148 Bacteria 3579
107 Ga0105248_10082872 3300009177 Bacteria 3608
108 Ga0105237_10787463 3300009545 Bacteria 958
109 Ga0105238_10410435 3300009551 Bacteria 1348
110 Ga0105249_10230243 3300009553 Bacteria 1827
111 Ga0105239_10133659 3300010375 Bacteria 2761
112 Ga0105246_10000793 3300011119 Bacteria 17916
113 Ga0157345_1000009 3300012498 Bacteria 55332
114 Ga0157373_10000151 3300013100 Bacteria 55916
115 Ga0157373_10001540 3300013100 Bacteria 17590
116 Ga0157373_10005442 3300013100 Bacteria 9563
117 Ga0157373_10006919 3300013100 Bacteria 8442
118 Ga0157373_10014276 3300013100 Bacteria 5825
119 Ga0157373_10119422 3300013100 Bacteria 1853
120 Ga0157371_10000115 3300013102 Bacteria 122316
121 Ga0157371_10000306 3300013102 Bacteria 64149
122 Ga0157371_10156859 3300013102 Bacteria 1625
123 Ga0157370_10001398 3300013104 Bacteria 29918
124 Ga0157369_10000424 3300013105 Bacteria 56027
125 Ga0157369_10002940 3300013105 Bacteria 20374
126 Ga0157369_10017481 3300013105 Bacteria 8058
127 Ga0157369_10222437 3300013105 Bacteria 1975
128 Ga0163162_10000072 3300013306 Bacteria 92818
129 Ga0163162_10022682 3300013306 Bacteria 6189
130 Ga0163162_10028461 3300013306 Bacteria 5530
131 Ga0163162_10115389 3300013306 Bacteria 2785
132 Ga0157372_10006797 3300013307 Bacteria 12161
133 Ga0157375_10001580 3300013308 Bacteria 19586
134 Ga0157375_10033744 3300013308 Bacteria 4867
135 Ga0157375_10092800 3300013308 Bacteria 3083
136 Ga0157375_10246777 3300013308 Bacteria 1946
137 Ga0163163_10024518 3300014325 Bacteria 5741
138 Ga0182008_10001385 3300014497 Bacteria 16413
139 Ga0182008_10006061 3300014497 Bacteria 6800
140 Ga0182008_10115977 3300014497 Bacteria 1329
141 Ga0182006_1001126 3300015261 Bacteria 16985
142 Ga0182006_1008860 3300015261 Bacteria 4542
143 Ga0182006_1024079 3300015261 Bacteria 2514
144 Ga0182006_1024149 3300015261 Bacteria 2509
145 Ga0182006_1042833 3300015261 Bacteria 1772
146 Ga0182007_10001148 3300015262 Bacteria 14345
147 Ga0182007_10003193 3300015262 Bacteria 7827
148 Ga0182007_10008808 3300015262 Bacteria 4116
149 Ga0163161_10000156 3300017792 Bacteria 63154
150 Ga0163161_10009883 3300017792 Bacteria 6609
151 Ga0163161_10011283 3300017792 Bacteria 6191
152 Ga0163161_10219868 3300017792 Bacteria 1470
153 Ga0209435_100067 3300025206 Bacteria 66388
154 Ga0209760_100002 3300025207 Bacteria 274743
155 Ga0209784_100001 3300025224 Bacteria 3600592
156 Ga0209566_100001 3300025225 Bacteria 3600765
157 Ga0209674_100002 3300025226 Bacteria 3600592
158 Ga0209563_100002 3300025230 Bacteria 2045675
159 Ga0209563_100345 3300025230 Bacteria 17647
160 Ga0207427_100009 3300025231 Bacteria 663036
161 Ga0209437_100001 3300025233 Bacteria 2045675
162 Ga0209437_100272 3300025233 Bacteria 77336
163 Ga0209646_1000061 3300025246 Bacteria 255495
164 Ga0209026_1003054 3300025250 Bacteria 5746
165 Ga0209677_100002 3300025253 Bacteria 2045675
166 Ga0209148_1000603 3300025254 Bacteria 32352
167 Ga0209759_1000209 3300025256 Bacteria 90642
168 Ga0209759_1025262 3300025256 Bacteria 1268
169 Ga0209565_1000374 3300025263 Bacteria 38256
170 Ga0209455_1000613 3300025272 Bacteria 22668
171 Ga0209673_1009477 3300025273 Bacteria 4210
172 Ga0209675_1000231 3300025291 Bacteria 56755
173 Ga0209675_1003651 3300025291 Bacteria 7212
174 Ga0209675_1004819 3300025291 Bacteria 5853
175 Ga0209676_1000010 3300025292 Bacteria 954025
176 Ga0209676_1000036 3300025292 Bacteria 457623
177 Ga0209025_1000345 3300025294 Bacteria 100876
178 Ga0209025_1001077 3300025294 Bacteria 39567
179 Ga0209025_1001122 3300025294 Bacteria 38354
180 Ga0209025_1031182 3300025294 Bacteria 2529
181 Ga0209564_1000878 3300025295 Bacteria 39964
182 Ga0209564_1001207 3300025295 Bacteria 29501
183 Ga0209564_1001260 3300025295 Bacteria 27874
184 Ga0209050_1000081 3300025298 Bacteria 267533
185 Ga0209256_1000244 3300025299 Bacteria 96646
186 Ga0209256_1000846 3300025299 Bacteria 38261
187 Ga0209051_1000185 3300025303 Bacteria 110195
188 Ga0209051_1035482 3300025303 Bacteria 1855
189 Ga0209257_1000040 3300025304 Bacteria 538759
190 Ga0207656_10000094 3300025321 Bacteria 33269
191 Ga0207696_1000169 3300025711 Bacteria 103182
192 Ga0207696_1000193 3300025711 Bacteria 94161
193 Ga0207696_1000363 3300025711 Bacteria 45454
194 Ga0207696_1002805 3300025711 Bacteria 8269
195 Ga0207696_1015195 3300025711 Bacteria 2615
196 Ga0207696_1016556 3300025711 Bacteria 2462
197 Ga0207696_1030319 3300025711 Bacteria 1644
198 Ga0207655_1000006 3300025728 Bacteria 861092
199 Ga0207655_1000283 3300025728 Bacteria 77444
200 Ga0207655_1000551 3300025728 Bacteria 46983
201 Ga0207655_1003813 3300025728 Bacteria 10999
202 Ga0207655_1004649 3300025728 Bacteria 9632
203 Ga0207655_1005210 3300025728 Bacteria 8934
204 Ga0207655_1005395 3300025728 Bacteria 8704
205 Ga0207655_1005834 3300025728 Bacteria 8269
206 Ga0207655_1018643 3300025728 Bacteria 3668
207 Ga0207655_1022189 3300025728 Bacteria 3192
208 Ga0207713_1000020 3300025735 Bacteria 359258
209 Ga0207713_1000060 3300025735 Bacteria 213145
210 Ga0207713_1001221 3300025735 Bacteria 21470
211 Ga0207713_1002183 3300025735 Bacteria 14508
212 Ga0207713_1007911 3300025735 Bacteria 6195
213 Ga0207713_1011205 3300025735 Bacteria 4897
214 Ga0207713_1013068 3300025735 Bacteria 4400
215 Ga0207713_1029853 3300025735 Bacteria 2435
216 Ga0207713_1061162 3300025735 Bacteria 1434
217 Ga0207713_1075603 3300025735 Bacteria 1228
218 Ga0207680_10011842 3300025903 Bacteria 4423
219 Ga0207695_10000615 3300025913 Bacteria 71501
220 Ga0207695_10038879 3300025913 Bacteria 5117
221 Ga0207681_10002725 3300025923 Bacteria 11187
222 Ga0207681_10004592 3300025923 Bacteria 8495
223 Ga0207650_10001093 3300025925 Bacteria 20031
224 Ga0207659_10026434 3300025926 Bacteria 3916
225 Ga0207690_10007146 3300025932 Bacteria 6631
226 Ga0207706_10000668 3300025933 Bacteria 36073
227 Ga0207706_10020727 3300025933 Bacteria 5906
228 Ga0207709_10000035 3300025935 Bacteria 300968
229 Ga0207691_10025239 3300025940 Bacteria 5580
230 Ga0207689_10157497 3300025942 Bacteria 1872
231 Ga0207679_10256009 3300025945 Bacteria 1491
232 Ga0207667_10043443 3300025949 Bacteria 4769
233 Ga0207668_10001796 3300025972 Bacteria 12529
234 Ga0207640_10058929 3300025981 Bacteria 2532
235 Ga0207658_10264705 3300025986 Bacteria 1467
236 Ga0207639_10064389 3300026041 Bacteria 2842
237 Ga0207708_10008158 3300026075 Bacteria 7755
238 Ga0207702_10180179 3300026078 Bacteria 1945
239 Ga0207648_10066643 3300026089 Bacteria 3140
240 Ga0207676_10282026 3300026095 Bacteria 1509
241 Ga0207675_100008666 3300026118 Bacteria 9560
242 Ga0207698_10001442 3300026142 Bacteria 13816
243 Ga0209281_1008310 3300027111 Bacteria 2530
244 Ga0209371_1001498 3300027312 Bacteria 15558
245 Ga0209282_1000021 3300027666 Bacteria 177705
246 Ga0268266_10279974 3300028379 Bacteria 1550
247 Ga0268266_10307467 3300028379 Bacteria 1481
248 Ga0268265_10028981 3300028380 Bacteria 3969
249 Ga0268256_1003139 3300030500 Bacteria 7700
250 Ga0265316_10121215 3300031344 Bacteria 1975
251 Ga0307408_100000074 3300031548 Bacteria 111955
252 Ga0307408_100022868 3300031548 Bacteria 4253
253 Ga0307408_100270786 3300031548 Bacteria 1410
254 Ga0265314_10002266 3300031711 Bacteria 19921
255 Ga0316576_10140034 3300031727 Unclassified 1821
256 Ga0307406_10157227 3300031901 Bacteria 1629
257 Ga0307407_10154153 3300031903 Bacteria 1496
258 Ga0307412_10000459 3300031911 Bacteria 24584
259 Ga0307412_10000594 3300031911 Bacteria 21381
260 Ga0307409_100164708 3300031995 Bacteria 1944
261 Ga0307409_100164730 3300031995 Bacteria 1944
262 Ga0307416_100201264 3300032002 Bacteria 1890
263 Ga0307414_10012907 3300032004 Bacteria 4958
264 Ga0307414_10048154 3300032004 Bacteria 2939
265 Ga0307414_10167632 3300032004 Bacteria 1752
266 Ga0307414_10307432 3300032004 Bacteria 1344
267 Ga0307411_10002996 3300032005 Bacteria 7690
268 Ga0307411_10005887 3300032005 Bacteria 6082
269 Ga0307411_10032567 3300032005 Bacteria 3222
270 Ga0307411_10111223 3300032005 Bacteria 1961
271 Ga0307510_10000265 3300033180 Bacteria 47882
272 Ga0316574_0127431 3300035398 Bacteria 1637
273 Ga0395905_0009894 3300037471 Bacteria 9293
274 Ga0237819_00585 3300038705 Bacteria 12172
275 Ga0439438_000190 3300041405 Bacteria 27711
276 Ga0439447_012306 3300041407 Bacteria 2463
277 Ga0451793_0439505 3300041452 Bacteria 6531
278 Ga0451839_0364642 3300041496 Bacteria 2657
279 Ga0451841_0330586 3300041498 Bacteria 5744
280 Ga0439432_000450 3300042006 Bacteria 15331
281 Ga0439432_002490 3300042006 Bacteria 6938
282 Ga0439456_008369 3300042013 Bacteria 2134
283 Ga0439456_009091 3300042013 Bacteria 2052
284 Ga0439463_000246 3300042016 Bacteria 14986
285 Ga0439463_005777 3300042016 Bacteria 3071
286 Ga0450911_000060 3300042115 Bacteria 44515
287 Ga0450903_006129 3300042138 Bacteria 2007
288 Ga0450889_006281 3300042144 Bacteria 1191
289 Ga0450906_000025 3300042145 Bacteria 27046
290 Ga0450893_0000671 3300042532 Bacteria 4924
291 Ga0453684_0044496 3300044712 Bacteria 5938
292 Ga0466958_0084182 3300045836 Bacteria 1961
293 Ga0466967_0062113 3300045976 Bacteria 3316
294 Ga0495617_005002 3300046452 Bacteria 4761
295 Ga0495617_005622 3300046452 Bacteria 4434
296 Ga0495617_021300 3300046452 Bacteria 2189
297 Ga0495627_000062 3300046453 Bacteria 138772
298 Ga0495627_000239 3300046453 Bacteria 57647
299 Ga0495627_001016 3300046453 Bacteria 18819
300 Ga0495627_001778 3300046453 Bacteria 11550
301 Ga0495627_002540 3300046453 Bacteria 8672
302 Ga0495627_004978 3300046453 Bacteria 5451
303 Ga0495627_023743 3300046453 Bacteria 2005
304 Ga0495627_028690 3300046453 Bacteria 1776
305 Ga0495603_0002114 3300046455 Bacteria 11680
306 Ga0495590_0010664 3300046457 Bacteria 3445
307 Ga0495590_0026410 3300046457 Bacteria 2039
308 Ga0495591_000107 3300046458 Bacteria 95742
309 Ga0495591_000323 3300046458 Bacteria 43207
310 Ga0495591_000774 3300046458 Bacteria 23026
311 Ga0495591_001826 3300046458 Bacteria 12581
312 Ga0495591_002165 3300046458 Bacteria 11255
313 Ga0495591_003014 3300046458 Bacteria 8962
314 Ga0495591_003018 3300046458 Bacteria 8960
315 Ga0495591_003943 3300046458 Bacteria 7447
316 Ga0495591_005561 3300046458 Bacteria 5796
317 Ga0495591_008120 3300046458 Bacteria 4338
318 Ga0495591_008413 3300046458 Bacteria 4227
319 Ga0495591_013632 3300046458 Bacteria 2961
320 Ga0495591_053093 3300046458 Bacteria 1100
321 Ga0495638_0004844 3300046460 Bacteria 10137
322 Ga0495638_0005423 3300046460 Bacteria 9492
323 Ga0495638_0008482 3300046460 Bacteria 7283
324 Ga0495638_0008864 3300046460 Bacteria 7100
325 Ga0495638_0013249 3300046460 Bacteria 5622
326 Ga0495638_0062264 3300046460 Bacteria 2303
327 Ga0495638_0113909 3300046460 Bacteria 1604
328 Ga0495638_0132234 3300046460 Bacteria 1464
329 Ga0495653_0000110 3300046463 Bacteria 68799
330 Ga0495653_0000525 3300046463 Bacteria 29386
331 Ga0495653_0035825 3300046463 Bacteria 3913
332 Ga0495650_0000018 3300046471 Bacteria 538888
333 Ga0495650_0003078 3300046471 Bacteria 12518
334 Ga0495650_0003101 3300046471 Bacteria 12466
335 Ga0495650_0004460 3300046471 Bacteria 9578
336 Ga0495650_0016488 3300046471 Bacteria 3739
337 Ga0495650_0021032 3300046471 Bacteria 3164
338 Ga0495650_0021270 3300046471 Bacteria 3140
339 Ga0495650_0029555 3300046471 Bacteria 2496
340 Ga0495650_0046200 3300046471 Bacteria 1828
341 Ga0495650_0096238 3300046471 Bacteria 1118
342 Ga0495605_0000006 3300046474 Bacteria 361304
343 Ga0495605_0000123 3300046474 Bacteria 101983
344 Ga0495605_0001256 3300046474 Bacteria 16814
345 Ga0495605_0001518 3300046474 Bacteria 15075
346 Ga0495605_0001744 3300046474 Bacteria 13927
347 Ga0495605_0001919 3300046474 Bacteria 13233
348 Ga0495605_0003862 3300046474 Bacteria 8892
349 Ga0495605_0008675 3300046474 Bacteria 5742
350 Ga0495605_0019405 3300046474 Bacteria 3630
351 Ga0495605_0021867 3300046474 Bacteria 3383
352 Ga0495605_0030415 3300046474 Bacteria 2769
353 Ga0495584_0000505 3300046491 Bacteria 26765
354 Ga0495584_0002338 3300046491 Bacteria 10807
355 Ga0495584_0002358 3300046491 Bacteria 10759
356 Ga0495584_0002635 3300046491 Bacteria 10114
357 Ga0495584_0005572 3300046491 Bacteria 6661
358 Ga0495584_0005622 3300046491 Bacteria 6627
359 Ga0495584_0012680 3300046491 Bacteria 4301
360 Ga0495584_0218813 3300046491 Bacteria 968
361 Ga0495585_0000228 3300046492 Bacteria 57922
362 Ga0495585_0001140 3300046492 Bacteria 21730
363 Ga0495585_0003921 3300046492 Bacteria 9852
364 Ga0495585_0004209 3300046492 Bacteria 9394
365 Ga0495585_0005289 3300046492 Bacteria 8155
366 Ga0495585_0007152 3300046492 Bacteria 6855
367 Ga0495594_0018727 3300046499 Bacteria 3670
368 Ga0495596_0000385 3300046500 Bacteria 28186
369 Ga0495596_0010024 3300046500 Bacteria 4145
370 Ga0495596_0066571 3300046500 Bacteria 1400
371 Ga0495596_0075126 3300046500 Bacteria 1312
372 Ga0495607_0000210 3300046501 Bacteria 62298
373 Ga0495607_0001376 3300046501 Bacteria 21622
374 Ga0495607_0001798 3300046501 Bacteria 18317
375 Ga0495607_0001929 3300046501 Bacteria 17511
376 Ga0495607_0002076 3300046501 Bacteria 16733
377 Ga0495607_0007597 3300046501 Bacteria 7476
378 Ga0495607_0011178 3300046501 Bacteria 5993
379 Ga0495607_0012233 3300046501 Bacteria 5672
380 Ga0495607_0012388 3300046501 Bacteria 5635
381 Ga0495607_0013606 3300046501 Bacteria 5327
382 Ga0495607_0038502 3300046501 Bacteria 2864
383 Ga0495607_0044697 3300046501 Bacteria 2610
384 Ga0495607_0058363 3300046501 Bacteria 2206
385 Ga0495607_0063015 3300046501 Bacteria 2099
386 Ga0495607_0067003 3300046501 Bacteria 2018
387 Ga0495607_0092095 3300046501 Bacteria 1640
388 Ga0495607_0108084 3300046501 Bacteria 1478
389 Ga0495583_0000036 3300046506 Bacteria 246077
390 Ga0495583_0000798 3300046506 Bacteria 38957
391 Ga0495583_0000984 3300046506 Bacteria 32650
392 Ga0495583_0001142 3300046506 Bacteria 28911
393 Ga0495583_0001347 3300046506 Bacteria 25452
394 Ga0495583_0002613 3300046506 Bacteria 15067
395 Ga0495583_0005174 3300046506 Bacteria 8983
396 Ga0495583_0006457 3300046506 Bacteria 7665
397 Ga0495583_0007233 3300046506 Bacteria 7028
398 Ga0495583_0042430 3300046506 Bacteria 2124
399 Ga0495606_0000098 3300046507 Bacteria 151131
400 Ga0495606_0000421 3300046507 Bacteria 70842
401 Ga0495606_0000782 3300046507 Bacteria 48702
402 Ga0495606_0000988 3300046507 Bacteria 41466
403 Ga0495606_0002509 3300046507 Bacteria 21176
404 Ga0495606_0002630 3300046507 Bacteria 20483
405 Ga0495606_0004727 3300046507 Bacteria 13409
406 Ga0495606_0013803 3300046507 Bacteria 6351
407 Ga0495606_0027248 3300046507 Bacteria 4056
408 Ga0495606_0042999 3300046507 Bacteria 3018
409 Ga0495606_0182470 3300046507 Bacteria 1209
410 Ga0495610_0000780 3300046512 Bacteria 29954
411 Ga0495610_0000916 3300046512 Bacteria 27419
412 Ga0495610_0002584 3300046512 Bacteria 15022
413 Ga0495610_0003306 3300046512 Bacteria 12676
414 Ga0495610_0009530 3300046512 Bacteria 6127
415 Ga0495610_0013697 3300046512 Bacteria 4803
416 Ga0495610_0024880 3300046512 Bacteria 3224
417 Ga0495610_0101475 3300046512 Bacteria 1288
418 Ga0495616_0000168 3300046513 Bacteria 56324
419 Ga0495616_0001463 3300046513 Bacteria 16397
420 Ga0495616_0004346 3300046513 Bacteria 8941
421 Ga0495616_0005711 3300046513 Bacteria 7619
422 Ga0495616_0005991 3300046513 Bacteria 7415
423 Ga0495616_0023032 3300046513 Bacteria 3356
424 Ga0495616_0051554 3300046513 Bacteria 2052
425 Ga0495616_0108712 3300046513 Bacteria 1290
426 Ga0495616_0134382 3300046513 Bacteria 1131
427 Ga0495620_0000001 3300046515 Bacteria 386508
428 Ga0495620_0000184 3300046515 Bacteria 48200
429 Ga0495620_0000955 3300046515 Bacteria 17780
430 Ga0495620_0001339 3300046515 Bacteria 14955
431 Ga0495620_0001469 3300046515 Bacteria 14091
432 Ga0495620_0002022 3300046515 Bacteria 11834
433 Ga0495620_0003675 3300046515 Bacteria 8761
434 Ga0495620_0006280 3300046515 Bacteria 6539
435 Ga0495620_0007910 3300046515 Bacteria 5737
436 Ga0495620_0013303 3300046515 Bacteria 4219
437 Ga0495620_0041153 3300046515 Bacteria 2028
438 Ga0495631_0000221 3300046518 Bacteria 39142
439 Ga0495631_0003793 3300046518 Bacteria 8219
440 Ga0495631_0046869 3300046518 Bacteria 1899
441 Ga0495632_0000222 3300046519 Bacteria 57787
442 Ga0495632_0003153 3300046519 Bacteria 11920
443 Ga0495632_0003661 3300046519 Bacteria 10783
444 Ga0495632_0003969 3300046519 Bacteria 10261
445 Ga0495632_0007269 3300046519 Bacteria 6982
446 Ga0495632_0022406 3300046519 Bacteria 3386
447 Ga0495632_0023538 3300046519 Bacteria 3288
448 Ga0495632_0024825 3300046519 Bacteria 3178
449 Ga0495632_0033388 3300046519 Bacteria 2642
450 Ga0495632_0054912 3300046519 Bacteria 1951
451 Ga0495632_0067709 3300046519 Bacteria 1721
452 Ga0495632_0073817 3300046519 Bacteria 1635
453 Ga0495632_0075300 3300046519 Bacteria 1615
454 Ga0495637_0000181 3300046520 Bacteria 48899
455 Ga0495637_0000465 3300046520 Bacteria 29588
456 Ga0495637_0000590 3300046520 Bacteria 25917
457 Ga0495637_0001443 3300046520 Bacteria 13998
458 Ga0495637_0001971 3300046520 Bacteria 11600
459 Ga0495637_0002205 3300046520 Bacteria 10889
460 Ga0495637_0004032 3300046520 Bacteria 7670
461 Ga0495637_0006073 3300046520 Bacteria 6100
462 Ga0495637_0038036 3300046520 Bacteria 2085
463 Ga0495637_0044395 3300046520 Bacteria 1892
464 Ga0495637_0072503 3300046520 Bacteria 1386
465 Ga0495637_0080572 3300046520 Bacteria 1298
466 Ga0495643_0002208 3300046522 Bacteria 15866
467 Ga0495643_0006539 3300046522 Bacteria 7667
468 Ga0495643_0008185 3300046522 Bacteria 6648
469 Ga0495643_0008354 3300046522 Bacteria 6562
470 Ga0495643_0056022 3300046522 Bacteria 2105
471 Ga0495644_0000783 3300046523 Bacteria 13069
472 Ga0495644_0005330 3300046523 Bacteria 5020
473 Ga0495648_0001614 3300046524 Bacteria 21924
474 Ga0495648_0001703 3300046524 Bacteria 21263
475 Ga0495648_0002271 3300046524 Bacteria 17946
476 Ga0495648_0002636 3300046524 Bacteria 16295
477 Ga0495648_0004515 3300046524 Bacteria 11869
478 Ga0495648_0004683 3300046524 Bacteria 11602
479 Ga0495648_0009594 3300046524 Bacteria 7470
480 Ga0495648_0010027 3300046524 Bacteria 7263
481 Ga0495648_0011326 3300046524 Bacteria 6727
482 Ga0495666_0027101 3300046526 Bacteria 2821
483 Ga0495666_0167631 3300046526 Bacteria 1016
484 Ga0495642_0052170 3300046528 Bacteria 1684
485 Ga0495652_0400853 3300046529 Bacteria 971
486 Ga0495654_0000111 3300046530 Bacteria 92977
487 Ga0495654_0000192 3300046530 Bacteria 59720
488 Ga0495654_0000478 3300046530 Bacteria 33081
489 Ga0495654_0001785 3300046530 Bacteria 14345
490 Ga0495654_0002127 3300046530 Bacteria 12936
491 Ga0495654_0007333 3300046530 Bacteria 6176
492 Ga0495654_0011790 3300046530 Bacteria 4719
493 Ga0495654_0027206 3300046530 Bacteria 2934
494 Ga0495654_0035686 3300046530 Bacteria 2501
495 Ga0495654_0036637 3300046530 Bacteria 2464
496 Ga0495654_0044214 3300046530 Bacteria 2203
497 Ga0495654_0109104 3300046530 Bacteria 1264
498 Ga0495587_0001739 3300046536 Bacteria 14536
499 Ga0495587_0017000 3300046536 Bacteria 4523
500 Ga0495609_0000029 3300046538 Bacteria 217067
501 Ga0495609_0000034 3300046538 Bacteria 201125
502 Ga0495609_0000035 3300046538 Bacteria 196269
503 Ga0495609_0000329 3300046538 Bacteria 41907
504 Ga0495609_0001540 3300046538 Bacteria 15127
505 Ga0495609_0002051 3300046538 Bacteria 12691
506 Ga0495609_0005908 3300046538 Bacteria 6325
507 Ga0495609_0010480 3300046538 Bacteria 4443
508 Ga0495609_0026795 3300046538 Bacteria 2637
509 Ga0495609_0041341 3300046538 Bacteria 2072
510 Ga0495597_0001453 3300046542 Bacteria 16962
511 Ga0495597_0009066 3300046542 Bacteria 4942
512 Ga0495597_0011627 3300046542 Bacteria 4263
513 Ga0495597_0013245 3300046542 Bacteria 3956
514 Ga0495597_0025233 3300046542 Bacteria 2737
515 Ga0495597_0029599 3300046542 Bacteria 2500
516 Ga0495597_0035257 3300046542 Bacteria 2257
517 Ga0495597_0050781 3300046542 Bacteria 1829
518 Ga0495597_0079311 3300046542 Bacteria 1406
519 Ga0495645_0066767 3300046543 Bacteria 2598
520 Ga0495622_0000911 3300046557 Bacteria 16047
521 Ga0495622_0012641 3300046557 Bacteria 3912
522 Ga0495622_0097134 3300046557 Bacteria 1351
523 Ga0495633_0000016 3300046558 Bacteria 250457
524 Ga0495633_0002557 3300046558 Bacteria 12755
525 Ga0495633_0006318 3300046558 Bacteria 7056
526 Ga0495633_0152762 3300046558 Bacteria 1066
527 Ga0495668_0001572 3300046616 Bacteria 21592
528 Ga0495668_0007142 3300046616 Bacteria 7187
529 Ga0495668_0035052 3300046616 Bacteria 2812
530 Ga0495668_0047839 3300046616 Bacteria 2374
531 Ga0495668_0081718 3300046616 Bacteria 1772
532 Ga0495634_0001755 3300046642 Bacteria 18787
533 Ga0495634_0013585 3300046642 Bacteria 5882
534 Ga0495611_0000107 3300046648 Bacteria 58046
535 Ga0495611_0000904 3300046648 Bacteria 16136
536 Ga0495611_0001132 3300046648 Bacteria 13971
537 Ga0495611_0152072 3300046648 Bacteria 1080
538 Ga0495625_0000004 3300046660 Bacteria 611314
539 Ga0495625_0000337 3300046660 Bacteria 71532
540 Ga0495625_0001089 3300046660 Bacteria 35275
541 Ga0495625_0001350 3300046660 Bacteria 30319
542 Ga0495625_0010814 3300046660 Bacteria 7511
543 Ga0495625_0035582 3300046660 Bacteria 3669
544 Ga0495625_0171577 3300046660 Bacteria 1448
545 Ga0495625_0213761 3300046660 Bacteria 1266
546 Ga0495635_0000856 3300046663 Bacteria 19937
547 Ga0495661_0000004 3300046665 Bacteria 555340
548 Ga0495661_0000041 3300046665 Bacteria 151138
549 Ga0495661_0000288 3300046665 Bacteria 57108
550 Ga0495661_0000443 3300046665 Bacteria 43820
551 Ga0495661_0007133 3300046665 Bacteria 7802
552 Ga0495661_0010296 3300046665 Bacteria 6386
553 Ga0495661_0011031 3300046665 Bacteria 6138
554 Ga0495661_0011768 3300046665 Bacteria 5926
555 Ga0495661_0098561 3300046665 Bacteria 1649
556 Ga0495661_0157789 3300046665 Bacteria 1220
557 Ga0495588_0003508 3300046674 Bacteria 6841
558 Ga0495623_0001646 3300046679 Bacteria 15007
559 Ga0495646_0003121 3300046680 Bacteria 10276
560 Ga0495646_0046235 3300046680 Bacteria 2654
561 Ga0495613_0016575 3300046689 Bacteria 5485
562 Ga0495613_0229319 3300046689 Bacteria 1301
563 Ga0495624_0000637 3300046690 Bacteria 27477
564 Ga0495624_0031549 3300046690 Bacteria 3443
565 Ga0495670_0000105 3300046691 Bacteria 37273
566 Ga0495670_0004953 3300046691 Bacteria 6541
567 Ga0495670_0062655 3300046691 Bacteria 1871
568 Ga0495671_0001925 3300046692 Bacteria 13325
569 Ga0495671_0002727 3300046692 Bacteria 11062
570 Ga0495671_0003072 3300046692 Bacteria 10368
571 Ga0495671_0003848 3300046692 Bacteria 9121
572 Ga0495671_0005396 3300046692 Bacteria 7492
573 Ga0495671_0016959 3300046692 Bacteria 3880
574 Ga0495671_0023908 3300046692 Bacteria 3189
575 Ga0495671_0029342 3300046692 Bacteria 2825
576 Ga0495671_0070792 3300046692 Bacteria 1713
577 Ga0495649_0002385 3300046694 Bacteria 13290
578 Ga0495649_0003729 3300046694 Bacteria 10130
579 Ga0495649_0005030 3300046694 Bacteria 8500
580 Ga0495649_0012142 3300046694 Bacteria 5026
581 Ga0495649_0024414 3300046694 Bacteria 3372
582 Ga0495649_0031427 3300046694 Bacteria 2927
583 Ga0495649_0032146 3300046694 Bacteria 2892
584 Ga0495649_0058343 3300046694 Bacteria 2080
585 Ga0495649_0060925 3300046694 Bacteria 2029
586 Ga0495589_0000278 3300046794 Bacteria 41647
587 Ga0495589_0007278 3300046794 Bacteria 5796
588 Ga0495589_0009224 3300046794 Bacteria 5132
589 Ga0495589_0017355 3300046794 Bacteria 3694
590 Ga0495600_0023735 3300046809 Bacteria 3945
591 Ga0495660_0000004 3300046810 Bacteria 1003183
592 Ga0495660_0000998 3300046810 Bacteria 20590
593 Ga0495660_0001470 3300046810 Bacteria 16027
594 Ga0495660_0001702 3300046810 Bacteria 14721
595 Ga0495660_0002168 3300046810 Bacteria 12650
596 Ga0495660_0002263 3300046810 Bacteria 12382
597 Ga0495660_0007379 3300046810 Bacteria 6457
598 Ga0495660_0007452 3300046810 Bacteria 6423
599 Ga0495660_0008421 3300046810 Bacteria 6037
600 Ga0495660_0010816 3300046810 Bacteria 5299
601 Ga0495660_0013777 3300046810 Bacteria 4686
602 Ga0495660_0044274 3300046810 Bacteria 2449
603 Ga0495660_0058751 3300046810 Bacteria 2070
604 Ga0495604_0098533 3300047317 Bacteria 2153
605 Ga0495674_0024635 3300047319 Bacteria 5524
606 Ga0495672_0000672 3300047320 Bacteria 37986
607 Ga0495672_0002204 3300047320 Bacteria 18139
608 Ga0495672_0003725 3300047320 Bacteria 12852
609 Ga0495672_0013260 3300047320 Bacteria 5693
610 Ga0495672_0018945 3300047320 Bacteria 4554
611 Ga0495672_0044424 3300047320 Bacteria 2665
612 Ga0495672_0064285 3300047320 Bacteria 2101
613 Ga0495672_0145022 3300047320 Bacteria 1236
614 Ga0495676_0000023 3300047321 Bacteria 156478
615 Ga0495676_0000286 3300047321 Bacteria 40855
616 Ga0495676_0008721 3300047321 Bacteria 9279
617 Ga0495680_0020625 3300047322 Bacteria 5538
618 Ga0495680_0033183 3300047322 Bacteria 4181
619 Ga0495683_0000074 3300047323 Bacteria 100733
620 Ga0495683_0000270 3300047323 Bacteria 45608
621 Ga0495683_0004249 3300047323 Bacteria 8177
622 Ga0495683_0006486 3300047323 Bacteria 6392
623 Ga0495683_0082963 3300047323 Bacteria 1561
624 Ga0495675_0044149 3300047444 Bacteria 2839
625 Ga0495675_0048647 3300047444 Bacteria 2697
626 Ga0495679_000127 3300047446 Bacteria 67885
627 Ga0495679_000256 3300047446 Bacteria 44090
628 Ga0495679_000689 3300047446 Bacteria 21996
629 Ga0495679_001938 3300047446 Bacteria 11054
630 Ga0495679_003360 3300047446 Bacteria 7727
631 Ga0495679_021316 3300047446 Bacteria 2240
632 Ga0495679_024054 3300047446 Bacteria 2057
633 Ga0495679_035967 3300047446 Bacteria 1566
634 Ga0495673_0000297 3300047469 Bacteria 66473
635 Ga0495673_0000525 3300047469 Bacteria 40095
636 Ga0495673_0000537 3300047469 Bacteria 39215
637 Ga0495673_0001706 3300047469 Bacteria 16823
638 Ga0495673_0002220 3300047469 Bacteria 13970
639 Ga0495673_0002230 3300047469 Bacteria 13918
640 Ga0495673_0005283 3300047469 Bacteria 7846
641 Ga0495673_0008780 3300047469 Bacteria 5644
642 Ga0495673_0017386 3300047469 Bacteria 3655
643 Ga0495673_0021649 3300047469 Bacteria 3169
644 Ga0495673_0038788 3300047469 Bacteria 2164
645 Ga0495673_0040226 3300047469 Bacteria 2114
646 Ga0495673_0048287 3300047469 Bacteria 1877
647 Ga0495673_0112697 3300047469 Bacteria 1085
648 Ga0495681_0000448 3300047470 Bacteria 31537
649 Ga0495681_0000997 3300047470 Bacteria 21677
650 Ga0495681_0002274 3300047470 Bacteria 13804
651 Ga0495681_0002776 3300047470 Bacteria 12391
652 Ga0495681_0020296 3300047470 Bacteria 3608
653 Ga0495684_0012161 3300047471 Bacteria 6638
654 Ga0495686_0001277 3300047472 Bacteria 28463
655 Ga0495686_0005723 3300047472 Bacteria 9713
656 Ga0495686_0014979 3300047472 Bacteria 5316
657 Ga0495686_0021387 3300047472 Bacteria 4296
658 Ga0495593_0014260 3300047673 Bacteria 4519
659 Ga0495602_0001722 3300048088 Bacteria 21780
660 Ga0495626_0000213 3300048091 Bacteria 69180
661 Ga0495626_0000679 3300048091 Bacteria 32576
662 Ga0495626_0001952 3300048091 Bacteria 15321
663 Ga0495626_0003061 3300048091 Bacteria 10975
664 Ga0495626_0005451 3300048091 Bacteria 7444
665 Ga0495626_0035602 3300048091 Bacteria 2375
666 Ga0495626_0043695 3300048091 Bacteria 2101
667 Ga0496102_0000250 3300048905 Bacteria 70330
668 Ga0496102_0097756 3300048905 Bacteria 2723
669 Ga0496102_0257696 3300048905 Bacteria 1645
670 Ga0496103_0005141 3300048906 Bacteria 7875
671 Ga0496104_0001712 3300048907 Bacteria 18944
672 Ga0496104_0488667 3300048907 Bacteria 1142
673 Ga0496110_0351768 3300048913 Bacteria 1342
674 Ga0496115_0018650 3300048918 Bacteria 5333
675 Ga0496116_0000083 3300048919 Bacteria 220955
676 Ga0496116_0000869 3300048919 Bacteria 37701
677 Ga0496116_0007579 3300048919 Bacteria 9594
678 Ga0496116_0007720 3300048919 Bacteria 9472
679 Ga0496116_0021443 3300048919 Bacteria 4873
680 Ga0496116_0033974 3300048919 Bacteria 3608
681 Ga0496117_0003912 3300048920 Bacteria 16865
682 Ga0496117_0007554 3300048920 Bacteria 10590
683 Ga0496117_0014278 3300048920 Bacteria 6853
684 Ga0496117_0019755 3300048920 Bacteria 5521
685 Ga0496117_0031230 3300048920 Bacteria 4070
686 Ga0496117_0034545 3300048920 Bacteria 3807
687 Ga0496118_0010389 3300048921 Bacteria 9227
688 Ga0496118_0030089 3300048921 Bacteria 4541
689 Ga0496118_0037003 3300048921 Bacteria 3936
690 Ga0496118_0043591 3300048921 Bacteria 3523
691 Ga0496118_0056868 3300048921 Bacteria 2936
692 Ga0496118_0069452 3300048921 Bacteria 2551
693 Ga0496118_0072593 3300048921 Bacteria 2470
694 Ga0496119_0009151 3300048922 Bacteria 8560
695 Ga0496119_0032479 3300048922 Bacteria 3477
696 Ga0496119_0073694 3300048922 Bacteria 1990
697 Ga0496120_0024888 3300048923 Bacteria 3724
698 Ga0496120_0066605 3300048923 Bacteria 1991
699 Ga0496121_0001304 3300048924 Bacteria 42843
700 Ga0496121_0003384 3300048924 Bacteria 22840
701 Ga0496121_0009533 3300048924 Bacteria 11123
702 Ga0496121_0010014 3300048924 Bacteria 10777
703 Ga0496121_0013817 3300048924 Bacteria 8642
704 Ga0496121_0055027 3300048924 Bacteria 3319
705 Ga0496121_0077266 3300048924 Bacteria 2652
706 Ga0496121_0233319 3300048924 Bacteria 1287
707 Ga0496122_0000135 3300048925 Bacteria 170955
708 Ga0496122_0000408 3300048925 Bacteria 91323
709 Ga0496122_0007158 3300048925 Bacteria 12504
710 Ga0496122_0011943 3300048925 Bacteria 8716
711 Ga0496122_0039296 3300048925 Bacteria 3775
712 Ga0496122_0101003 3300048925 Bacteria 1928
713 Ga0496123_0000004 3300048926 Bacteria 777230
714 Ga0496123_0000188 3300048926 Bacteria 125135
715 Ga0496123_0000379 3300048926 Bacteria 83366
716 Ga0496123_0005659 3300048926 Bacteria 12477
717 Ga0496123_0005708 3300048926 Bacteria 12404
718 Ga0496123_0041025 3300048926 Bacteria 3215
719 Ga0496124_0000035 3300048927 Bacteria 318099
720 Ga0496124_0000140 3300048927 Bacteria 149743
721 Ga0496124_0002234 3300048927 Bacteria 25761
722 Ga0496124_0004218 3300048927 Bacteria 16920
723 Ga0496124_0004969 3300048927 Bacteria 15213
724 Ga0496124_0035873 3300048927 Bacteria 4333
725 Ga0496124_0118783 3300048927 Bacteria 2116
726 Ga0496124_0128894 3300048927 Bacteria 2012
727 Ga0496125_0000131 3300048928 Bacteria 162607
728 Ga0496125_0003931 3300048928 Bacteria 17527
729 Ga0496125_0007948 3300048928 Bacteria 11200
730 Ga0496125_0010597 3300048928 Bacteria 9312
731 Ga0496125_0010647 3300048928 Bacteria 9286
732 Ga0496125_0062983 3300048928 Bacteria 2961
733 Ga0496126_0000300 3300048929 Bacteria 105128
734 Ga0495678_000036 3300049459 Bacteria 198018
735 Ga0495678_000120 3300049459 Bacteria 91473
736 Ga0495678_000309 3300049459 Bacteria 52491
737 Ga0495678_000573 3300049459 Bacteria 34988
738 Ga0495678_002641 3300049459 Bacteria 11904
739 Ga0495678_002991 3300049459 Bacteria 10777
740 Ga0495678_005410 3300049459 Bacteria 7055
741 Ga0495678_009248 3300049459 Bacteria 4895
742 Ga0495678_009335 3300049459 Bacteria 4860
743 Ga0495678_022399 3300049459 Bacteria 2762
744 Ga0495682_0001294 3300049460 Bacteria 13917
745 Ga0495682_0002319 3300049460 Bacteria 9054
746 Ga0495682_0003273 3300049460 Bacteria 7249
747 Ga0495682_0035617 3300049460 Bacteria 1833
748 Ga0501040_0172239 3300049576 Bacteria 1533
749 Ga0501047_0000018 3300049581 Bacteria 274180
750 Ga0501069_0040124 3300049585 Bacteria 2587
751 Ga0501073_0117412 3300049589 Bacteria 1844
752 Ga0501075_0021465 3300049591 Bacteria 4708
753 Ga0501076_0304117 3300049592 Bacteria 1308
754 Ga0501222_000941 3300049662 Bacteria 4186
755 Ga0501227_001106 3300049665 Bacteria 5995
756 Ga0501241_000265 3300049758 Bacteria 11675
757 Ga0501269_003058 3300049766 Bacteria 2033
758 nmdc:mga03683_7748_c1 3300050489 Bacteria 3743
759 nmdc:mga03n38_10641_c1 3300050490 Bacteria 3394
760 nmdc:mga00v17_75291_c1 3300050491 Bacteria 2099
761 nmdc:mga0yw44_34475_c1 3300050492 Bacteria 2967
762 nmdc:mga0k408_5928_c1 3300050493 Bacteria 6517
763 nmdc:mga0k408_79045_c1 3300050493 Bacteria 1925
764 nmdc:mga06z11_7119_c1 3300050494 Bacteria 4591
765 nmdc:mga07m45_23895_c1 3300050496 Bacteria 2844
766 nmdc:mga08y16_222829_c1 3300050511 Bacteria 1952
767 nmdc:mga08y16_7016_c1 3300050511 Bacteria 11816
768 nmdc:mga0sz30_20244_c1 3300050516 Bacteria 2683
769 Ga0500646_0000782 3300053090 Bacteria 8892
770 Ga0500572_001586 3300053111 Bacteria 6030
771 Ga0500621_007988 3300053126 Bacteria 3502
772 Ga0500577_0015242 3300053142 Bacteria 2397
773 Ga0500634_0010006 3300053161 Bacteria 4828

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0040124 Ga0501069_0040124_783_1691 270
2 3300049581 Ga0501047_0000018 Ga0501047_0000018_267758_268663 277
3 3300046501 Ga0495607_0002076 Ga0495607_0002076_9093_10037 278
4 3300006195 Ga0075366_10025355 Ga0075366_100253555 281
5 3300050493 nmdc:mga0k408_79045_c1 nmdc:mga0k408_79045_c1_757_1674 281
6 3300049589 Ga0501073_0117412 Ga0501073_0117412_229_1122 283
7 iso_pu_bacteria 2511231010 2511290649 283
8 iso_pu_bacteria 2511231011 2511296339 283
9 iso_pu_bacteria 2511231018 2511340178 283
10 iso_pu_bacteria 2511231019 2511346442 283
11 iso_pu_bacteria 2511231023 2511372313 283
12 iso_pu_bacteria 2511231031 2511415306 283
13 iso_pu_bacteria 2599185167 2599401770 283
14 iso_pu_bacteria 2599185179 2599451585 283
15 iso_pu_bacteria 2599185190 2599515014 283
16 iso_pu_bacteria 2599185191 2599521115 283
17 iso_pu_bacteria 2599185290 2599894185 283
18 iso_pu_bacteria 2599185307 2599973139 283
19 iso_pu_bacteria 2600255283 2601628005 283
20 iso_pu_bacteria 2600255318 2601796181 283
21 iso_pu_bacteria 2603880185 2606073330 283
22 iso_pu_bacteria 2603880199 2606127024 283
23 iso_pu_bacteria 2623620443 2624481830 283
24 iso_pu_bacteria 2675903420 2677900950 283
25 iso_pu_bacteria 2713897148 2715753163 283
26 iso_pu_bacteria 2713897149 2715758133 283
27 iso_pu_bacteria 2718217725 2718635072 283
28 iso_pu_bacteria 2738543025 2739314161 283
29 iso_pu_bacteria 2773857670 2774123364 283
30 iso_pu_bacteria 2773857673 2774132735 283
31 iso_pu_bacteria 2784132063 2784263451 283
32 iso_pu_bacteria 2784132072 2784316094 283
33 iso_pu_bacteria 2808606361 2808854610 283
34 iso_pu_bacteria 2808606376 2808921746 283
35 iso_pu_bacteria 2808606377 2808930520 283
36 iso_pu_bacteria 2808606378 2808934718 283
37 iso_pu_bacteria 2808606380 2808943867 283
38 iso_pu_bacteria 2808606381 2808952642 283
39 iso_pu_bacteria 2808606382 2808957362 283
40 iso_pu_bacteria 2808606383 2808963115 283
41 iso_pu_bacteria 2808606389 2808998003 283
42 iso_pu_bacteria 2818991456 2819655570 283
43 iso_pu_bacteria 2834028612 2834029839 283
44 iso_pu_bacteria 2842832357 2842834713 283
45 iso_pu_bacteria 2842843487 2842843531 283
46 iso_pu_bacteria 2852657418 2852662430 283
47 iso_pu_bacteria 2860339153 2860340721 283
48 iso_pu_bacteria 2878029506 2878033814 283
49 iso_pu_bacteria 2880230671 2880234436 283
50 iso_pu_bacteria 2904518522 2904523960 283
51 iso_pu_bacteria 2908446538 2908448790 283
52 iso_pu_bacteria 2919063839 2919068800 283
53 iso_pu_bacteria 2919487758 2919492235 283
54 iso_pu_bacteria 2923586266 2923586705 283
55 iso_pu_bacteria 2931390751 2931392909 283
56 iso_pu_bacteria 2931396565 2931403274 283
57 iso_pu_bacteria 2945928738 2945928751 283
58 iso_pu_bacteria 2945961074 2945964967 283
59 iso_pu_bacteria 2946006987 2946010937 283
60 iso_pu_bacteria 2969304461 2969308586 283
61 iso_pu_bacteria 2998139840 2998142943 283
62 iso_pu_bacteria 3007419365 3007422262 283
63 iso_pu_bacteria 3007511990 3007515590 283
64 iso_pu_bacteria 3007614139 3007617247 283
65 iso_pu_bacteria 3007718800 3007718820 283
66 iso_pu_bacteria 8054285046 8054287587 283
67 iso_pu_bacteria 8055817908 8055819977 283
68 iso_pu_bacteria 8056161164 8056165162 283
69 iso_pu_bacteria 8056177738 8056179561 283
70 3300005334 Ga0068869_100071545 Ga0068869_1000715452 284
71 3300005438 Ga0070701_10167209 Ga0070701_101672091 284
72 3300005441 Ga0070700_100001656 Ga0070700_1000016567 284
73 3300005617 Ga0068859_100056948 Ga0068859_1000569483 284
74 3300005719 Ga0068861_100060140 Ga0068861_1000601402 284
75 3300006844 Ga0075428_100078978 Ga0075428_1000789783 284
76 3300006846 Ga0075430_100079162 Ga0075430_1000791623 284
77 3300006880 Ga0075429_100107193 Ga0075429_1001071933 284
78 3300006881 Ga0068865_100123527 Ga0068865_1001235272 284
79 3300006931 Ga0097620_100056947 Ga0097620_1000569473 284
80 3300009094 Ga0111539_10034048 Ga0111539_100340483 284
81 3300009148 Ga0105243_10041967 Ga0105243_100419672 284
82 3300009553 Ga0105249_10230243 Ga0105249_102302432 284
83 3300025254 Ga0209148_1000603 Ga0209148_100060337 284
84 3300025272 Ga0209455_1000613 Ga0209455_10006139 284
85 3300025942 Ga0207689_10157497 Ga0207689_101574972 284
86 3300026075 Ga0207708_10008158 Ga0207708_100081588 284
87 3300026089 Ga0207648_10066643 Ga0207648_100666432 284
88 3300026118 Ga0207675_100008666 Ga0207675_1000086663 284
89 3300028380 Ga0268265_10028981 Ga0268265_100289812 284
90 3300045836 Ga0466958_0084182 Ga0466958_0084182_968_1849 284
91 3300045976 Ga0466967_0062113 Ga0466967_0062113_1622_2503 284
92 3300049576 Ga0501040_0172239 Ga0501040_0172239_360_1259 284
93 3300049591 Ga0501075_0021465 Ga0501075_0021465_2803_3702 284
94 3300050511 nmdc:mga08y16_222829_c1 nmdc:mga08y16_222829_c1_334_1233 284
95 3300050511 nmdc:mga08y16_7016_c1 nmdc:mga08y16_7016_c1_8121_9020 284
96 iso_pu_bacteria 2643221571 2643870727 284
97 iso_pu_bacteria 2842854478 2842855248 284
98 iso_pu_bacteria 2860867994 2860873271 284
99 iso_pu_bacteria 2946027586 2946028150 284
100 iso_pu_bacteria 2947233263 2947236665 284
101 iso_pu_bacteria 3007619802 3007623786 284
102 iso_pu_bacteria 3007866637 3007868805 284
103 iso_pu_bacteria 8056143049 8056146597 284
104 iso_pu_bacteria 8056148874 8056151037 284
105 3300031995 Ga0307409_100164730 Ga0307409_1001647302 285
106 3300032002 Ga0307416_100201264 Ga0307416_1002012642 285
107 3300005347 Ga0070668_100002511 Ga0070668_10000251110 286
108 3300005353 Ga0070669_100063928 Ga0070669_1000639284 286
109 3300005354 Ga0070675_100111992 Ga0070675_1001119924 286
110 3300005367 Ga0070667_100287197 Ga0070667_1002871973 286
111 3300005543 Ga0070672_100091113 Ga0070672_1000911132 286
112 3300005548 Ga0070665_100013666 Ga0070665_1000136667 286
113 3300025926 Ga0207659_10026434 Ga0207659_100264343 286
114 3300025940 Ga0207691_10025239 Ga0207691_100252395 286
115 3300025972 Ga0207668_10001796 Ga0207668_100017963 286
116 3300026095 Ga0207676_10282026 Ga0207676_102820262 286
117 3300031548 Ga0307408_100270786 Ga0307408_1002707862 286
118 3300032005 Ga0307411_10005887 Ga0307411_100058875 286
119 3300044712 Ga0453684_0044496 Ga0453684_0044496_4062_4961 286
120 3300047469 Ga0495673_0017386 Ga0495673_0017386_1998_2873 286
121 iso_pu_bacteria 2667528173 2671106975 286
122 iso_pu_bacteria 2904474040 2904475900 286
123 iso_pu_bacteria 2919150387 2919152069 286
124 iso_pu_bacteria 2927143783 2927144738 286
125 3300003781 Ga0055536_1000198 Ga0055536_100019822 287
126 3300003791 Ga0055530_10000259 Ga0055530_1000025922 287
127 3300003792 Ga0055540_1000105 Ga0055540_100010522 287
128 3300003794 Ga0055531_10000081 Ga0055531_1000008122 287
129 3300003841 Ga0055541_1008295 Ga0055541_10082952 287
130 3300005288 Ga0065714_10002505 Ga0065714_1000250518 287
131 3300005288 Ga0065714_10067698 Ga0065714_100676987 287
132 3300005288 Ga0065714_10071937 Ga0065714_100719372 287
133 3300005288 Ga0065714_10098434 Ga0065714_100984341 287
134 3300005288 Ga0065714_10108719 Ga0065714_101087192 287
135 3300005331 Ga0070670_100007654 Ga0070670_1000076544 287
136 3300005353 Ga0070669_100006394 Ga0070669_1000063946 287
137 3300005366 Ga0070659_100001434 Ga0070659_1000014347 287
138 3300005457 Ga0070662_100019335 Ga0070662_1000193356 287
139 3300005539 Ga0068853_100048670 Ga0068853_1000486704 287
140 3300005548 Ga0070665_100034111 Ga0070665_1000341116 287
141 3300005564 Ga0070664_100192217 Ga0070664_1001922172 287
142 3300005578 Ga0068854_100079243 Ga0068854_1000792432 287
143 3300005834 Ga0068851_10000251 Ga0068851_1000025125 287
144 3300006177 Ga0075362_10045025 Ga0075362_100450252 287
145 3300006946 Ga0079104_1002600 Ga0079104_10026002 287
146 3300006946 Ga0079104_1012703 Ga0079104_10127031 287
147 3300009011 Ga0105251_10000078 Ga0105251_1000007835 287
148 3300009011 Ga0105251_10001024 Ga0105251_1000102414 287
149 3300009011 Ga0105251_10007444 Ga0105251_100074447 287
150 3300009011 Ga0105251_10008460 Ga0105251_100084602 287
151 3300009011 Ga0105251_10033813 Ga0105251_100338132 287
152 3300009036 Ga0105244_10001075 Ga0105244_100010757 287
153 3300009036 Ga0105244_10002651 Ga0105244_100026514 287
154 3300009036 Ga0105244_10002693 Ga0105244_1000269313 287
155 3300009036 Ga0105244_10008972 Ga0105244_100089722 287
156 3300009036 Ga0105244_10034704 Ga0105244_100347042 287
157 3300009036 Ga0105244_10098827 Ga0105244_100988272 287
158 3300009092 Ga0105250_10000560 Ga0105250_1000056017 287
159 3300009092 Ga0105250_10000898 Ga0105250_1000089812 287
160 3300009092 Ga0105250_10004003 Ga0105250_100040035 287
161 3300009092 Ga0105250_10024377 Ga0105250_100243771 287
162 3300009092 Ga0105250_10086517 Ga0105250_100865172 287
163 3300009092 Ga0105250_10096169 Ga0105250_100961691 287
164 3300009148 Ga0105243_10000103 Ga0105243_1000010369 287
165 3300011119 Ga0105246_10000793 Ga0105246_1000079316 287
166 3300012498 Ga0157345_1000009 Ga0157345_100000930 287
167 3300013100 Ga0157373_10000151 Ga0157373_1000015117 287
168 3300013100 Ga0157373_10001540 Ga0157373_1000154014 287
169 3300013100 Ga0157373_10005442 Ga0157373_100054427 287
170 3300013100 Ga0157373_10006919 Ga0157373_100069195 287
171 3300013100 Ga0157373_10014276 Ga0157373_100142764 287
172 3300013100 Ga0157373_10119422 Ga0157373_101194222 287
173 3300013102 Ga0157371_10000306 Ga0157371_100003069 287
174 3300013102 Ga0157371_10156859 Ga0157371_101568592 287
175 3300013105 Ga0157369_10000424 Ga0157369_1000042417 287
176 3300013105 Ga0157369_10002940 Ga0157369_1000294015 287
177 3300013105 Ga0157369_10017481 Ga0157369_100174818 287
178 3300013306 Ga0163162_10000072 Ga0163162_1000007273 287
179 3300013306 Ga0163162_10022682 Ga0163162_100226822 287
180 3300013306 Ga0163162_10115389 Ga0163162_101153892 287
181 3300013307 Ga0157372_10006797 Ga0157372_1000679711 287
182 3300013308 Ga0157375_10001580 Ga0157375_1000158015 287
183 3300013308 Ga0157375_10033744 Ga0157375_100337442 287
184 3300013308 Ga0157375_10092800 Ga0157375_100928004 287
185 3300014497 Ga0182008_10001385 Ga0182008_1000138511 287
186 3300014497 Ga0182008_10006061 Ga0182008_100060615 287
187 3300014497 Ga0182008_10115977 Ga0182008_101159771 287
188 3300015261 Ga0182006_1001126 Ga0182006_100112620 287
189 3300015261 Ga0182006_1008860 Ga0182006_10088604 287
190 3300015261 Ga0182006_1024079 Ga0182006_10240792 287
191 3300015261 Ga0182006_1042833 Ga0182006_10428331 287
192 3300015262 Ga0182007_10001148 Ga0182007_1000114810 287
193 3300015262 Ga0182007_10003193 Ga0182007_100031935 287
194 3300015262 Ga0182007_10008808 Ga0182007_100088085 287
195 3300017792 Ga0163161_10000156 Ga0163161_1000015637 287
196 3300017792 Ga0163161_10009883 Ga0163161_100098835 287
197 3300017792 Ga0163161_10011283 Ga0163161_100112832 287
198 3300017792 Ga0163161_10219868 Ga0163161_102198682 287
199 3300025230 Ga0209563_100345 Ga0209563_1003456 287
200 3300025256 Ga0209759_1025262 Ga0209759_10252621 287
201 3300025292 Ga0209676_1000010 Ga0209676_100001022 287
202 3300025298 Ga0209050_1000081 Ga0209050_1000081228 287
203 3300025303 Ga0209051_1000185 Ga0209051_100018579 287
204 3300025304 Ga0209257_1000040 Ga0209257_1000040503 287
205 3300025321 Ga0207656_10000094 Ga0207656_1000009422 287
206 3300025711 Ga0207696_1000193 Ga0207696_100019317 287
207 3300025711 Ga0207696_1002805 Ga0207696_10028051 287
208 3300025711 Ga0207696_1015195 Ga0207696_10151952 287
209 3300025711 Ga0207696_1016556 Ga0207696_10165563 287
210 3300025711 Ga0207696_1030319 Ga0207696_10303191 287
211 3300025728 Ga0207655_1000006 Ga0207655_1000006367 287
212 3300025728 Ga0207655_1000551 Ga0207655_100055120 287
213 3300025728 Ga0207655_1004649 Ga0207655_100464911 287
214 3300025728 Ga0207655_1005210 Ga0207655_10052107 287
215 3300025728 Ga0207655_1005395 Ga0207655_10053959 287
216 3300025728 Ga0207655_1005834 Ga0207655_10058345 287
217 3300025728 Ga0207655_1018643 Ga0207655_10186432 287
218 3300025728 Ga0207655_1022189 Ga0207655_10221892 287
219 3300025735 Ga0207713_1000060 Ga0207713_10000609 287
220 3300025735 Ga0207713_1001221 Ga0207713_100122120 287
221 3300025735 Ga0207713_1002183 Ga0207713_10021836 287
222 3300025735 Ga0207713_1007911 Ga0207713_10079112 287
223 3300025735 Ga0207713_1011205 Ga0207713_10112052 287
224 3300025735 Ga0207713_1013068 Ga0207713_10130682 287
225 3300025735 Ga0207713_1029853 Ga0207713_10298532 287
226 3300025923 Ga0207681_10002725 Ga0207681_100027259 287
227 3300025923 Ga0207681_10004592 Ga0207681_100045928 287
228 3300025925 Ga0207650_10001093 Ga0207650_1000109312 287
229 3300025932 Ga0207690_10007146 Ga0207690_100071463 287
230 3300025933 Ga0207706_10000668 Ga0207706_100006686 287
231 3300025933 Ga0207706_10020727 Ga0207706_100207275 287
232 3300025935 Ga0207709_10000035 Ga0207709_1000003520 287
233 3300025945 Ga0207679_10256009 Ga0207679_102560092 287
234 3300025981 Ga0207640_10058929 Ga0207640_100589292 287
235 3300027111 Ga0209281_1008310 Ga0209281_10083102 287
236 3300028379 Ga0268266_10279974 Ga0268266_102799742 287
237 3300028379 Ga0268266_10307467 Ga0268266_103074672 287
238 3300031548 Ga0307408_100022868 Ga0307408_1000228682 287
239 3300031727 Ga0316576_10140034 Ga0316576_101400341 287
240 3300031995 Ga0307409_100164708 Ga0307409_1001647082 287
241 3300032004 Ga0307414_10048154 Ga0307414_100481542 287
242 3300032004 Ga0307414_10307432 Ga0307414_103074321 287
243 3300032005 Ga0307411_10002996 Ga0307411_100029965 287
244 3300032005 Ga0307411_10111223 Ga0307411_101112231 287
245 3300033180 Ga0307510_10000265 Ga0307510_1000026532 287
246 3300035398 Ga0316574_0127431 Ga0316574_0127431_628_1533 287
247 3300038705 Ga0237819_00585 Ga0237819_00585_10651_11526 287
248 3300041407 Ga0439447_012306 Ga0439447_012306_1260_2135 287
249 3300042006 Ga0439432_002490 Ga0439432_002490_977_1852 287
250 3300042016 Ga0439463_000246 Ga0439463_000246_9481_10386 287
251 3300042016 Ga0439463_005777 Ga0439463_005777_2020_2895 287
252 3300042115 Ga0450911_000060 Ga0450911_000060_41158_42033 287
253 3300042138 Ga0450903_006129 Ga0450903_006129_987_1862 287
254 3300042144 Ga0450889_006281 Ga0450889_006281_296_1171 287
255 3300042145 Ga0450906_000025 Ga0450906_000025_25314_26189 287
256 3300042532 Ga0450893_0000671 Ga0450893_0000671_2030_2905 287
257 3300046452 Ga0495617_005002 Ga0495617_005002_3542_4417 287
258 3300046452 Ga0495617_005622 Ga0495617_005622_1852_2727 287
259 3300046452 Ga0495617_021300 Ga0495617_021300_970_1845 287
260 3300046453 Ga0495627_000062 Ga0495627_000062_20376_21290 287
261 3300046453 Ga0495627_000239 Ga0495627_000239_14128_15003 287
262 3300046453 Ga0495627_001016 Ga0495627_001016_5076_5951 287
263 3300046453 Ga0495627_001778 Ga0495627_001778_7681_8556 287
264 3300046453 Ga0495627_002540 Ga0495627_002540_5072_5977 287
265 3300046453 Ga0495627_004978 Ga0495627_004978_2961_3836 287
266 3300046453 Ga0495627_023743 Ga0495627_023743_1065_1940 287
267 3300046453 Ga0495627_028690 Ga0495627_028690_702_1577 287
268 3300046455 Ga0495603_0002114 Ga0495603_0002114_2952_3827 287
269 3300046457 Ga0495590_0010664 Ga0495590_0010664_1606_2481 287
270 3300046457 Ga0495590_0026410 Ga0495590_0026410_704_1579 287
271 3300046458 Ga0495591_000107 Ga0495591_000107_80816_81763 287
272 3300046458 Ga0495591_000323 Ga0495591_000323_25392_26297 287
273 3300046458 Ga0495591_000774 Ga0495591_000774_14255_15130 287
274 3300046458 Ga0495591_001826 Ga0495591_001826_7411_8286 287
275 3300046458 Ga0495591_002165 Ga0495591_002165_6777_7652 287
276 3300046458 Ga0495591_003014 Ga0495591_003014_1929_2804 287
277 3300046458 Ga0495591_003018 Ga0495591_003018_5837_6712 287
278 3300046458 Ga0495591_003943 Ga0495591_003943_4822_5697 287
279 3300046458 Ga0495591_005561 Ga0495591_005561_2686_3561 287
280 3300046458 Ga0495591_008120 Ga0495591_008120_214_1089 287
281 3300046458 Ga0495591_008413 Ga0495591_008413_3200_4075 287
282 3300046458 Ga0495591_013632 Ga0495591_013632_632_1507 287
283 3300046460 Ga0495638_0004844 Ga0495638_0004844_6511_7449 287
284 3300046460 Ga0495638_0005423 Ga0495638_0005423_3090_3965 287
285 3300046460 Ga0495638_0008482 Ga0495638_0008482_189_1064 287
286 3300046460 Ga0495638_0013249 Ga0495638_0013249_3089_3964 287
287 3300046460 Ga0495638_0062264 Ga0495638_0062264_976_1851 287
288 3300046460 Ga0495638_0113909 Ga0495638_0113909_550_1425 287
289 3300046460 Ga0495638_0132234 Ga0495638_0132234_244_1119 287
290 3300046463 Ga0495653_0000110 Ga0495653_0000110_4780_5664 287
291 3300046463 Ga0495653_0000525 Ga0495653_0000525_14474_15436 287
292 3300046463 Ga0495653_0035825 Ga0495653_0035825_1399_2274 287
293 3300046471 Ga0495650_0003078 Ga0495650_0003078_2122_3081 287
294 3300046471 Ga0495650_0003101 Ga0495650_0003101_8273_9148 287
295 3300046471 Ga0495650_0004460 Ga0495650_0004460_2428_3303 287
296 3300046471 Ga0495650_0016488 Ga0495650_0016488_1861_2736 287
297 3300046471 Ga0495650_0021032 Ga0495650_0021032_1915_2790 287
298 3300046471 Ga0495650_0021270 Ga0495650_0021270_279_1154 287
299 3300046471 Ga0495650_0029555 Ga0495650_0029555_654_1601 287
300 3300046471 Ga0495650_0096238 Ga0495650_0096238_15_893 287
301 3300046474 Ga0495605_0000123 Ga0495605_0000123_32048_32923 287
302 3300046474 Ga0495605_0001256 Ga0495605_0001256_11637_12578 287
303 3300046474 Ga0495605_0001744 Ga0495605_0001744_8187_9062 287
304 3300046474 Ga0495605_0001919 Ga0495605_0001919_4520_5467 287
305 3300046474 Ga0495605_0003862 Ga0495605_0003862_3429_4334 287
306 3300046474 Ga0495605_0008675 Ga0495605_0008675_3271_4146 287
307 3300046474 Ga0495605_0030415 Ga0495605_0030415_1787_2662 287
308 3300046491 Ga0495584_0000505 Ga0495584_0000505_19009_20019 287
309 3300046491 Ga0495584_0002338 Ga0495584_0002338_6503_7378 287
310 3300046491 Ga0495584_0002358 Ga0495584_0002358_4204_5079 287
311 3300046491 Ga0495584_0002635 Ga0495584_0002635_4127_5002 287
312 3300046491 Ga0495584_0005572 Ga0495584_0005572_1659_2534 287
313 3300046491 Ga0495584_0005622 Ga0495584_0005622_3533_4408 287
314 3300046491 Ga0495584_0012680 Ga0495584_0012680_3314_4189 287
315 3300046492 Ga0495585_0000228 Ga0495585_0000228_40017_40892 287
316 3300046492 Ga0495585_0001140 Ga0495585_0001140_6515_7531 287
317 3300046492 Ga0495585_0003921 Ga0495585_0003921_3813_4688 287
318 3300046492 Ga0495585_0004209 Ga0495585_0004209_1749_2624 287
319 3300046492 Ga0495585_0005289 Ga0495585_0005289_3607_4482 287
320 3300046492 Ga0495585_0007152 Ga0495585_0007152_565_1440 287
321 3300046499 Ga0495594_0018727 Ga0495594_0018727_1011_1886 287
322 3300046500 Ga0495596_0010024 Ga0495596_0010024_1348_2223 287
323 3300046500 Ga0495596_0066571 Ga0495596_0066571_473_1348 287
324 3300046500 Ga0495596_0075126 Ga0495596_0075126_162_1037 287
325 3300046501 Ga0495607_0000210 Ga0495607_0000210_56925_57830 287
326 3300046501 Ga0495607_0001376 Ga0495607_0001376_14354_15229 287
327 3300046501 Ga0495607_0001798 Ga0495607_0001798_3200_4075 287
328 3300046501 Ga0495607_0001929 Ga0495607_0001929_5256_6131 287
329 3300046501 Ga0495607_0007597 Ga0495607_0007597_1875_2780 287
330 3300046501 Ga0495607_0011178 Ga0495607_0011178_3825_4700 287
331 3300046501 Ga0495607_0012233 Ga0495607_0012233_2234_3109 287
332 3300046501 Ga0495607_0038502 Ga0495607_0038502_566_1441 287
333 3300046501 Ga0495607_0058363 Ga0495607_0058363_437_1312 287
334 3300046501 Ga0495607_0063015 Ga0495607_0063015_1029_1904 287
335 3300046501 Ga0495607_0067003 Ga0495607_0067003_47_922 287
336 3300046501 Ga0495607_0092095 Ga0495607_0092095_421_1296 287
337 3300046501 Ga0495607_0108084 Ga0495607_0108084_474_1349 287
338 3300046506 Ga0495583_0000036 Ga0495583_0000036_41413_42288 287
339 3300046506 Ga0495583_0000798 Ga0495583_0000798_19928_20803 287
340 3300046506 Ga0495583_0000984 Ga0495583_0000984_1838_2713 287
341 3300046506 Ga0495583_0001347 Ga0495583_0001347_19832_20737 287
342 3300046506 Ga0495583_0002613 Ga0495583_0002613_4050_4925 287
343 3300046506 Ga0495583_0005174 Ga0495583_0005174_4262_5311 287
344 3300046506 Ga0495583_0006457 Ga0495583_0006457_3401_4276 287
345 3300046506 Ga0495583_0007233 Ga0495583_0007233_999_2009 287
346 3300046506 Ga0495583_0042430 Ga0495583_0042430_995_1870 287
347 3300046507 Ga0495606_0000098 Ga0495606_0000098_79093_79968 287
348 3300046507 Ga0495606_0000421 Ga0495606_0000421_4931_5815 287
349 3300046507 Ga0495606_0000782 Ga0495606_0000782_40305_41321 287
350 3300046507 Ga0495606_0000988 Ga0495606_0000988_26432_27307 287
351 3300046507 Ga0495606_0002509 Ga0495606_0002509_3740_4615 287
352 3300046507 Ga0495606_0002630 Ga0495606_0002630_14553_15428 287
353 3300046507 Ga0495606_0004727 Ga0495606_0004727_10780_11655 287
354 3300046507 Ga0495606_0013803 Ga0495606_0013803_5131_6006 287
355 3300046507 Ga0495606_0027248 Ga0495606_0027248_1633_2508 287
356 3300046507 Ga0495606_0042999 Ga0495606_0042999_282_1157 287
357 3300046507 Ga0495606_0182470 Ga0495606_0182470_227_1102 287
358 3300046512 Ga0495610_0000780 Ga0495610_0000780_1348_2223 287
359 3300046512 Ga0495610_0000916 Ga0495610_0000916_4291_5166 287
360 3300046512 Ga0495610_0003306 Ga0495610_0003306_5775_6650 287
361 3300046512 Ga0495610_0009530 Ga0495610_0009530_2230_3105 287
362 3300046512 Ga0495610_0013697 Ga0495610_0013697_2005_2880 287
363 3300046512 Ga0495610_0024880 Ga0495610_0024880_2121_2996 287
364 3300046512 Ga0495610_0101475 Ga0495610_0101475_375_1250 287
365 3300046513 Ga0495616_0000168 Ga0495616_0000168_40730_41677 287
366 3300046513 Ga0495616_0001463 Ga0495616_0001463_14501_15376 287
367 3300046513 Ga0495616_0005711 Ga0495616_0005711_6697_7572 287
368 3300046513 Ga0495616_0005991 Ga0495616_0005991_48_923 287
369 3300046513 Ga0495616_0023032 Ga0495616_0023032_1843_2718 287
370 3300046513 Ga0495616_0051554 Ga0495616_0051554_989_1864 287
371 3300046513 Ga0495616_0108712 Ga0495616_0108712_371_1246 287
372 3300046513 Ga0495616_0134382 Ga0495616_0134382_174_1049 287
373 3300046515 Ga0495620_0000001 Ga0495620_0000001_316571_317446 287
374 3300046515 Ga0495620_0000184 Ga0495620_0000184_14213_15088 287
375 3300046515 Ga0495620_0000955 Ga0495620_0000955_12407_13312 287
376 3300046515 Ga0495620_0001469 Ga0495620_0001469_11007_11882 287
377 3300046515 Ga0495620_0002022 Ga0495620_0002022_5199_6074 287
378 3300046515 Ga0495620_0003675 Ga0495620_0003675_6993_7952 287
379 3300046515 Ga0495620_0006280 Ga0495620_0006280_4607_5554 287
380 3300046515 Ga0495620_0007910 Ga0495620_0007910_1921_2826 287
381 3300046515 Ga0495620_0013303 Ga0495620_0013303_1892_2767 287
382 3300046515 Ga0495620_0041153 Ga0495620_0041153_473_1348 287
383 3300046518 Ga0495631_0000221 Ga0495631_0000221_23961_24836 287
384 3300046518 Ga0495631_0003793 Ga0495631_0003793_6411_7286 287
385 3300046518 Ga0495631_0046869 Ga0495631_0046869_874_1749 287
386 3300046519 Ga0495632_0000222 Ga0495632_0000222_42749_43624 287
387 3300046519 Ga0495632_0003153 Ga0495632_0003153_4448_5395 287
388 3300046519 Ga0495632_0003661 Ga0495632_0003661_1109_2014 287
389 3300046519 Ga0495632_0003969 Ga0495632_0003969_5832_6746 287
390 3300046519 Ga0495632_0007269 Ga0495632_0007269_694_1569 287
391 3300046519 Ga0495632_0022406 Ga0495632_0022406_2417_3292 287
392 3300046519 Ga0495632_0023538 Ga0495632_0023538_423_1298 287
393 3300046519 Ga0495632_0024825 Ga0495632_0024825_1000_1875 287
394 3300046519 Ga0495632_0033388 Ga0495632_0033388_328_1203 287
395 3300046519 Ga0495632_0054912 Ga0495632_0054912_133_1008 287
396 3300046519 Ga0495632_0067709 Ga0495632_0067709_624_1499 287
397 3300046519 Ga0495632_0073817 Ga0495632_0073817_338_1237 287
398 3300046519 Ga0495632_0075300 Ga0495632_0075300_591_1502 287
399 3300046520 Ga0495637_0000181 Ga0495637_0000181_26032_26907 287
400 3300046520 Ga0495637_0000465 Ga0495637_0000465_14323_15198 287
401 3300046520 Ga0495637_0000590 Ga0495637_0000590_2849_3724 287
402 3300046520 Ga0495637_0001443 Ga0495637_0001443_2183_3058 287
403 3300046520 Ga0495637_0001971 Ga0495637_0001971_7847_8722 287
404 3300046520 Ga0495637_0002205 Ga0495637_0002205_3589_4464 287
405 3300046520 Ga0495637_0004032 Ga0495637_0004032_1756_2715 287
406 3300046520 Ga0495637_0006073 Ga0495637_0006073_3531_4406 287
407 3300046520 Ga0495637_0038036 Ga0495637_0038036_265_1170 287
408 3300046520 Ga0495637_0044395 Ga0495637_0044395_830_1705 287
409 3300046520 Ga0495637_0072503 Ga0495637_0072503_148_1023 287
410 3300046520 Ga0495637_0080572 Ga0495637_0080572_253_1128 287
411 3300046522 Ga0495643_0002208 Ga0495643_0002208_7147_8022 287
412 3300046522 Ga0495643_0006539 Ga0495643_0006539_195_1070 287
413 3300046522 Ga0495643_0008185 Ga0495643_0008185_954_1829 287
414 3300046522 Ga0495643_0008354 Ga0495643_0008354_3574_4449 287
415 3300046522 Ga0495643_0056022 Ga0495643_0056022_556_1431 287
416 3300046523 Ga0495644_0000783 Ga0495644_0000783_4563_5438 287
417 3300046523 Ga0495644_0005330 Ga0495644_0005330_1784_2659 287
418 3300046524 Ga0495648_0001614 Ga0495648_0001614_14096_14971 287
419 3300046524 Ga0495648_0001703 Ga0495648_0001703_20001_20876 287
420 3300046524 Ga0495648_0002271 Ga0495648_0002271_6292_7167 287
421 3300046524 Ga0495648_0002636 Ga0495648_0002636_14237_15184 287
422 3300046524 Ga0495648_0004515 Ga0495648_0004515_5831_6706 287
423 3300046524 Ga0495648_0004683 Ga0495648_0004683_8877_9752 287
424 3300046524 Ga0495648_0009594 Ga0495648_0009594_2801_3676 287
425 3300046524 Ga0495648_0010027 Ga0495648_0010027_5346_6221 287
426 3300046526 Ga0495666_0027101 Ga0495666_0027101_1590_2552 287
427 3300046526 Ga0495666_0167631 Ga0495666_0167631_75_950 287
428 3300046530 Ga0495654_0000111 Ga0495654_0000111_78034_78981 287
429 3300046530 Ga0495654_0000192 Ga0495654_0000192_44379_45293 287
430 3300046530 Ga0495654_0000478 Ga0495654_0000478_15893_16798 287
431 3300046530 Ga0495654_0001785 Ga0495654_0001785_7558_8433 287
432 3300046530 Ga0495654_0002127 Ga0495654_0002127_11157_12032 287
433 3300046530 Ga0495654_0007333 Ga0495654_0007333_3023_3898 287
434 3300046530 Ga0495654_0011790 Ga0495654_0011790_3624_4499 287
435 3300046530 Ga0495654_0027206 Ga0495654_0027206_1972_2847 287
436 3300046530 Ga0495654_0035686 Ga0495654_0035686_533_1408 287
437 3300046530 Ga0495654_0036637 Ga0495654_0036637_956_1831 287
438 3300046530 Ga0495654_0044214 Ga0495654_0044214_400_1275 287
439 3300046530 Ga0495654_0109104 Ga0495654_0109104_15_890 287
440 3300046536 Ga0495587_0001739 Ga0495587_0001739_13529_14470 287
441 3300046536 Ga0495587_0017000 Ga0495587_0017000_1933_2895 287
442 3300046538 Ga0495609_0000029 Ga0495609_0000029_33301_34176 287
443 3300046538 Ga0495609_0000035 Ga0495609_0000035_136397_137272 287
444 3300046538 Ga0495609_0000329 Ga0495609_0000329_14189_15064 287
445 3300046538 Ga0495609_0002051 Ga0495609_0002051_59_934 287
446 3300046538 Ga0495609_0005908 Ga0495609_0005908_3362_4237 287
447 3300046538 Ga0495609_0010480 Ga0495609_0010480_62_937 287
448 3300046538 Ga0495609_0026795 Ga0495609_0026795_163_1038 287
449 3300046538 Ga0495609_0041341 Ga0495609_0041341_89_1036 287
450 3300046542 Ga0495597_0001453 Ga0495597_0001453_14257_15132 287
451 3300046542 Ga0495597_0009066 Ga0495597_0009066_1938_2813 287
452 3300046542 Ga0495597_0011627 Ga0495597_0011627_139_1014 287
453 3300046542 Ga0495597_0013245 Ga0495597_0013245_928_1803 287
454 3300046542 Ga0495597_0029599 Ga0495597_0029599_1453_2445 287
455 3300046542 Ga0495597_0035257 Ga0495597_0035257_1257_2132 287
456 3300046542 Ga0495597_0050781 Ga0495597_0050781_752_1627 287
457 3300046542 Ga0495597_0079311 Ga0495597_0079311_432_1307 287
458 3300046543 Ga0495645_0066767 Ga0495645_0066767_1458_2420 287
459 3300046557 Ga0495622_0000911 Ga0495622_0000911_1025_1900 287
460 3300046557 Ga0495622_0012641 Ga0495622_0012641_1381_2256 287
461 3300046557 Ga0495622_0097134 Ga0495622_0097134_184_1059 287
462 3300046558 Ga0495633_0000016 Ga0495633_0000016_180591_181466 287
463 3300046558 Ga0495633_0002557 Ga0495633_0002557_5162_6037 287
464 3300046558 Ga0495633_0006318 Ga0495633_0006318_6049_6924 287
465 3300046616 Ga0495668_0001572 Ga0495668_0001572_14385_15260 287
466 3300046616 Ga0495668_0007142 Ga0495668_0007142_6244_7119 287
467 3300046616 Ga0495668_0035052 Ga0495668_0035052_40_915 287
468 3300046616 Ga0495668_0047839 Ga0495668_0047839_446_1321 287
469 3300046616 Ga0495668_0081718 Ga0495668_0081718_26_901 287
470 3300046642 Ga0495634_0001755 Ga0495634_0001755_13640_14515 287
471 3300046642 Ga0495634_0013585 Ga0495634_0013585_2962_3924 287
472 3300046648 Ga0495611_0000107 Ga0495611_0000107_42900_43775 287
473 3300046648 Ga0495611_0000904 Ga0495611_0000904_879_1754 287
474 3300046648 Ga0495611_0001132 Ga0495611_0001132_11839_12714 287
475 3300046648 Ga0495611_0152072 Ga0495611_0152072_59_934 287
476 3300046660 Ga0495625_0000004 Ga0495625_0000004_147040_147915 287
477 3300046660 Ga0495625_0001089 Ga0495625_0001089_20111_21058 287
478 3300046660 Ga0495625_0001350 Ga0495625_0001350_8279_9154 287
479 3300046660 Ga0495625_0010814 Ga0495625_0010814_6445_7320 287
480 3300046660 Ga0495625_0035582 Ga0495625_0035582_73_948 287
481 3300046660 Ga0495625_0171577 Ga0495625_0171577_191_1066 287
482 3300046660 Ga0495625_0213761 Ga0495625_0213761_261_1136 287
483 3300046663 Ga0495635_0000856 Ga0495635_0000856_18887_19828 287
484 3300046665 Ga0495661_0000004 Ga0495661_0000004_189403_190278 287
485 3300046665 Ga0495661_0000041 Ga0495661_0000041_126832_127707 287
486 3300046665 Ga0495661_0000288 Ga0495661_0000288_37953_38858 287
487 3300046665 Ga0495661_0000443 Ga0495661_0000443_628_1533 287
488 3300046665 Ga0495661_0007133 Ga0495661_0007133_1481_2356 287
489 3300046665 Ga0495661_0011031 Ga0495661_0011031_3841_4716 287
490 3300046665 Ga0495661_0011768 Ga0495661_0011768_468_1373 287
491 3300046665 Ga0495661_0098561 Ga0495661_0098561_730_1605 287
492 3300046665 Ga0495661_0157789 Ga0495661_0157789_181_1056 287
493 3300046674 Ga0495588_0003508 Ga0495588_0003508_3141_4016 287
494 3300046679 Ga0495623_0001646 Ga0495623_0001646_3425_4300 287
495 3300046680 Ga0495646_0003121 Ga0495646_0003121_337_1212 287
496 3300046680 Ga0495646_0046235 Ga0495646_0046235_627_1589 287
497 3300046689 Ga0495613_0016575 Ga0495613_0016575_2490_3452 287
498 3300046689 Ga0495613_0229319 Ga0495613_0229319_327_1202 287
499 3300046690 Ga0495624_0000637 Ga0495624_0000637_12437_13399 287
500 3300046690 Ga0495624_0031549 Ga0495624_0031549_2204_3079 287
501 3300046691 Ga0495670_0000105 Ga0495670_0000105_22290_23165 287
502 3300046691 Ga0495670_0004953 Ga0495670_0004953_4409_5284 287
503 3300046691 Ga0495670_0062655 Ga0495670_0062655_195_1070 287
504 3300046692 Ga0495671_0001925 Ga0495671_0001925_11335_12282 287
505 3300046692 Ga0495671_0002727 Ga0495671_0002727_6670_7545 287
506 3300046692 Ga0495671_0003072 Ga0495671_0003072_8098_9009 287
507 3300046692 Ga0495671_0003848 Ga0495671_0003848_6522_7397 287
508 3300046692 Ga0495671_0005396 Ga0495671_0005396_3709_4584 287
509 3300046692 Ga0495671_0016959 Ga0495671_0016959_1001_1876 287
510 3300046692 Ga0495671_0023908 Ga0495671_0023908_530_1405 287
511 3300046692 Ga0495671_0070792 Ga0495671_0070792_214_1089 287
512 3300046694 Ga0495649_0002385 Ga0495649_0002385_8045_8992 287
513 3300046694 Ga0495649_0003729 Ga0495649_0003729_2858_3733 287
514 3300046694 Ga0495649_0005030 Ga0495649_0005030_2223_3098 287
515 3300046694 Ga0495649_0024414 Ga0495649_0024414_2279_3154 287
516 3300046694 Ga0495649_0031427 Ga0495649_0031427_1619_2494 287
517 3300046694 Ga0495649_0032146 Ga0495649_0032146_213_1088 287
518 3300046694 Ga0495649_0058343 Ga0495649_0058343_1102_1977 287
519 3300046694 Ga0495649_0060925 Ga0495649_0060925_682_1557 287
520 3300046794 Ga0495589_0000278 Ga0495589_0000278_14213_15088 287
521 3300046794 Ga0495589_0007278 Ga0495589_0007278_1725_2600 287
522 3300046794 Ga0495589_0009224 Ga0495589_0009224_3356_4231 287
523 3300046794 Ga0495589_0017355 Ga0495589_0017355_2153_3028 287
524 3300046809 Ga0495600_0023735 Ga0495600_0023735_1757_2719 287
525 3300046810 Ga0495660_0000998 Ga0495660_0000998_13192_14067 287
526 3300046810 Ga0495660_0001470 Ga0495660_0001470_13949_14896 287
527 3300046810 Ga0495660_0001702 Ga0495660_0001702_6512_7387 287
528 3300046810 Ga0495660_0002168 Ga0495660_0002168_5895_6770 287
529 3300046810 Ga0495660_0002263 Ga0495660_0002263_7834_8718 287
530 3300046810 Ga0495660_0007379 Ga0495660_0007379_2451_3326 287
531 3300046810 Ga0495660_0007452 Ga0495660_0007452_4613_5488 287
532 3300046810 Ga0495660_0010816 Ga0495660_0010816_3242_4117 287
533 3300046810 Ga0495660_0013777 Ga0495660_0013777_10_885 287
534 3300046810 Ga0495660_0044274 Ga0495660_0044274_446_1321 287
535 3300046810 Ga0495660_0058751 Ga0495660_0058751_200_1075 287
536 3300047317 Ga0495604_0098533 Ga0495604_0098533_910_1872 287
537 3300047319 Ga0495674_0024635 Ga0495674_0024635_1612_2487 287
538 3300047320 Ga0495672_0000672 Ga0495672_0000672_22946_23908 287
539 3300047320 Ga0495672_0002204 Ga0495672_0002204_11656_12570 287
540 3300047320 Ga0495672_0003725 Ga0495672_0003725_4410_5285 287
541 3300047320 Ga0495672_0013260 Ga0495672_0013260_3296_4171 287
542 3300047320 Ga0495672_0044424 Ga0495672_0044424_529_1404 287
543 3300047320 Ga0495672_0064285 Ga0495672_0064285_304_1179 287
544 3300047320 Ga0495672_0145022 Ga0495672_0145022_250_1125 287
545 3300047321 Ga0495676_0000023 Ga0495676_0000023_9212_10087 287
546 3300047321 Ga0495676_0000286 Ga0495676_0000286_25807_26682 287
547 3300047321 Ga0495676_0008721 Ga0495676_0008721_1963_2925 287
548 3300047322 Ga0495680_0020625 Ga0495680_0020625_1234_2196 287
549 3300047322 Ga0495680_0033183 Ga0495680_0033183_1784_2659 287
550 3300047323 Ga0495683_0000074 Ga0495683_0000074_30818_31693 287
551 3300047323 Ga0495683_0000270 Ga0495683_0000270_38111_38986 287
552 3300047323 Ga0495683_0004249 Ga0495683_0004249_6210_7085 287
553 3300047323 Ga0495683_0006486 Ga0495683_0006486_5397_6344 287
554 3300047323 Ga0495683_0082963 Ga0495683_0082963_628_1503 287
555 3300047444 Ga0495675_0044149 Ga0495675_0044149_1238_2179 287
556 3300047444 Ga0495675_0048647 Ga0495675_0048647_1495_2457 287
557 3300047446 Ga0495679_000127 Ga0495679_000127_49907_50782 287
558 3300047446 Ga0495679_000256 Ga0495679_000256_22920_23795 287
559 3300047446 Ga0495679_000689 Ga0495679_000689_7420_8367 287
560 3300047446 Ga0495679_001938 Ga0495679_001938_5297_6172 287
561 3300047446 Ga0495679_003360 Ga0495679_003360_4991_5866 287
562 3300047446 Ga0495679_021316 Ga0495679_021316_894_1769 287
563 3300047446 Ga0495679_024054 Ga0495679_024054_117_992 287
564 3300047446 Ga0495679_035967 Ga0495679_035967_156_1031 287
565 3300047469 Ga0495673_0000297 Ga0495673_0000297_48418_49293 287
566 3300047469 Ga0495673_0000525 Ga0495673_0000525_19136_20095 287
567 3300047469 Ga0495673_0000537 Ga0495673_0000537_24262_25209 287
568 3300047469 Ga0495673_0001706 Ga0495673_0001706_12888_13763 287
569 3300047469 Ga0495673_0002220 Ga0495673_0002220_392_1267 287
570 3300047469 Ga0495673_0002230 Ga0495673_0002230_9529_10404 287
571 3300047469 Ga0495673_0005283 Ga0495673_0005283_2577_3452 287
572 3300047469 Ga0495673_0008780 Ga0495673_0008780_3173_4078 287
573 3300047469 Ga0495673_0021649 Ga0495673_0021649_1369_2244 287
574 3300047469 Ga0495673_0038788 Ga0495673_0038788_867_1742 287
575 3300047469 Ga0495673_0040226 Ga0495673_0040226_1042_1917 287
576 3300047469 Ga0495673_0112697 Ga0495673_0112697_16_891 287
577 3300047470 Ga0495681_0000448 Ga0495681_0000448_19141_20016 287
578 3300047470 Ga0495681_0000997 Ga0495681_0000997_14355_15230 287
579 3300047470 Ga0495681_0002274 Ga0495681_0002274_9733_10608 287
580 3300047470 Ga0495681_0002776 Ga0495681_0002776_6531_7406 287
581 3300047470 Ga0495681_0020296 Ga0495681_0020296_612_1487 287
582 3300047471 Ga0495684_0012161 Ga0495684_0012161_4026_4988 287
583 3300047472 Ga0495686_0001277 Ga0495686_0001277_5210_6085 287
584 3300047472 Ga0495686_0005723 Ga0495686_0005723_5621_6496 287
585 3300047472 Ga0495686_0014979 Ga0495686_0014979_3302_4177 287
586 3300047472 Ga0495686_0021387 Ga0495686_0021387_2170_3045 287
587 3300047673 Ga0495593_0014260 Ga0495593_0014260_1450_2412 287
588 3300048088 Ga0495602_0001722 Ga0495602_0001722_2401_3363 287
589 3300048091 Ga0495626_0000213 Ga0495626_0000213_43905_44780 287
590 3300048091 Ga0495626_0000679 Ga0495626_0000679_13997_14944 287
591 3300048091 Ga0495626_0001952 Ga0495626_0001952_200_1075 287
592 3300048091 Ga0495626_0003061 Ga0495626_0003061_7499_8374 287
593 3300048091 Ga0495626_0005451 Ga0495626_0005451_6391_7266 287
594 3300048091 Ga0495626_0035602 Ga0495626_0035602_1286_2161 287
595 3300048091 Ga0495626_0043695 Ga0495626_0043695_1058_1933 287
596 3300048905 Ga0496102_0000250 Ga0496102_0000250_13613_14554 287
597 3300048905 Ga0496102_0097756 Ga0496102_0097756_1272_2231 287
598 3300048905 Ga0496102_0257696 Ga0496102_0257696_685_1590 287
599 3300048906 Ga0496103_0005141 Ga0496103_0005141_5362_6303 287
600 3300048913 Ga0496110_0351768 Ga0496110_0351768_289_1164 287
601 3300048918 Ga0496115_0018650 Ga0496115_0018650_2878_3753 287
602 3300048919 Ga0496116_0000869 Ga0496116_0000869_14234_15109 287
603 3300048919 Ga0496116_0007720 Ga0496116_0007720_6509_7384 287
604 3300048919 Ga0496116_0033974 Ga0496116_0033974_736_1695 287
605 3300048920 Ga0496117_0003912 Ga0496117_0003912_2717_3622 287
606 3300048920 Ga0496117_0019755 Ga0496117_0019755_4495_5436 287
607 3300048920 Ga0496117_0031230 Ga0496117_0031230_2909_3784 287
608 3300048920 Ga0496117_0034545 Ga0496117_0034545_1763_2638 287
609 3300048921 Ga0496118_0030089 Ga0496118_0030089_115_1056 287
610 3300048921 Ga0496118_0037003 Ga0496118_0037003_1562_2437 287
611 3300048921 Ga0496118_0043591 Ga0496118_0043591_312_1187 287
612 3300048921 Ga0496118_0056868 Ga0496118_0056868_1377_2252 287
613 3300048921 Ga0496118_0069452 Ga0496118_0069452_59_1018 287
614 3300048921 Ga0496118_0072593 Ga0496118_0072593_1389_2264 287
615 3300048922 Ga0496119_0032479 Ga0496119_0032479_1095_1970 287
616 3300048922 Ga0496119_0073694 Ga0496119_0073694_582_1457 287
617 3300048923 Ga0496120_0024888 Ga0496120_0024888_1248_2123 287
618 3300048923 Ga0496120_0066605 Ga0496120_0066605_583_1458 287
619 3300048924 Ga0496121_0001304 Ga0496121_0001304_34068_34943 287
620 3300048924 Ga0496121_0003384 Ga0496121_0003384_1890_2765 287
621 3300048924 Ga0496121_0013817 Ga0496121_0013817_4287_5162 287
622 3300048924 Ga0496121_0077266 Ga0496121_0077266_487_1362 287
623 3300048924 Ga0496121_0233319 Ga0496121_0233319_92_1033 287
624 3300048925 Ga0496122_0011943 Ga0496122_0011943_82_957 287
625 3300048925 Ga0496122_0039296 Ga0496122_0039296_1299_2174 287
626 3300048925 Ga0496122_0101003 Ga0496122_0101003_1029_1904 287
627 3300048926 Ga0496123_0000379 Ga0496123_0000379_7760_8635 287
628 3300048926 Ga0496123_0005708 Ga0496123_0005708_5045_5920 287
629 3300048926 Ga0496123_0041025 Ga0496123_0041025_385_1260 287
630 3300048927 Ga0496124_0002234 Ga0496124_0002234_21533_22408 287
631 3300048927 Ga0496124_0004218 Ga0496124_0004218_2762_3637 287
632 3300048927 Ga0496124_0004969 Ga0496124_0004969_9853_10728 287
633 3300048927 Ga0496124_0035873 Ga0496124_0035873_727_1602 287
634 3300048927 Ga0496124_0128894 Ga0496124_0128894_552_1427 287
635 3300048928 Ga0496125_0003931 Ga0496125_0003931_13739_14644 287
636 3300048928 Ga0496125_0010647 Ga0496125_0010647_6380_7255 287
637 3300048928 Ga0496125_0062983 Ga0496125_0062983_1124_1999 287
638 3300049459 Ga0495678_000036 Ga0495678_000036_5875_6750 287
639 3300049459 Ga0495678_000120 Ga0495678_000120_39643_40518 287
640 3300049459 Ga0495678_000309 Ga0495678_000309_42837_43712 287
641 3300049459 Ga0495678_000573 Ga0495678_000573_13997_14944 287
642 3300049459 Ga0495678_002641 Ga0495678_002641_4866_5741 287
643 3300049459 Ga0495678_002991 Ga0495678_002991_6240_7115 287
644 3300049459 Ga0495678_005410 Ga0495678_005410_5390_6274 287
645 3300049459 Ga0495678_009248 Ga0495678_009248_1114_1989 287
646 3300049459 Ga0495678_009335 Ga0495678_009335_2612_3487 287
647 3300049459 Ga0495678_022399 Ga0495678_022399_35_910 287
648 3300049460 Ga0495682_0001294 Ga0495682_0001294_5075_5950 287
649 3300049460 Ga0495682_0002319 Ga0495682_0002319_4788_5693 287
650 3300049460 Ga0495682_0003273 Ga0495682_0003273_266_1141 287
651 3300049460 Ga0495682_0035617 Ga0495682_0035617_30_905 287
652 3300049758 Ga0501241_000265 Ga0501241_000265_6555_7430 287
653 3300049766 Ga0501269_003058 Ga0501269_003058_986_1861 287
654 3300053111 Ga0500572_001586 Ga0500572_001586_3443_4318 287
655 3300053126 Ga0500621_007988 Ga0500621_007988_741_1616 287
656 3300053161 Ga0500634_0010006 Ga0500634_0010006_1327_2202 287
657 iso_pu_bacteria 2885266251 2885270052 287
658 3300005328 Ga0070676_10275990 Ga0070676_102759901 288
659 3300005356 Ga0070674_100095734 Ga0070674_1000957344 288
660 3300005459 Ga0068867_100049492 Ga0068867_1000494922 288
661 3300005539 Ga0068853_100404867 Ga0068853_1004048672 288
662 3300005543 Ga0070672_100078917 Ga0070672_1000789172 288
663 3300005548 Ga0070665_100345641 Ga0070665_1003456412 288
664 3300005616 Ga0068852_100304461 Ga0068852_1003044612 288
665 3300005834 Ga0068851_10040259 Ga0068851_100402594 288
666 3300009011 Ga0105251_10000032 Ga0105251_100000322 288
667 3300009011 Ga0105251_10015827 Ga0105251_100158271 288
668 3300009092 Ga0105250_10000241 Ga0105250_1000024146 288
669 3300013102 Ga0157371_10000115 Ga0157371_1000011581 288
670 3300025711 Ga0207696_1000363 Ga0207696_100036346 288
671 3300025735 Ga0207713_1000020 Ga0207713_1000020223 288
672 3300025735 Ga0207713_1061162 Ga0207713_10611621 288
673 3300025986 Ga0207658_10264705 Ga0207658_102647052 288
674 3300027312 Ga0209371_1001498 Ga0209371_10014982 288
675 3300030500 Ga0268256_1003139 Ga0268256_10031392 288
676 3300031548 Ga0307408_100000074 Ga0307408_10000007424 288
677 3300031901 Ga0307406_10157227 Ga0307406_101572271 288
678 3300031903 Ga0307407_10154153 Ga0307407_101541532 288
679 3300031911 Ga0307412_10000459 Ga0307412_1000045918 288
680 3300031911 Ga0307412_10000594 Ga0307412_1000059415 288
681 3300032004 Ga0307414_10012907 Ga0307414_100129074 288
682 3300032004 Ga0307414_10167632 Ga0307414_101676322 288
683 3300032005 Ga0307411_10032567 Ga0307411_100325672 288
684 3300041405 Ga0439438_000190 Ga0439438_000190_8550_9446 288
685 3300042006 Ga0439432_000450 Ga0439432_000450_8777_9673 288
686 3300042013 Ga0439456_009091 Ga0439456_009091_921_1805 288
687 3300046460 Ga0495638_0008864 Ga0495638_0008864_1332_2270 288
688 3300046474 Ga0495605_0000006 Ga0495605_0000006_290747_291625 288
689 3300046474 Ga0495605_0019405 Ga0495605_0019405_1283_2167 288
690 3300046474 Ga0495605_0021867 Ga0495605_0021867_981_1976 288
691 3300046501 Ga0495607_0013606 Ga0495607_0013606_2382_3290 288
692 3300046501 Ga0495607_0044697 Ga0495607_0044697_866_1744 288
693 3300046506 Ga0495583_0001142 Ga0495583_0001142_14432_15310 288
694 3300046515 Ga0495620_0001339 Ga0495620_0001339_1101_2054 288
695 3300046529 Ga0495652_0400853 Ga0495652_0400853_75_959 288
696 3300046538 Ga0495609_0000034 Ga0495609_0000034_139891_140769 288
697 3300046810 Ga0495660_0008421 Ga0495660_0008421_1502_2386 288
698 3300047469 Ga0495673_0048287 Ga0495673_0048287_911_1789 288
699 3300048920 Ga0496117_0007554 Ga0496117_0007554_3274_4158 288
700 3300048921 Ga0496118_0010389 Ga0496118_0010389_6310_7194 288
701 3300048927 Ga0496124_0000035 Ga0496124_0000035_211735_212619 288
702 3300048927 Ga0496124_0118783 Ga0496124_0118783_803_1687 288
703 3300048928 Ga0496125_0010597 Ga0496125_0010597_5511_6395 288
704 3300049592 Ga0501076_0304117 Ga0501076_0304117_224_1117 288
705 3300049662 Ga0501222_000941 Ga0501222_000941_1176_2072 288
706 3300049665 Ga0501227_001106 Ga0501227_001106_1745_2740 288
707 3300053142 Ga0500577_0015242 Ga0500577_0015242_1014_1892 288
708 iso_pu_bacteria 2511231003 2511248439 288
709 iso_pu_bacteria 2884811622 2884816095 288
710 iso_pu_bacteria 2884836552 2884839426 288
711 iso_pu_bacteria 2884852848 2884856764 288
712 iso_pu_bacteria 2896154374 2896158110 288
713 3300006038 Ga0075365_10027755 Ga0075365_100277552 289
714 3300006042 Ga0075368_10002741 Ga0075368_100027413 289
715 3300006048 Ga0075363_100003970 Ga0075363_1000039709 289
716 3300006051 Ga0075364_10019688 Ga0075364_100196882 289
717 3300006177 Ga0075362_10006218 Ga0075362_100062182 289
718 3300006178 Ga0075367_10004049 Ga0075367_100040492 289
719 3300006186 Ga0075369_10008317 Ga0075369_100083172 289
720 3300006195 Ga0075366_10008293 Ga0075366_100082932 289
721 3300006353 Ga0075370_10044048 Ga0075370_100440482 289
722 3300026041 Ga0207639_10064389 Ga0207639_100643892 289
723 3300046471 Ga0495650_0046200 Ga0495650_0046200_938_1813 289
724 3300050489 nmdc:mga03683_7748_c1 nmdc:mga03683_7748_c1_2550_3431 289
725 3300050490 nmdc:mga03n38_10641_c1 nmdc:mga03n38_10641_c1_1030_1911 289
726 3300050491 nmdc:mga00v17_75291_c1 nmdc:mga00v17_75291_c1_906_1787 289
727 3300050492 nmdc:mga0yw44_34475_c1 nmdc:mga0yw44_34475_c1_1104_1985 289
728 3300050493 nmdc:mga0k408_5928_c1 nmdc:mga0k408_5928_c1_1569_2450 289
729 3300050494 nmdc:mga06z11_7119_c1 nmdc:mga06z11_7119_c1_2142_3023 289
730 3300050496 nmdc:mga07m45_23895_c1 nmdc:mga07m45_23895_c1_1233_2114 289
731 3300050516 nmdc:mga0sz30_20244_c1 nmdc:mga0sz30_20244_c1_270_1151 289
732 3300053090 Ga0500646_0000782 Ga0500646_0000782_7281_8162 289
733 3300002771 JGI25163J39215_1000003 JGI25163J39215_1000003101 290
734 3300002772 JGI25164J39214_1000041 JGI25164J39214_1000041101 290
735 3300003187 JGI25151J46595_10001449 JGI25151J46595_1000144917 290
736 3300003751 Ga0055538_1000003 Ga0055538_1000003519 290
737 3300003752 Ga0055539_1000003 Ga0055539_1000003101 290
738 3300003756 Ga0055533_1000005 Ga0055533_1000005101 290
739 3300003759 Ga0055525_1000005 Ga0055525_1000005519 290
740 3300003771 Ga0055526_1000917 Ga0055526_10009172 290
741 3300003771 Ga0055526_1002371 Ga0055526_100237112 290
742 3300003771 Ga0055526_1008492 Ga0055526_10084923 290
743 3300003771 Ga0055526_1011889 Ga0055526_10118893 290
744 3300003771 Ga0055526_1013063 Ga0055526_10130633 290
745 3300003775 Ga0055524_1000557 Ga0055524_10005575 290
746 3300003775 Ga0055524_1012040 Ga0055524_10120403 290
747 3300003781 Ga0055536_1000031 Ga0055536_100003192 290
748 3300003784 Ga0055534_1001179 Ga0055534_10011796 290
749 3300003841 Ga0055541_1000003 Ga0055541_1000003519 290
750 3300006948 Ga0099826_10000007 Ga0099826_10000007236 290
751 3300009036 Ga0105244_10000190 Ga0105244_1000019024 290
752 3300009092 Ga0105250_10000265 Ga0105250_1000026516 290
753 3300025207 Ga0209760_100002 Ga0209760_100002193 290
754 3300025224 Ga0209784_100001 Ga0209784_1000012860 290
755 3300025225 Ga0209566_100001 Ga0209566_1000012860 290
756 3300025226 Ga0209674_100002 Ga0209674_1000022860 290
757 3300025230 Ga0209563_100002 Ga0209563_1000021395 290
758 3300025231 Ga0207427_100009 Ga0207427_100009513 290
759 3300025233 Ga0209437_100001 Ga0209437_1000011395 290
760 3300025253 Ga0209677_100002 Ga0209677_1000021395 290
761 3300025263 Ga0209565_1000374 Ga0209565_100037411 290
762 3300025273 Ga0209673_1009477 Ga0209673_10094773 290
763 3300025291 Ga0209675_1000231 Ga0209675_100023117 290
764 3300025291 Ga0209675_1003651 Ga0209675_10036513 290
765 3300025291 Ga0209675_1004819 Ga0209675_10048193 290
766 3300025292 Ga0209676_1000036 Ga0209676_1000036319 290
767 3300025294 Ga0209025_1000345 Ga0209025_100034538 290
768 3300025294 Ga0209025_1001077 Ga0209025_100107717 290
769 3300025294 Ga0209025_1001122 Ga0209025_10011229 290
770 3300025294 Ga0209025_1031182 Ga0209025_10311823 290
771 3300025295 Ga0209564_1000878 Ga0209564_100087812 290
772 3300025295 Ga0209564_1001207 Ga0209564_100120712 290
773 3300025295 Ga0209564_1001260 Ga0209564_10012605 290
774 3300025299 Ga0209256_1000244 Ga0209256_100024432 290
775 3300025299 Ga0209256_1000846 Ga0209256_100084611 290
776 3300025303 Ga0209051_1035482 Ga0209051_10354822 290
777 3300025711 Ga0207696_1000169 Ga0207696_100016974 290
778 3300025728 Ga0207655_1003813 Ga0207655_10038138 290
779 3300027666 Ga0209282_1000021 Ga0209282_1000021138 290
780 3300037471 Ga0395905_0009894 Ga0395905_0009894_6302_7204 290
781 3300041452 Ga0451793_0439505 Ga0451793_0439505_840_1778 290
782 3300041496 Ga0451839_0364642 Ga0451839_0364642_910_1848 290
783 3300041498 Ga0451841_0330586 Ga0451841_0330586_46_984 290
784 3300042013 Ga0439456_008369 Ga0439456_008369_1070_1945 290
785 3300046458 Ga0495591_053093 Ga0495591_053093_87_965 290
786 3300046471 Ga0495650_0000018 Ga0495650_0000018_229421_230296 290
787 3300046474 Ga0495605_0001518 Ga0495605_0001518_9636_10514 290
788 3300046491 Ga0495584_0218813 Ga0495584_0218813_28_906 290
789 3300046500 Ga0495596_0000385 Ga0495596_0000385_25380_26258 290
790 3300046501 Ga0495607_0012388 Ga0495607_0012388_3576_4454 290
791 3300046512 Ga0495610_0002584 Ga0495610_0002584_4601_5479 290
792 3300046513 Ga0495616_0004346 Ga0495616_0004346_4606_5484 290
793 3300046524 Ga0495648_0011326 Ga0495648_0011326_3755_4633 290
794 3300046528 Ga0495642_0052170 Ga0495642_0052170_570_1448 290
795 3300046538 Ga0495609_0001540 Ga0495609_0001540_9715_10593 290
796 3300046542 Ga0495597_0025233 Ga0495597_0025233_1190_2068 290
797 3300046665 Ga0495661_0010296 Ga0495661_0010296_1921_2799 290
798 3300046692 Ga0495671_0029342 Ga0495671_0029342_73_951 290
799 3300046694 Ga0495649_0012142 Ga0495649_0012142_1115_1993 290
800 3300046810 Ga0495660_0000004 Ga0495660_0000004_465271_466146 290
801 3300047320 Ga0495672_0018945 Ga0495672_0018945_1942_2820 290
802 3300048907 Ga0496104_0001712 Ga0496104_0001712_7037_7912 290
803 3300048907 Ga0496104_0488667 Ga0496104_0488667_25_936 290
804 3300048919 Ga0496116_0000083 Ga0496116_0000083_61343_62218 290
805 3300048919 Ga0496116_0007579 Ga0496116_0007579_1630_2508 290
806 3300048920 Ga0496117_0014278 Ga0496117_0014278_3696_4571 290
807 3300048922 Ga0496119_0009151 Ga0496119_0009151_7505_8380 290
808 3300048924 Ga0496121_0010014 Ga0496121_0010014_3411_4289 290
809 3300048925 Ga0496122_0000135 Ga0496122_0000135_96803_97678 290
810 3300048925 Ga0496122_0007158 Ga0496122_0007158_4603_5481 290
811 3300048926 Ga0496123_0000004 Ga0496123_0000004_96711_97586 290
812 3300048926 Ga0496123_0005659 Ga0496123_0005659_9798_10676 290
813 3300048927 Ga0496124_0000140 Ga0496124_0000140_115882_116757 290
814 3300048928 Ga0496125_0000131 Ga0496125_0000131_100389_101264 290
815 3300048929 Ga0496126_0000300 Ga0496126_0000300_16366_17241 290
816 3300013104 Ga0157370_10001398 Ga0157370_1000139813 291
817 3300025728 Ga0207655_1000283 Ga0207655_100028364 291
818 3300002704 JGI25155J39150_1000456 JGI25155J39150_10004563 292
819 3300002705 JGI25156J39149_1004331 JGI25156J39149_10043313 292
820 3300002738 JGI25154J39366_1000291 JGI25154J39366_100029123 292
821 3300005843 Ga0068860_100139990 Ga0068860_1001399902 292
822 3300006237 Ga0097621_100006028 Ga0097621_10000602810 292
823 3300009011 Ga0105251_10088032 Ga0105251_100880321 292
824 3300009093 Ga0105240_10000250 Ga0105240_1000025077 292
825 3300009177 Ga0105248_10082872 Ga0105248_100828724 292
826 3300009545 Ga0105237_10787463 Ga0105237_107874631 292
827 3300009551 Ga0105238_10410435 Ga0105238_104104352 292
828 3300010375 Ga0105239_10133659 Ga0105239_101336594 292
829 3300013105 Ga0157369_10222437 Ga0157369_102224372 292
830 3300013306 Ga0163162_10028461 Ga0163162_100284612 292
831 3300013308 Ga0157375_10246777 Ga0157375_102467772 292
832 3300014325 Ga0163163_10024518 Ga0163163_100245184 292
833 3300015261 Ga0182006_1024149 Ga0182006_10241494 292
834 3300025206 Ga0209435_100067 Ga0209435_1000679 292
835 3300025233 Ga0209437_100272 Ga0209437_10027232 292
836 3300025246 Ga0209646_1000061 Ga0209646_100006143 292
837 3300025250 Ga0209026_1003054 Ga0209026_10030544 292
838 3300025256 Ga0209759_1000209 Ga0209759_100020942 292
839 3300025735 Ga0207713_1075603 Ga0207713_10756032 292
840 3300025903 Ga0207680_10011842 Ga0207680_100118425 292
841 3300025913 Ga0207695_10000615 Ga0207695_1000061514 292
842 3300025913 Ga0207695_10038879 Ga0207695_100388793 292
843 3300025949 Ga0207667_10043443 Ga0207667_100434434 292
844 3300026078 Ga0207702_10180179 Ga0207702_101801792 292
845 3300026142 Ga0207698_10001442 Ga0207698_100014428 292
846 3300031344 Ga0265316_10121215 Ga0265316_101212152 292
847 3300031711 Ga0265314_10002266 Ga0265314_100022663 292
848 3300046558 Ga0495633_0152762 Ga0495633_0152762_80_958 292
849 3300046660 Ga0495625_0000337 Ga0495625_0000337_53890_54774 292
850 3300048919 Ga0496116_0021443 Ga0496116_0021443_3125_4009 292
851 3300048924 Ga0496121_0009533 Ga0496121_0009533_7797_8738 292
852 3300048924 Ga0496121_0055027 Ga0496121_0055027_1173_2057 292
853 3300048925 Ga0496122_0000408 Ga0496122_0000408_52423_53307 292
854 3300048926 Ga0496123_0000188 Ga0496123_0000188_38017_38901 292
855 3300048928 Ga0496125_0007948 Ga0496125_0007948_7741_8619 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

84

337

0.88

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

86

343

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qyj-assembly1.cif.gz_A crystal structure of alr0039, a putative alpha/beta hydrolase from nostoc sp pcc 7120. 0.9868 1 290
3r41-assembly1.cif.gz_B crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/apo 0.9825 2 292
5t4t-assembly1.cif.gz_B crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn - apo no halide 0.9823 2 290
6qkw-assembly1.cif.gz_A crystal structure of the fluoroacetate dehalogenase rpa1163 - tyr219phe - fluoroacetate soaked 2hr 0.9806 2 292
3r3z-assembly1.cif.gz_A crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/glycolate 0.9801 2 292
ID Description Score Start End Superfamily
5k3cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9673 2 290 3.40.50.1820
3b12A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9662 1 291 3.40.50.1820
4nvrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9659 2 291 3.40.50.1820
3b12A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9564 1 291 3.40.50.1820
5k3cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9473 2 290 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A246JNT3-F1-model_v4 Alpha/beta hydrolase 0.9926 2 290 GO:0016787
AF-A0A538N151-F1-model_v4 Alpha/beta hydrolase 0.9926 1 128 GO:0016020
GO:0046464
GO:0047372
AF-A0A2N2UBE0-F1-model_v4 deleted 0.9904 1 292
AF-A0A552F0S2-F1-model_v4 Alpha/beta hydrolase 0.9897 1 290 GO:0016787
AF-A0A7W0ZFJ5-F1-model_v4 Alpha/beta fold hydrolase 0.9891 1 131 GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
95.72 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map