F483632
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 855 | 362 | 773 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300046506|Ga0495583_0005174|Ga0495583_0005174_4262_5311 |
| Length | 349 |
| Sequence | MWALACDADHSFYPAYRVDFIAGKPAPTHFMNNPSTLSPLPRTPRDSRMQAIITRSHSMFAGFQKDQCHVNGVDISYRKGGTGPGLLLLHGHPQTHVIWHKVAEQLAEHFTVVAADLRGYGDSSRPPANDHHTNYSKREMARDGVELMQALGFAQFSLLAHDRGARVAHRLALDHPEAVQRMVLLDIAPTLSMYAQTDEAFARAYWHWFFLIRPAPLPEALIESNPELYLRSVMGSRSAGLKPFTDEAFADYLRCLKLPGSATGICEDYRAAAGIDLEHDQADIDAGNHLNLPLLVMWGAEGTVGRCFEPLKEWQKVATDVRGKALPAGHYIAEEAPELLLGEVLAFLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 3 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 4 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 5 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 6 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 7 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 8 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 9 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 10 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 11 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 12 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 13 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 14 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 15 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 16 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 17 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 18 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 19 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 20 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 21 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 22 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 23 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 24 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 25 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 26 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 27 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 28 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 29 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 30 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 31 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 32 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 33 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 34 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 35 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 36 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 37 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 38 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 39 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 40 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 41 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 42 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 43 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 44 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 45 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 46 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 47 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 48 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 49 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 50 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 51 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 52 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 53 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 54 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 55 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 56 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 57 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 58 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 59 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 60 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 61 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 62 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 63 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 64 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 65 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 66 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 67 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 68 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 69 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 70 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 71 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 72 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 73 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 74 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 75 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 76 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 77 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 78 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 79 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 80 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 81 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 82 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 83 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 84 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 85 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 86 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 87 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 88 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 89 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 90 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 91 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 92 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 93 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 94 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 95 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 96 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 99 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 109 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 110 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 116 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 117 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 118 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 119 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 120 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 121 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 122 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 123 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 124 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 125 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 126 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 127 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 129 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 130 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 131 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 135 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 136 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 149 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 158 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 162 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 171 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 229 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 232 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 233 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 234 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 236 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 237 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 238 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 239 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 240 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 241 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 242 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 243 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 244 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 321 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 324 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 327 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 340 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 341 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 342 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 343 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 345 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 346 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 347 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 348 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 352 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 353 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 354 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 355 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 357 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 358 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 359 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 360 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 361 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 362 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.41 |
| Metatranscriptomes | 0 |
| Isolates | 9.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.24 |
| Nodule | 1.64 |
| Rhizoplane | 2.34 |
| Rhizosphere | 75.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000456 | 3300002704 | Bacteria | 10447 |
| 2 | JGI25156J39149_1004331 | 3300002705 | Bacteria | 4353 |
| 3 | JGI25154J39366_1000291 | 3300002738 | Bacteria | 30050 |
| 4 | JGI25163J39215_1000003 | 3300002771 | Bacteria | 149140 |
| 5 | JGI25164J39214_1000041 | 3300002772 | Bacteria | 127466 |
| 6 | JGI25151J46595_10001449 | 3300003187 | Bacteria | 16081 |
| 7 | Ga0055538_1000003 | 3300003751 | Bacteria | 663004 |
| 8 | Ga0055539_1000003 | 3300003752 | Bacteria | 663004 |
| 9 | Ga0055533_1000005 | 3300003756 | Bacteria | 663004 |
| 10 | Ga0055525_1000005 | 3300003759 | Bacteria | 663004 |
| 11 | Ga0055526_1000917 | 3300003771 | Bacteria | 21919 |
| 12 | Ga0055526_1002371 | 3300003771 | Bacteria | 12763 |
| 13 | Ga0055526_1008492 | 3300003771 | Bacteria | 5117 |
| 14 | Ga0055526_1011889 | 3300003771 | Bacteria | 3862 |
| 15 | Ga0055526_1013063 | 3300003771 | Bacteria | 3550 |
| 16 | Ga0055524_1000557 | 3300003775 | Bacteria | 28144 |
| 17 | Ga0055524_1012040 | 3300003775 | Bacteria | 3342 |
| 18 | Ga0055536_1000031 | 3300003781 | Bacteria | 151112 |
| 19 | Ga0055536_1000198 | 3300003781 | Bacteria | 49612 |
| 20 | Ga0055534_1001179 | 3300003784 | Bacteria | 10987 |
| 21 | Ga0055530_10000259 | 3300003791 | Bacteria | 47742 |
| 22 | Ga0055540_1000105 | 3300003792 | Bacteria | 93593 |
| 23 | Ga0055531_10000081 | 3300003794 | Bacteria | 103600 |
| 24 | Ga0055541_1000003 | 3300003841 | Bacteria | 663004 |
| 25 | Ga0055541_1008295 | 3300003841 | Bacteria | 1661 |
| 26 | Ga0065714_10002505 | 3300005288 | Bacteria | 22372 |
| 27 | Ga0065714_10067698 | 3300005288 | Bacteria | 5246 |
| 28 | Ga0065714_10071937 | 3300005288 | Bacteria | 3465 |
| 29 | Ga0065714_10098434 | 3300005288 | Bacteria | 1711 |
| 30 | Ga0065714_10108719 | 3300005288 | Bacteria | 1511 |
| 31 | Ga0070676_10275990 | 3300005328 | Bacteria | 1131 |
| 32 | Ga0070670_100007654 | 3300005331 | Bacteria | 9179 |
| 33 | Ga0068869_100071545 | 3300005334 | Bacteria | 2568 |
| 34 | Ga0070668_100002511 | 3300005347 | Bacteria | 13515 |
| 35 | Ga0070669_100006394 | 3300005353 | Bacteria | 8482 |
| 36 | Ga0070669_100063928 | 3300005353 | Bacteria | 2709 |
| 37 | Ga0070675_100111992 | 3300005354 | Bacteria | 2310 |
| 38 | Ga0070674_100095734 | 3300005356 | Bacteria | 2153 |
| 39 | Ga0070659_100001434 | 3300005366 | Bacteria | 17182 |
| 40 | Ga0070667_100287197 | 3300005367 | Bacteria | 1478 |
| 41 | Ga0070701_10167209 | 3300005438 | Bacteria | 1278 |
| 42 | Ga0070700_100001656 | 3300005441 | Bacteria | 11153 |
| 43 | Ga0070662_100019335 | 3300005457 | Bacteria | 4623 |
| 44 | Ga0068867_100049492 | 3300005459 | Bacteria | 3094 |
| 45 | Ga0068853_100048670 | 3300005539 | Bacteria | 3642 |
| 46 | Ga0068853_100404867 | 3300005539 | Bacteria | 1278 |
| 47 | Ga0070672_100078917 | 3300005543 | Bacteria | 2634 |
| 48 | Ga0070672_100091113 | 3300005543 | Bacteria | 2460 |
| 49 | Ga0070665_100013666 | 3300005548 | Bacteria | 8167 |
| 50 | Ga0070665_100034111 | 3300005548 | Bacteria | 5118 |
| 51 | Ga0070665_100345641 | 3300005548 | Bacteria | 1493 |
| 52 | Ga0070664_100192217 | 3300005564 | Bacteria | 1819 |
| 53 | Ga0068854_100079243 | 3300005578 | Bacteria | 2421 |
| 54 | Ga0068852_100304461 | 3300005616 | Bacteria | 1544 |
| 55 | Ga0068859_100056948 | 3300005617 | Bacteria | 3937 |
| 56 | Ga0068861_100060140 | 3300005719 | Bacteria | 2911 |
| 57 | Ga0068851_10000251 | 3300005834 | Bacteria | 25318 |
| 58 | Ga0068851_10040259 | 3300005834 | Bacteria | 2349 |
| 59 | Ga0068860_100139990 | 3300005843 | Bacteria | 2325 |
| 60 | Ga0075365_10027755 | 3300006038 | Bacteria | 3605 |
| 61 | Ga0075368_10002741 | 3300006042 | Bacteria | 5814 |
| 62 | Ga0075363_100003970 | 3300006048 | Bacteria | 6394 |
| 63 | Ga0075364_10019688 | 3300006051 | Bacteria | 4238 |
| 64 | Ga0075362_10006218 | 3300006177 | Bacteria | 4436 |
| 65 | Ga0075362_10045025 | 3300006177 | Bacteria | 1959 |
| 66 | Ga0075367_10004049 | 3300006178 | Bacteria | 7090 |
| 67 | Ga0075369_10008317 | 3300006186 | Bacteria | 3990 |
| 68 | Ga0075366_10008293 | 3300006195 | Bacteria | 5772 |
| 69 | Ga0075366_10025355 | 3300006195 | Bacteria | 3462 |
| 70 | Ga0097621_100006028 | 3300006237 | Bacteria | 8568 |
| 71 | Ga0075370_10044048 | 3300006353 | Bacteria | 2522 |
| 72 | Ga0075428_100078978 | 3300006844 | Bacteria | 3591 |
| 73 | Ga0075430_100079162 | 3300006846 | Bacteria | 2755 |
| 74 | Ga0075429_100107193 | 3300006880 | Bacteria | 2441 |
| 75 | Ga0068865_100123527 | 3300006881 | Bacteria | 1929 |
| 76 | Ga0097620_100056947 | 3300006931 | Bacteria | 3937 |
| 77 | Ga0079104_1002600 | 3300006946 | Bacteria | 9462 |
| 78 | Ga0079104_1012703 | 3300006946 | Bacteria | 2630 |
| 79 | Ga0099826_10000007 | 3300006948 | Bacteria | 393518 |
| 80 | Ga0105251_10000032 | 3300009011 | Bacteria | 120825 |
| 81 | Ga0105251_10000078 | 3300009011 | Bacteria | 93496 |
| 82 | Ga0105251_10001024 | 3300009011 | Bacteria | 24532 |
| 83 | Ga0105251_10007444 | 3300009011 | Bacteria | 6744 |
| 84 | Ga0105251_10008460 | 3300009011 | Bacteria | 6188 |
| 85 | Ga0105251_10015827 | 3300009011 | Bacteria | 4104 |
| 86 | Ga0105251_10033813 | 3300009011 | Bacteria | 2534 |
| 87 | Ga0105251_10088032 | 3300009011 | Bacteria | 1429 |
| 88 | Ga0105244_10000190 | 3300009036 | Bacteria | 62853 |
| 89 | Ga0105244_10001075 | 3300009036 | Bacteria | 22766 |
| 90 | Ga0105244_10002651 | 3300009036 | Bacteria | 13407 |
| 91 | Ga0105244_10002693 | 3300009036 | Bacteria | 13288 |
| 92 | Ga0105244_10008972 | 3300009036 | Bacteria | 6188 |
| 93 | Ga0105244_10034704 | 3300009036 | Bacteria | 2654 |
| 94 | Ga0105244_10098827 | 3300009036 | Bacteria | 1429 |
| 95 | Ga0105250_10000241 | 3300009092 | Bacteria | 45446 |
| 96 | Ga0105250_10000265 | 3300009092 | Bacteria | 42626 |
| 97 | Ga0105250_10000560 | 3300009092 | Bacteria | 25085 |
| 98 | Ga0105250_10000898 | 3300009092 | Bacteria | 17524 |
| 99 | Ga0105250_10004003 | 3300009092 | Bacteria | 6875 |
| 100 | Ga0105250_10024377 | 3300009092 | Bacteria | 2438 |
| 101 | Ga0105250_10086517 | 3300009092 | Bacteria | 1272 |
| 102 | Ga0105250_10096169 | 3300009092 | Bacteria | 1207 |
| 103 | Ga0105240_10000250 | 3300009093 | Bacteria | 107111 |
| 104 | Ga0111539_10034048 | 3300009094 | Bacteria | 6180 |
| 105 | Ga0105243_10000103 | 3300009148 | Bacteria | 97091 |
| 106 | Ga0105243_10041967 | 3300009148 | Bacteria | 3579 |
| 107 | Ga0105248_10082872 | 3300009177 | Bacteria | 3608 |
| 108 | Ga0105237_10787463 | 3300009545 | Bacteria | 958 |
| 109 | Ga0105238_10410435 | 3300009551 | Bacteria | 1348 |
| 110 | Ga0105249_10230243 | 3300009553 | Bacteria | 1827 |
| 111 | Ga0105239_10133659 | 3300010375 | Bacteria | 2761 |
| 112 | Ga0105246_10000793 | 3300011119 | Bacteria | 17916 |
| 113 | Ga0157345_1000009 | 3300012498 | Bacteria | 55332 |
| 114 | Ga0157373_10000151 | 3300013100 | Bacteria | 55916 |
| 115 | Ga0157373_10001540 | 3300013100 | Bacteria | 17590 |
| 116 | Ga0157373_10005442 | 3300013100 | Bacteria | 9563 |
| 117 | Ga0157373_10006919 | 3300013100 | Bacteria | 8442 |
| 118 | Ga0157373_10014276 | 3300013100 | Bacteria | 5825 |
| 119 | Ga0157373_10119422 | 3300013100 | Bacteria | 1853 |
| 120 | Ga0157371_10000115 | 3300013102 | Bacteria | 122316 |
| 121 | Ga0157371_10000306 | 3300013102 | Bacteria | 64149 |
| 122 | Ga0157371_10156859 | 3300013102 | Bacteria | 1625 |
| 123 | Ga0157370_10001398 | 3300013104 | Bacteria | 29918 |
| 124 | Ga0157369_10000424 | 3300013105 | Bacteria | 56027 |
| 125 | Ga0157369_10002940 | 3300013105 | Bacteria | 20374 |
| 126 | Ga0157369_10017481 | 3300013105 | Bacteria | 8058 |
| 127 | Ga0157369_10222437 | 3300013105 | Bacteria | 1975 |
| 128 | Ga0163162_10000072 | 3300013306 | Bacteria | 92818 |
| 129 | Ga0163162_10022682 | 3300013306 | Bacteria | 6189 |
| 130 | Ga0163162_10028461 | 3300013306 | Bacteria | 5530 |
| 131 | Ga0163162_10115389 | 3300013306 | Bacteria | 2785 |
| 132 | Ga0157372_10006797 | 3300013307 | Bacteria | 12161 |
| 133 | Ga0157375_10001580 | 3300013308 | Bacteria | 19586 |
| 134 | Ga0157375_10033744 | 3300013308 | Bacteria | 4867 |
| 135 | Ga0157375_10092800 | 3300013308 | Bacteria | 3083 |
| 136 | Ga0157375_10246777 | 3300013308 | Bacteria | 1946 |
| 137 | Ga0163163_10024518 | 3300014325 | Bacteria | 5741 |
| 138 | Ga0182008_10001385 | 3300014497 | Bacteria | 16413 |
| 139 | Ga0182008_10006061 | 3300014497 | Bacteria | 6800 |
| 140 | Ga0182008_10115977 | 3300014497 | Bacteria | 1329 |
| 141 | Ga0182006_1001126 | 3300015261 | Bacteria | 16985 |
| 142 | Ga0182006_1008860 | 3300015261 | Bacteria | 4542 |
| 143 | Ga0182006_1024079 | 3300015261 | Bacteria | 2514 |
| 144 | Ga0182006_1024149 | 3300015261 | Bacteria | 2509 |
| 145 | Ga0182006_1042833 | 3300015261 | Bacteria | 1772 |
| 146 | Ga0182007_10001148 | 3300015262 | Bacteria | 14345 |
| 147 | Ga0182007_10003193 | 3300015262 | Bacteria | 7827 |
| 148 | Ga0182007_10008808 | 3300015262 | Bacteria | 4116 |
| 149 | Ga0163161_10000156 | 3300017792 | Bacteria | 63154 |
| 150 | Ga0163161_10009883 | 3300017792 | Bacteria | 6609 |
| 151 | Ga0163161_10011283 | 3300017792 | Bacteria | 6191 |
| 152 | Ga0163161_10219868 | 3300017792 | Bacteria | 1470 |
| 153 | Ga0209435_100067 | 3300025206 | Bacteria | 66388 |
| 154 | Ga0209760_100002 | 3300025207 | Bacteria | 274743 |
| 155 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 156 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 157 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 158 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 159 | Ga0209563_100345 | 3300025230 | Bacteria | 17647 |
| 160 | Ga0207427_100009 | 3300025231 | Bacteria | 663036 |
| 161 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 162 | Ga0209437_100272 | 3300025233 | Bacteria | 77336 |
| 163 | Ga0209646_1000061 | 3300025246 | Bacteria | 255495 |
| 164 | Ga0209026_1003054 | 3300025250 | Bacteria | 5746 |
| 165 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 166 | Ga0209148_1000603 | 3300025254 | Bacteria | 32352 |
| 167 | Ga0209759_1000209 | 3300025256 | Bacteria | 90642 |
| 168 | Ga0209759_1025262 | 3300025256 | Bacteria | 1268 |
| 169 | Ga0209565_1000374 | 3300025263 | Bacteria | 38256 |
| 170 | Ga0209455_1000613 | 3300025272 | Bacteria | 22668 |
| 171 | Ga0209673_1009477 | 3300025273 | Bacteria | 4210 |
| 172 | Ga0209675_1000231 | 3300025291 | Bacteria | 56755 |
| 173 | Ga0209675_1003651 | 3300025291 | Bacteria | 7212 |
| 174 | Ga0209675_1004819 | 3300025291 | Bacteria | 5853 |
| 175 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 176 | Ga0209676_1000036 | 3300025292 | Bacteria | 457623 |
| 177 | Ga0209025_1000345 | 3300025294 | Bacteria | 100876 |
| 178 | Ga0209025_1001077 | 3300025294 | Bacteria | 39567 |
| 179 | Ga0209025_1001122 | 3300025294 | Bacteria | 38354 |
| 180 | Ga0209025_1031182 | 3300025294 | Bacteria | 2529 |
| 181 | Ga0209564_1000878 | 3300025295 | Bacteria | 39964 |
| 182 | Ga0209564_1001207 | 3300025295 | Bacteria | 29501 |
| 183 | Ga0209564_1001260 | 3300025295 | Bacteria | 27874 |
| 184 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 185 | Ga0209256_1000244 | 3300025299 | Bacteria | 96646 |
| 186 | Ga0209256_1000846 | 3300025299 | Bacteria | 38261 |
| 187 | Ga0209051_1000185 | 3300025303 | Bacteria | 110195 |
| 188 | Ga0209051_1035482 | 3300025303 | Bacteria | 1855 |
| 189 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 190 | Ga0207656_10000094 | 3300025321 | Bacteria | 33269 |
| 191 | Ga0207696_1000169 | 3300025711 | Bacteria | 103182 |
| 192 | Ga0207696_1000193 | 3300025711 | Bacteria | 94161 |
| 193 | Ga0207696_1000363 | 3300025711 | Bacteria | 45454 |
| 194 | Ga0207696_1002805 | 3300025711 | Bacteria | 8269 |
| 195 | Ga0207696_1015195 | 3300025711 | Bacteria | 2615 |
| 196 | Ga0207696_1016556 | 3300025711 | Bacteria | 2462 |
| 197 | Ga0207696_1030319 | 3300025711 | Bacteria | 1644 |
| 198 | Ga0207655_1000006 | 3300025728 | Bacteria | 861092 |
| 199 | Ga0207655_1000283 | 3300025728 | Bacteria | 77444 |
| 200 | Ga0207655_1000551 | 3300025728 | Bacteria | 46983 |
| 201 | Ga0207655_1003813 | 3300025728 | Bacteria | 10999 |
| 202 | Ga0207655_1004649 | 3300025728 | Bacteria | 9632 |
| 203 | Ga0207655_1005210 | 3300025728 | Bacteria | 8934 |
| 204 | Ga0207655_1005395 | 3300025728 | Bacteria | 8704 |
| 205 | Ga0207655_1005834 | 3300025728 | Bacteria | 8269 |
| 206 | Ga0207655_1018643 | 3300025728 | Bacteria | 3668 |
| 207 | Ga0207655_1022189 | 3300025728 | Bacteria | 3192 |
| 208 | Ga0207713_1000020 | 3300025735 | Bacteria | 359258 |
| 209 | Ga0207713_1000060 | 3300025735 | Bacteria | 213145 |
| 210 | Ga0207713_1001221 | 3300025735 | Bacteria | 21470 |
| 211 | Ga0207713_1002183 | 3300025735 | Bacteria | 14508 |
| 212 | Ga0207713_1007911 | 3300025735 | Bacteria | 6195 |
| 213 | Ga0207713_1011205 | 3300025735 | Bacteria | 4897 |
| 214 | Ga0207713_1013068 | 3300025735 | Bacteria | 4400 |
| 215 | Ga0207713_1029853 | 3300025735 | Bacteria | 2435 |
| 216 | Ga0207713_1061162 | 3300025735 | Bacteria | 1434 |
| 217 | Ga0207713_1075603 | 3300025735 | Bacteria | 1228 |
| 218 | Ga0207680_10011842 | 3300025903 | Bacteria | 4423 |
| 219 | Ga0207695_10000615 | 3300025913 | Bacteria | 71501 |
| 220 | Ga0207695_10038879 | 3300025913 | Bacteria | 5117 |
| 221 | Ga0207681_10002725 | 3300025923 | Bacteria | 11187 |
| 222 | Ga0207681_10004592 | 3300025923 | Bacteria | 8495 |
| 223 | Ga0207650_10001093 | 3300025925 | Bacteria | 20031 |
| 224 | Ga0207659_10026434 | 3300025926 | Bacteria | 3916 |
| 225 | Ga0207690_10007146 | 3300025932 | Bacteria | 6631 |
| 226 | Ga0207706_10000668 | 3300025933 | Bacteria | 36073 |
| 227 | Ga0207706_10020727 | 3300025933 | Bacteria | 5906 |
| 228 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 229 | Ga0207691_10025239 | 3300025940 | Bacteria | 5580 |
| 230 | Ga0207689_10157497 | 3300025942 | Bacteria | 1872 |
| 231 | Ga0207679_10256009 | 3300025945 | Bacteria | 1491 |
| 232 | Ga0207667_10043443 | 3300025949 | Bacteria | 4769 |
| 233 | Ga0207668_10001796 | 3300025972 | Bacteria | 12529 |
| 234 | Ga0207640_10058929 | 3300025981 | Bacteria | 2532 |
| 235 | Ga0207658_10264705 | 3300025986 | Bacteria | 1467 |
| 236 | Ga0207639_10064389 | 3300026041 | Bacteria | 2842 |
| 237 | Ga0207708_10008158 | 3300026075 | Bacteria | 7755 |
| 238 | Ga0207702_10180179 | 3300026078 | Bacteria | 1945 |
| 239 | Ga0207648_10066643 | 3300026089 | Bacteria | 3140 |
| 240 | Ga0207676_10282026 | 3300026095 | Bacteria | 1509 |
| 241 | Ga0207675_100008666 | 3300026118 | Bacteria | 9560 |
| 242 | Ga0207698_10001442 | 3300026142 | Bacteria | 13816 |
| 243 | Ga0209281_1008310 | 3300027111 | Bacteria | 2530 |
| 244 | Ga0209371_1001498 | 3300027312 | Bacteria | 15558 |
| 245 | Ga0209282_1000021 | 3300027666 | Bacteria | 177705 |
| 246 | Ga0268266_10279974 | 3300028379 | Bacteria | 1550 |
| 247 | Ga0268266_10307467 | 3300028379 | Bacteria | 1481 |
| 248 | Ga0268265_10028981 | 3300028380 | Bacteria | 3969 |
| 249 | Ga0268256_1003139 | 3300030500 | Bacteria | 7700 |
| 250 | Ga0265316_10121215 | 3300031344 | Bacteria | 1975 |
| 251 | Ga0307408_100000074 | 3300031548 | Bacteria | 111955 |
| 252 | Ga0307408_100022868 | 3300031548 | Bacteria | 4253 |
| 253 | Ga0307408_100270786 | 3300031548 | Bacteria | 1410 |
| 254 | Ga0265314_10002266 | 3300031711 | Bacteria | 19921 |
| 255 | Ga0316576_10140034 | 3300031727 | Unclassified | 1821 |
| 256 | Ga0307406_10157227 | 3300031901 | Bacteria | 1629 |
| 257 | Ga0307407_10154153 | 3300031903 | Bacteria | 1496 |
| 258 | Ga0307412_10000459 | 3300031911 | Bacteria | 24584 |
| 259 | Ga0307412_10000594 | 3300031911 | Bacteria | 21381 |
| 260 | Ga0307409_100164708 | 3300031995 | Bacteria | 1944 |
| 261 | Ga0307409_100164730 | 3300031995 | Bacteria | 1944 |
| 262 | Ga0307416_100201264 | 3300032002 | Bacteria | 1890 |
| 263 | Ga0307414_10012907 | 3300032004 | Bacteria | 4958 |
| 264 | Ga0307414_10048154 | 3300032004 | Bacteria | 2939 |
| 265 | Ga0307414_10167632 | 3300032004 | Bacteria | 1752 |
| 266 | Ga0307414_10307432 | 3300032004 | Bacteria | 1344 |
| 267 | Ga0307411_10002996 | 3300032005 | Bacteria | 7690 |
| 268 | Ga0307411_10005887 | 3300032005 | Bacteria | 6082 |
| 269 | Ga0307411_10032567 | 3300032005 | Bacteria | 3222 |
| 270 | Ga0307411_10111223 | 3300032005 | Bacteria | 1961 |
| 271 | Ga0307510_10000265 | 3300033180 | Bacteria | 47882 |
| 272 | Ga0316574_0127431 | 3300035398 | Bacteria | 1637 |
| 273 | Ga0395905_0009894 | 3300037471 | Bacteria | 9293 |
| 274 | Ga0237819_00585 | 3300038705 | Bacteria | 12172 |
| 275 | Ga0439438_000190 | 3300041405 | Bacteria | 27711 |
| 276 | Ga0439447_012306 | 3300041407 | Bacteria | 2463 |
| 277 | Ga0451793_0439505 | 3300041452 | Bacteria | 6531 |
| 278 | Ga0451839_0364642 | 3300041496 | Bacteria | 2657 |
| 279 | Ga0451841_0330586 | 3300041498 | Bacteria | 5744 |
| 280 | Ga0439432_000450 | 3300042006 | Bacteria | 15331 |
| 281 | Ga0439432_002490 | 3300042006 | Bacteria | 6938 |
| 282 | Ga0439456_008369 | 3300042013 | Bacteria | 2134 |
| 283 | Ga0439456_009091 | 3300042013 | Bacteria | 2052 |
| 284 | Ga0439463_000246 | 3300042016 | Bacteria | 14986 |
| 285 | Ga0439463_005777 | 3300042016 | Bacteria | 3071 |
| 286 | Ga0450911_000060 | 3300042115 | Bacteria | 44515 |
| 287 | Ga0450903_006129 | 3300042138 | Bacteria | 2007 |
| 288 | Ga0450889_006281 | 3300042144 | Bacteria | 1191 |
| 289 | Ga0450906_000025 | 3300042145 | Bacteria | 27046 |
| 290 | Ga0450893_0000671 | 3300042532 | Bacteria | 4924 |
| 291 | Ga0453684_0044496 | 3300044712 | Bacteria | 5938 |
| 292 | Ga0466958_0084182 | 3300045836 | Bacteria | 1961 |
| 293 | Ga0466967_0062113 | 3300045976 | Bacteria | 3316 |
| 294 | Ga0495617_005002 | 3300046452 | Bacteria | 4761 |
| 295 | Ga0495617_005622 | 3300046452 | Bacteria | 4434 |
| 296 | Ga0495617_021300 | 3300046452 | Bacteria | 2189 |
| 297 | Ga0495627_000062 | 3300046453 | Bacteria | 138772 |
| 298 | Ga0495627_000239 | 3300046453 | Bacteria | 57647 |
| 299 | Ga0495627_001016 | 3300046453 | Bacteria | 18819 |
| 300 | Ga0495627_001778 | 3300046453 | Bacteria | 11550 |
| 301 | Ga0495627_002540 | 3300046453 | Bacteria | 8672 |
| 302 | Ga0495627_004978 | 3300046453 | Bacteria | 5451 |
| 303 | Ga0495627_023743 | 3300046453 | Bacteria | 2005 |
| 304 | Ga0495627_028690 | 3300046453 | Bacteria | 1776 |
| 305 | Ga0495603_0002114 | 3300046455 | Bacteria | 11680 |
| 306 | Ga0495590_0010664 | 3300046457 | Bacteria | 3445 |
| 307 | Ga0495590_0026410 | 3300046457 | Bacteria | 2039 |
| 308 | Ga0495591_000107 | 3300046458 | Bacteria | 95742 |
| 309 | Ga0495591_000323 | 3300046458 | Bacteria | 43207 |
| 310 | Ga0495591_000774 | 3300046458 | Bacteria | 23026 |
| 311 | Ga0495591_001826 | 3300046458 | Bacteria | 12581 |
| 312 | Ga0495591_002165 | 3300046458 | Bacteria | 11255 |
| 313 | Ga0495591_003014 | 3300046458 | Bacteria | 8962 |
| 314 | Ga0495591_003018 | 3300046458 | Bacteria | 8960 |
| 315 | Ga0495591_003943 | 3300046458 | Bacteria | 7447 |
| 316 | Ga0495591_005561 | 3300046458 | Bacteria | 5796 |
| 317 | Ga0495591_008120 | 3300046458 | Bacteria | 4338 |
| 318 | Ga0495591_008413 | 3300046458 | Bacteria | 4227 |
| 319 | Ga0495591_013632 | 3300046458 | Bacteria | 2961 |
| 320 | Ga0495591_053093 | 3300046458 | Bacteria | 1100 |
| 321 | Ga0495638_0004844 | 3300046460 | Bacteria | 10137 |
| 322 | Ga0495638_0005423 | 3300046460 | Bacteria | 9492 |
| 323 | Ga0495638_0008482 | 3300046460 | Bacteria | 7283 |
| 324 | Ga0495638_0008864 | 3300046460 | Bacteria | 7100 |
| 325 | Ga0495638_0013249 | 3300046460 | Bacteria | 5622 |
| 326 | Ga0495638_0062264 | 3300046460 | Bacteria | 2303 |
| 327 | Ga0495638_0113909 | 3300046460 | Bacteria | 1604 |
| 328 | Ga0495638_0132234 | 3300046460 | Bacteria | 1464 |
| 329 | Ga0495653_0000110 | 3300046463 | Bacteria | 68799 |
| 330 | Ga0495653_0000525 | 3300046463 | Bacteria | 29386 |
| 331 | Ga0495653_0035825 | 3300046463 | Bacteria | 3913 |
| 332 | Ga0495650_0000018 | 3300046471 | Bacteria | 538888 |
| 333 | Ga0495650_0003078 | 3300046471 | Bacteria | 12518 |
| 334 | Ga0495650_0003101 | 3300046471 | Bacteria | 12466 |
| 335 | Ga0495650_0004460 | 3300046471 | Bacteria | 9578 |
| 336 | Ga0495650_0016488 | 3300046471 | Bacteria | 3739 |
| 337 | Ga0495650_0021032 | 3300046471 | Bacteria | 3164 |
| 338 | Ga0495650_0021270 | 3300046471 | Bacteria | 3140 |
| 339 | Ga0495650_0029555 | 3300046471 | Bacteria | 2496 |
| 340 | Ga0495650_0046200 | 3300046471 | Bacteria | 1828 |
| 341 | Ga0495650_0096238 | 3300046471 | Bacteria | 1118 |
| 342 | Ga0495605_0000006 | 3300046474 | Bacteria | 361304 |
| 343 | Ga0495605_0000123 | 3300046474 | Bacteria | 101983 |
| 344 | Ga0495605_0001256 | 3300046474 | Bacteria | 16814 |
| 345 | Ga0495605_0001518 | 3300046474 | Bacteria | 15075 |
| 346 | Ga0495605_0001744 | 3300046474 | Bacteria | 13927 |
| 347 | Ga0495605_0001919 | 3300046474 | Bacteria | 13233 |
| 348 | Ga0495605_0003862 | 3300046474 | Bacteria | 8892 |
| 349 | Ga0495605_0008675 | 3300046474 | Bacteria | 5742 |
| 350 | Ga0495605_0019405 | 3300046474 | Bacteria | 3630 |
| 351 | Ga0495605_0021867 | 3300046474 | Bacteria | 3383 |
| 352 | Ga0495605_0030415 | 3300046474 | Bacteria | 2769 |
| 353 | Ga0495584_0000505 | 3300046491 | Bacteria | 26765 |
| 354 | Ga0495584_0002338 | 3300046491 | Bacteria | 10807 |
| 355 | Ga0495584_0002358 | 3300046491 | Bacteria | 10759 |
| 356 | Ga0495584_0002635 | 3300046491 | Bacteria | 10114 |
| 357 | Ga0495584_0005572 | 3300046491 | Bacteria | 6661 |
| 358 | Ga0495584_0005622 | 3300046491 | Bacteria | 6627 |
| 359 | Ga0495584_0012680 | 3300046491 | Bacteria | 4301 |
| 360 | Ga0495584_0218813 | 3300046491 | Bacteria | 968 |
| 361 | Ga0495585_0000228 | 3300046492 | Bacteria | 57922 |
| 362 | Ga0495585_0001140 | 3300046492 | Bacteria | 21730 |
| 363 | Ga0495585_0003921 | 3300046492 | Bacteria | 9852 |
| 364 | Ga0495585_0004209 | 3300046492 | Bacteria | 9394 |
| 365 | Ga0495585_0005289 | 3300046492 | Bacteria | 8155 |
| 366 | Ga0495585_0007152 | 3300046492 | Bacteria | 6855 |
| 367 | Ga0495594_0018727 | 3300046499 | Bacteria | 3670 |
| 368 | Ga0495596_0000385 | 3300046500 | Bacteria | 28186 |
| 369 | Ga0495596_0010024 | 3300046500 | Bacteria | 4145 |
| 370 | Ga0495596_0066571 | 3300046500 | Bacteria | 1400 |
| 371 | Ga0495596_0075126 | 3300046500 | Bacteria | 1312 |
| 372 | Ga0495607_0000210 | 3300046501 | Bacteria | 62298 |
| 373 | Ga0495607_0001376 | 3300046501 | Bacteria | 21622 |
| 374 | Ga0495607_0001798 | 3300046501 | Bacteria | 18317 |
| 375 | Ga0495607_0001929 | 3300046501 | Bacteria | 17511 |
| 376 | Ga0495607_0002076 | 3300046501 | Bacteria | 16733 |
| 377 | Ga0495607_0007597 | 3300046501 | Bacteria | 7476 |
| 378 | Ga0495607_0011178 | 3300046501 | Bacteria | 5993 |
| 379 | Ga0495607_0012233 | 3300046501 | Bacteria | 5672 |
| 380 | Ga0495607_0012388 | 3300046501 | Bacteria | 5635 |
| 381 | Ga0495607_0013606 | 3300046501 | Bacteria | 5327 |
| 382 | Ga0495607_0038502 | 3300046501 | Bacteria | 2864 |
| 383 | Ga0495607_0044697 | 3300046501 | Bacteria | 2610 |
| 384 | Ga0495607_0058363 | 3300046501 | Bacteria | 2206 |
| 385 | Ga0495607_0063015 | 3300046501 | Bacteria | 2099 |
| 386 | Ga0495607_0067003 | 3300046501 | Bacteria | 2018 |
| 387 | Ga0495607_0092095 | 3300046501 | Bacteria | 1640 |
| 388 | Ga0495607_0108084 | 3300046501 | Bacteria | 1478 |
| 389 | Ga0495583_0000036 | 3300046506 | Bacteria | 246077 |
| 390 | Ga0495583_0000798 | 3300046506 | Bacteria | 38957 |
| 391 | Ga0495583_0000984 | 3300046506 | Bacteria | 32650 |
| 392 | Ga0495583_0001142 | 3300046506 | Bacteria | 28911 |
| 393 | Ga0495583_0001347 | 3300046506 | Bacteria | 25452 |
| 394 | Ga0495583_0002613 | 3300046506 | Bacteria | 15067 |
| 395 | Ga0495583_0005174 | 3300046506 | Bacteria | 8983 |
| 396 | Ga0495583_0006457 | 3300046506 | Bacteria | 7665 |
| 397 | Ga0495583_0007233 | 3300046506 | Bacteria | 7028 |
| 398 | Ga0495583_0042430 | 3300046506 | Bacteria | 2124 |
| 399 | Ga0495606_0000098 | 3300046507 | Bacteria | 151131 |
| 400 | Ga0495606_0000421 | 3300046507 | Bacteria | 70842 |
| 401 | Ga0495606_0000782 | 3300046507 | Bacteria | 48702 |
| 402 | Ga0495606_0000988 | 3300046507 | Bacteria | 41466 |
| 403 | Ga0495606_0002509 | 3300046507 | Bacteria | 21176 |
| 404 | Ga0495606_0002630 | 3300046507 | Bacteria | 20483 |
| 405 | Ga0495606_0004727 | 3300046507 | Bacteria | 13409 |
| 406 | Ga0495606_0013803 | 3300046507 | Bacteria | 6351 |
| 407 | Ga0495606_0027248 | 3300046507 | Bacteria | 4056 |
| 408 | Ga0495606_0042999 | 3300046507 | Bacteria | 3018 |
| 409 | Ga0495606_0182470 | 3300046507 | Bacteria | 1209 |
| 410 | Ga0495610_0000780 | 3300046512 | Bacteria | 29954 |
| 411 | Ga0495610_0000916 | 3300046512 | Bacteria | 27419 |
| 412 | Ga0495610_0002584 | 3300046512 | Bacteria | 15022 |
| 413 | Ga0495610_0003306 | 3300046512 | Bacteria | 12676 |
| 414 | Ga0495610_0009530 | 3300046512 | Bacteria | 6127 |
| 415 | Ga0495610_0013697 | 3300046512 | Bacteria | 4803 |
| 416 | Ga0495610_0024880 | 3300046512 | Bacteria | 3224 |
| 417 | Ga0495610_0101475 | 3300046512 | Bacteria | 1288 |
| 418 | Ga0495616_0000168 | 3300046513 | Bacteria | 56324 |
| 419 | Ga0495616_0001463 | 3300046513 | Bacteria | 16397 |
| 420 | Ga0495616_0004346 | 3300046513 | Bacteria | 8941 |
| 421 | Ga0495616_0005711 | 3300046513 | Bacteria | 7619 |
| 422 | Ga0495616_0005991 | 3300046513 | Bacteria | 7415 |
| 423 | Ga0495616_0023032 | 3300046513 | Bacteria | 3356 |
| 424 | Ga0495616_0051554 | 3300046513 | Bacteria | 2052 |
| 425 | Ga0495616_0108712 | 3300046513 | Bacteria | 1290 |
| 426 | Ga0495616_0134382 | 3300046513 | Bacteria | 1131 |
| 427 | Ga0495620_0000001 | 3300046515 | Bacteria | 386508 |
| 428 | Ga0495620_0000184 | 3300046515 | Bacteria | 48200 |
| 429 | Ga0495620_0000955 | 3300046515 | Bacteria | 17780 |
| 430 | Ga0495620_0001339 | 3300046515 | Bacteria | 14955 |
| 431 | Ga0495620_0001469 | 3300046515 | Bacteria | 14091 |
| 432 | Ga0495620_0002022 | 3300046515 | Bacteria | 11834 |
| 433 | Ga0495620_0003675 | 3300046515 | Bacteria | 8761 |
| 434 | Ga0495620_0006280 | 3300046515 | Bacteria | 6539 |
| 435 | Ga0495620_0007910 | 3300046515 | Bacteria | 5737 |
| 436 | Ga0495620_0013303 | 3300046515 | Bacteria | 4219 |
| 437 | Ga0495620_0041153 | 3300046515 | Bacteria | 2028 |
| 438 | Ga0495631_0000221 | 3300046518 | Bacteria | 39142 |
| 439 | Ga0495631_0003793 | 3300046518 | Bacteria | 8219 |
| 440 | Ga0495631_0046869 | 3300046518 | Bacteria | 1899 |
| 441 | Ga0495632_0000222 | 3300046519 | Bacteria | 57787 |
| 442 | Ga0495632_0003153 | 3300046519 | Bacteria | 11920 |
| 443 | Ga0495632_0003661 | 3300046519 | Bacteria | 10783 |
| 444 | Ga0495632_0003969 | 3300046519 | Bacteria | 10261 |
| 445 | Ga0495632_0007269 | 3300046519 | Bacteria | 6982 |
| 446 | Ga0495632_0022406 | 3300046519 | Bacteria | 3386 |
| 447 | Ga0495632_0023538 | 3300046519 | Bacteria | 3288 |
| 448 | Ga0495632_0024825 | 3300046519 | Bacteria | 3178 |
| 449 | Ga0495632_0033388 | 3300046519 | Bacteria | 2642 |
| 450 | Ga0495632_0054912 | 3300046519 | Bacteria | 1951 |
| 451 | Ga0495632_0067709 | 3300046519 | Bacteria | 1721 |
| 452 | Ga0495632_0073817 | 3300046519 | Bacteria | 1635 |
| 453 | Ga0495632_0075300 | 3300046519 | Bacteria | 1615 |
| 454 | Ga0495637_0000181 | 3300046520 | Bacteria | 48899 |
| 455 | Ga0495637_0000465 | 3300046520 | Bacteria | 29588 |
| 456 | Ga0495637_0000590 | 3300046520 | Bacteria | 25917 |
| 457 | Ga0495637_0001443 | 3300046520 | Bacteria | 13998 |
| 458 | Ga0495637_0001971 | 3300046520 | Bacteria | 11600 |
| 459 | Ga0495637_0002205 | 3300046520 | Bacteria | 10889 |
| 460 | Ga0495637_0004032 | 3300046520 | Bacteria | 7670 |
| 461 | Ga0495637_0006073 | 3300046520 | Bacteria | 6100 |
| 462 | Ga0495637_0038036 | 3300046520 | Bacteria | 2085 |
| 463 | Ga0495637_0044395 | 3300046520 | Bacteria | 1892 |
| 464 | Ga0495637_0072503 | 3300046520 | Bacteria | 1386 |
| 465 | Ga0495637_0080572 | 3300046520 | Bacteria | 1298 |
| 466 | Ga0495643_0002208 | 3300046522 | Bacteria | 15866 |
| 467 | Ga0495643_0006539 | 3300046522 | Bacteria | 7667 |
| 468 | Ga0495643_0008185 | 3300046522 | Bacteria | 6648 |
| 469 | Ga0495643_0008354 | 3300046522 | Bacteria | 6562 |
| 470 | Ga0495643_0056022 | 3300046522 | Bacteria | 2105 |
| 471 | Ga0495644_0000783 | 3300046523 | Bacteria | 13069 |
| 472 | Ga0495644_0005330 | 3300046523 | Bacteria | 5020 |
| 473 | Ga0495648_0001614 | 3300046524 | Bacteria | 21924 |
| 474 | Ga0495648_0001703 | 3300046524 | Bacteria | 21263 |
| 475 | Ga0495648_0002271 | 3300046524 | Bacteria | 17946 |
| 476 | Ga0495648_0002636 | 3300046524 | Bacteria | 16295 |
| 477 | Ga0495648_0004515 | 3300046524 | Bacteria | 11869 |
| 478 | Ga0495648_0004683 | 3300046524 | Bacteria | 11602 |
| 479 | Ga0495648_0009594 | 3300046524 | Bacteria | 7470 |
| 480 | Ga0495648_0010027 | 3300046524 | Bacteria | 7263 |
| 481 | Ga0495648_0011326 | 3300046524 | Bacteria | 6727 |
| 482 | Ga0495666_0027101 | 3300046526 | Bacteria | 2821 |
| 483 | Ga0495666_0167631 | 3300046526 | Bacteria | 1016 |
| 484 | Ga0495642_0052170 | 3300046528 | Bacteria | 1684 |
| 485 | Ga0495652_0400853 | 3300046529 | Bacteria | 971 |
| 486 | Ga0495654_0000111 | 3300046530 | Bacteria | 92977 |
| 487 | Ga0495654_0000192 | 3300046530 | Bacteria | 59720 |
| 488 | Ga0495654_0000478 | 3300046530 | Bacteria | 33081 |
| 489 | Ga0495654_0001785 | 3300046530 | Bacteria | 14345 |
| 490 | Ga0495654_0002127 | 3300046530 | Bacteria | 12936 |
| 491 | Ga0495654_0007333 | 3300046530 | Bacteria | 6176 |
| 492 | Ga0495654_0011790 | 3300046530 | Bacteria | 4719 |
| 493 | Ga0495654_0027206 | 3300046530 | Bacteria | 2934 |
| 494 | Ga0495654_0035686 | 3300046530 | Bacteria | 2501 |
| 495 | Ga0495654_0036637 | 3300046530 | Bacteria | 2464 |
| 496 | Ga0495654_0044214 | 3300046530 | Bacteria | 2203 |
| 497 | Ga0495654_0109104 | 3300046530 | Bacteria | 1264 |
| 498 | Ga0495587_0001739 | 3300046536 | Bacteria | 14536 |
| 499 | Ga0495587_0017000 | 3300046536 | Bacteria | 4523 |
| 500 | Ga0495609_0000029 | 3300046538 | Bacteria | 217067 |
| 501 | Ga0495609_0000034 | 3300046538 | Bacteria | 201125 |
| 502 | Ga0495609_0000035 | 3300046538 | Bacteria | 196269 |
| 503 | Ga0495609_0000329 | 3300046538 | Bacteria | 41907 |
| 504 | Ga0495609_0001540 | 3300046538 | Bacteria | 15127 |
| 505 | Ga0495609_0002051 | 3300046538 | Bacteria | 12691 |
| 506 | Ga0495609_0005908 | 3300046538 | Bacteria | 6325 |
| 507 | Ga0495609_0010480 | 3300046538 | Bacteria | 4443 |
| 508 | Ga0495609_0026795 | 3300046538 | Bacteria | 2637 |
| 509 | Ga0495609_0041341 | 3300046538 | Bacteria | 2072 |
| 510 | Ga0495597_0001453 | 3300046542 | Bacteria | 16962 |
| 511 | Ga0495597_0009066 | 3300046542 | Bacteria | 4942 |
| 512 | Ga0495597_0011627 | 3300046542 | Bacteria | 4263 |
| 513 | Ga0495597_0013245 | 3300046542 | Bacteria | 3956 |
| 514 | Ga0495597_0025233 | 3300046542 | Bacteria | 2737 |
| 515 | Ga0495597_0029599 | 3300046542 | Bacteria | 2500 |
| 516 | Ga0495597_0035257 | 3300046542 | Bacteria | 2257 |
| 517 | Ga0495597_0050781 | 3300046542 | Bacteria | 1829 |
| 518 | Ga0495597_0079311 | 3300046542 | Bacteria | 1406 |
| 519 | Ga0495645_0066767 | 3300046543 | Bacteria | 2598 |
| 520 | Ga0495622_0000911 | 3300046557 | Bacteria | 16047 |
| 521 | Ga0495622_0012641 | 3300046557 | Bacteria | 3912 |
| 522 | Ga0495622_0097134 | 3300046557 | Bacteria | 1351 |
| 523 | Ga0495633_0000016 | 3300046558 | Bacteria | 250457 |
| 524 | Ga0495633_0002557 | 3300046558 | Bacteria | 12755 |
| 525 | Ga0495633_0006318 | 3300046558 | Bacteria | 7056 |
| 526 | Ga0495633_0152762 | 3300046558 | Bacteria | 1066 |
| 527 | Ga0495668_0001572 | 3300046616 | Bacteria | 21592 |
| 528 | Ga0495668_0007142 | 3300046616 | Bacteria | 7187 |
| 529 | Ga0495668_0035052 | 3300046616 | Bacteria | 2812 |
| 530 | Ga0495668_0047839 | 3300046616 | Bacteria | 2374 |
| 531 | Ga0495668_0081718 | 3300046616 | Bacteria | 1772 |
| 532 | Ga0495634_0001755 | 3300046642 | Bacteria | 18787 |
| 533 | Ga0495634_0013585 | 3300046642 | Bacteria | 5882 |
| 534 | Ga0495611_0000107 | 3300046648 | Bacteria | 58046 |
| 535 | Ga0495611_0000904 | 3300046648 | Bacteria | 16136 |
| 536 | Ga0495611_0001132 | 3300046648 | Bacteria | 13971 |
| 537 | Ga0495611_0152072 | 3300046648 | Bacteria | 1080 |
| 538 | Ga0495625_0000004 | 3300046660 | Bacteria | 611314 |
| 539 | Ga0495625_0000337 | 3300046660 | Bacteria | 71532 |
| 540 | Ga0495625_0001089 | 3300046660 | Bacteria | 35275 |
| 541 | Ga0495625_0001350 | 3300046660 | Bacteria | 30319 |
| 542 | Ga0495625_0010814 | 3300046660 | Bacteria | 7511 |
| 543 | Ga0495625_0035582 | 3300046660 | Bacteria | 3669 |
| 544 | Ga0495625_0171577 | 3300046660 | Bacteria | 1448 |
| 545 | Ga0495625_0213761 | 3300046660 | Bacteria | 1266 |
| 546 | Ga0495635_0000856 | 3300046663 | Bacteria | 19937 |
| 547 | Ga0495661_0000004 | 3300046665 | Bacteria | 555340 |
| 548 | Ga0495661_0000041 | 3300046665 | Bacteria | 151138 |
| 549 | Ga0495661_0000288 | 3300046665 | Bacteria | 57108 |
| 550 | Ga0495661_0000443 | 3300046665 | Bacteria | 43820 |
| 551 | Ga0495661_0007133 | 3300046665 | Bacteria | 7802 |
| 552 | Ga0495661_0010296 | 3300046665 | Bacteria | 6386 |
| 553 | Ga0495661_0011031 | 3300046665 | Bacteria | 6138 |
| 554 | Ga0495661_0011768 | 3300046665 | Bacteria | 5926 |
| 555 | Ga0495661_0098561 | 3300046665 | Bacteria | 1649 |
| 556 | Ga0495661_0157789 | 3300046665 | Bacteria | 1220 |
| 557 | Ga0495588_0003508 | 3300046674 | Bacteria | 6841 |
| 558 | Ga0495623_0001646 | 3300046679 | Bacteria | 15007 |
| 559 | Ga0495646_0003121 | 3300046680 | Bacteria | 10276 |
| 560 | Ga0495646_0046235 | 3300046680 | Bacteria | 2654 |
| 561 | Ga0495613_0016575 | 3300046689 | Bacteria | 5485 |
| 562 | Ga0495613_0229319 | 3300046689 | Bacteria | 1301 |
| 563 | Ga0495624_0000637 | 3300046690 | Bacteria | 27477 |
| 564 | Ga0495624_0031549 | 3300046690 | Bacteria | 3443 |
| 565 | Ga0495670_0000105 | 3300046691 | Bacteria | 37273 |
| 566 | Ga0495670_0004953 | 3300046691 | Bacteria | 6541 |
| 567 | Ga0495670_0062655 | 3300046691 | Bacteria | 1871 |
| 568 | Ga0495671_0001925 | 3300046692 | Bacteria | 13325 |
| 569 | Ga0495671_0002727 | 3300046692 | Bacteria | 11062 |
| 570 | Ga0495671_0003072 | 3300046692 | Bacteria | 10368 |
| 571 | Ga0495671_0003848 | 3300046692 | Bacteria | 9121 |
| 572 | Ga0495671_0005396 | 3300046692 | Bacteria | 7492 |
| 573 | Ga0495671_0016959 | 3300046692 | Bacteria | 3880 |
| 574 | Ga0495671_0023908 | 3300046692 | Bacteria | 3189 |
| 575 | Ga0495671_0029342 | 3300046692 | Bacteria | 2825 |
| 576 | Ga0495671_0070792 | 3300046692 | Bacteria | 1713 |
| 577 | Ga0495649_0002385 | 3300046694 | Bacteria | 13290 |
| 578 | Ga0495649_0003729 | 3300046694 | Bacteria | 10130 |
| 579 | Ga0495649_0005030 | 3300046694 | Bacteria | 8500 |
| 580 | Ga0495649_0012142 | 3300046694 | Bacteria | 5026 |
| 581 | Ga0495649_0024414 | 3300046694 | Bacteria | 3372 |
| 582 | Ga0495649_0031427 | 3300046694 | Bacteria | 2927 |
| 583 | Ga0495649_0032146 | 3300046694 | Bacteria | 2892 |
| 584 | Ga0495649_0058343 | 3300046694 | Bacteria | 2080 |
| 585 | Ga0495649_0060925 | 3300046694 | Bacteria | 2029 |
| 586 | Ga0495589_0000278 | 3300046794 | Bacteria | 41647 |
| 587 | Ga0495589_0007278 | 3300046794 | Bacteria | 5796 |
| 588 | Ga0495589_0009224 | 3300046794 | Bacteria | 5132 |
| 589 | Ga0495589_0017355 | 3300046794 | Bacteria | 3694 |
| 590 | Ga0495600_0023735 | 3300046809 | Bacteria | 3945 |
| 591 | Ga0495660_0000004 | 3300046810 | Bacteria | 1003183 |
| 592 | Ga0495660_0000998 | 3300046810 | Bacteria | 20590 |
| 593 | Ga0495660_0001470 | 3300046810 | Bacteria | 16027 |
| 594 | Ga0495660_0001702 | 3300046810 | Bacteria | 14721 |
| 595 | Ga0495660_0002168 | 3300046810 | Bacteria | 12650 |
| 596 | Ga0495660_0002263 | 3300046810 | Bacteria | 12382 |
| 597 | Ga0495660_0007379 | 3300046810 | Bacteria | 6457 |
| 598 | Ga0495660_0007452 | 3300046810 | Bacteria | 6423 |
| 599 | Ga0495660_0008421 | 3300046810 | Bacteria | 6037 |
| 600 | Ga0495660_0010816 | 3300046810 | Bacteria | 5299 |
| 601 | Ga0495660_0013777 | 3300046810 | Bacteria | 4686 |
| 602 | Ga0495660_0044274 | 3300046810 | Bacteria | 2449 |
| 603 | Ga0495660_0058751 | 3300046810 | Bacteria | 2070 |
| 604 | Ga0495604_0098533 | 3300047317 | Bacteria | 2153 |
| 605 | Ga0495674_0024635 | 3300047319 | Bacteria | 5524 |
| 606 | Ga0495672_0000672 | 3300047320 | Bacteria | 37986 |
| 607 | Ga0495672_0002204 | 3300047320 | Bacteria | 18139 |
| 608 | Ga0495672_0003725 | 3300047320 | Bacteria | 12852 |
| 609 | Ga0495672_0013260 | 3300047320 | Bacteria | 5693 |
| 610 | Ga0495672_0018945 | 3300047320 | Bacteria | 4554 |
| 611 | Ga0495672_0044424 | 3300047320 | Bacteria | 2665 |
| 612 | Ga0495672_0064285 | 3300047320 | Bacteria | 2101 |
| 613 | Ga0495672_0145022 | 3300047320 | Bacteria | 1236 |
| 614 | Ga0495676_0000023 | 3300047321 | Bacteria | 156478 |
| 615 | Ga0495676_0000286 | 3300047321 | Bacteria | 40855 |
| 616 | Ga0495676_0008721 | 3300047321 | Bacteria | 9279 |
| 617 | Ga0495680_0020625 | 3300047322 | Bacteria | 5538 |
| 618 | Ga0495680_0033183 | 3300047322 | Bacteria | 4181 |
| 619 | Ga0495683_0000074 | 3300047323 | Bacteria | 100733 |
| 620 | Ga0495683_0000270 | 3300047323 | Bacteria | 45608 |
| 621 | Ga0495683_0004249 | 3300047323 | Bacteria | 8177 |
| 622 | Ga0495683_0006486 | 3300047323 | Bacteria | 6392 |
| 623 | Ga0495683_0082963 | 3300047323 | Bacteria | 1561 |
| 624 | Ga0495675_0044149 | 3300047444 | Bacteria | 2839 |
| 625 | Ga0495675_0048647 | 3300047444 | Bacteria | 2697 |
| 626 | Ga0495679_000127 | 3300047446 | Bacteria | 67885 |
| 627 | Ga0495679_000256 | 3300047446 | Bacteria | 44090 |
| 628 | Ga0495679_000689 | 3300047446 | Bacteria | 21996 |
| 629 | Ga0495679_001938 | 3300047446 | Bacteria | 11054 |
| 630 | Ga0495679_003360 | 3300047446 | Bacteria | 7727 |
| 631 | Ga0495679_021316 | 3300047446 | Bacteria | 2240 |
| 632 | Ga0495679_024054 | 3300047446 | Bacteria | 2057 |
| 633 | Ga0495679_035967 | 3300047446 | Bacteria | 1566 |
| 634 | Ga0495673_0000297 | 3300047469 | Bacteria | 66473 |
| 635 | Ga0495673_0000525 | 3300047469 | Bacteria | 40095 |
| 636 | Ga0495673_0000537 | 3300047469 | Bacteria | 39215 |
| 637 | Ga0495673_0001706 | 3300047469 | Bacteria | 16823 |
| 638 | Ga0495673_0002220 | 3300047469 | Bacteria | 13970 |
| 639 | Ga0495673_0002230 | 3300047469 | Bacteria | 13918 |
| 640 | Ga0495673_0005283 | 3300047469 | Bacteria | 7846 |
| 641 | Ga0495673_0008780 | 3300047469 | Bacteria | 5644 |
| 642 | Ga0495673_0017386 | 3300047469 | Bacteria | 3655 |
| 643 | Ga0495673_0021649 | 3300047469 | Bacteria | 3169 |
| 644 | Ga0495673_0038788 | 3300047469 | Bacteria | 2164 |
| 645 | Ga0495673_0040226 | 3300047469 | Bacteria | 2114 |
| 646 | Ga0495673_0048287 | 3300047469 | Bacteria | 1877 |
| 647 | Ga0495673_0112697 | 3300047469 | Bacteria | 1085 |
| 648 | Ga0495681_0000448 | 3300047470 | Bacteria | 31537 |
| 649 | Ga0495681_0000997 | 3300047470 | Bacteria | 21677 |
| 650 | Ga0495681_0002274 | 3300047470 | Bacteria | 13804 |
| 651 | Ga0495681_0002776 | 3300047470 | Bacteria | 12391 |
| 652 | Ga0495681_0020296 | 3300047470 | Bacteria | 3608 |
| 653 | Ga0495684_0012161 | 3300047471 | Bacteria | 6638 |
| 654 | Ga0495686_0001277 | 3300047472 | Bacteria | 28463 |
| 655 | Ga0495686_0005723 | 3300047472 | Bacteria | 9713 |
| 656 | Ga0495686_0014979 | 3300047472 | Bacteria | 5316 |
| 657 | Ga0495686_0021387 | 3300047472 | Bacteria | 4296 |
| 658 | Ga0495593_0014260 | 3300047673 | Bacteria | 4519 |
| 659 | Ga0495602_0001722 | 3300048088 | Bacteria | 21780 |
| 660 | Ga0495626_0000213 | 3300048091 | Bacteria | 69180 |
| 661 | Ga0495626_0000679 | 3300048091 | Bacteria | 32576 |
| 662 | Ga0495626_0001952 | 3300048091 | Bacteria | 15321 |
| 663 | Ga0495626_0003061 | 3300048091 | Bacteria | 10975 |
| 664 | Ga0495626_0005451 | 3300048091 | Bacteria | 7444 |
| 665 | Ga0495626_0035602 | 3300048091 | Bacteria | 2375 |
| 666 | Ga0495626_0043695 | 3300048091 | Bacteria | 2101 |
| 667 | Ga0496102_0000250 | 3300048905 | Bacteria | 70330 |
| 668 | Ga0496102_0097756 | 3300048905 | Bacteria | 2723 |
| 669 | Ga0496102_0257696 | 3300048905 | Bacteria | 1645 |
| 670 | Ga0496103_0005141 | 3300048906 | Bacteria | 7875 |
| 671 | Ga0496104_0001712 | 3300048907 | Bacteria | 18944 |
| 672 | Ga0496104_0488667 | 3300048907 | Bacteria | 1142 |
| 673 | Ga0496110_0351768 | 3300048913 | Bacteria | 1342 |
| 674 | Ga0496115_0018650 | 3300048918 | Bacteria | 5333 |
| 675 | Ga0496116_0000083 | 3300048919 | Bacteria | 220955 |
| 676 | Ga0496116_0000869 | 3300048919 | Bacteria | 37701 |
| 677 | Ga0496116_0007579 | 3300048919 | Bacteria | 9594 |
| 678 | Ga0496116_0007720 | 3300048919 | Bacteria | 9472 |
| 679 | Ga0496116_0021443 | 3300048919 | Bacteria | 4873 |
| 680 | Ga0496116_0033974 | 3300048919 | Bacteria | 3608 |
| 681 | Ga0496117_0003912 | 3300048920 | Bacteria | 16865 |
| 682 | Ga0496117_0007554 | 3300048920 | Bacteria | 10590 |
| 683 | Ga0496117_0014278 | 3300048920 | Bacteria | 6853 |
| 684 | Ga0496117_0019755 | 3300048920 | Bacteria | 5521 |
| 685 | Ga0496117_0031230 | 3300048920 | Bacteria | 4070 |
| 686 | Ga0496117_0034545 | 3300048920 | Bacteria | 3807 |
| 687 | Ga0496118_0010389 | 3300048921 | Bacteria | 9227 |
| 688 | Ga0496118_0030089 | 3300048921 | Bacteria | 4541 |
| 689 | Ga0496118_0037003 | 3300048921 | Bacteria | 3936 |
| 690 | Ga0496118_0043591 | 3300048921 | Bacteria | 3523 |
| 691 | Ga0496118_0056868 | 3300048921 | Bacteria | 2936 |
| 692 | Ga0496118_0069452 | 3300048921 | Bacteria | 2551 |
| 693 | Ga0496118_0072593 | 3300048921 | Bacteria | 2470 |
| 694 | Ga0496119_0009151 | 3300048922 | Bacteria | 8560 |
| 695 | Ga0496119_0032479 | 3300048922 | Bacteria | 3477 |
| 696 | Ga0496119_0073694 | 3300048922 | Bacteria | 1990 |
| 697 | Ga0496120_0024888 | 3300048923 | Bacteria | 3724 |
| 698 | Ga0496120_0066605 | 3300048923 | Bacteria | 1991 |
| 699 | Ga0496121_0001304 | 3300048924 | Bacteria | 42843 |
| 700 | Ga0496121_0003384 | 3300048924 | Bacteria | 22840 |
| 701 | Ga0496121_0009533 | 3300048924 | Bacteria | 11123 |
| 702 | Ga0496121_0010014 | 3300048924 | Bacteria | 10777 |
| 703 | Ga0496121_0013817 | 3300048924 | Bacteria | 8642 |
| 704 | Ga0496121_0055027 | 3300048924 | Bacteria | 3319 |
| 705 | Ga0496121_0077266 | 3300048924 | Bacteria | 2652 |
| 706 | Ga0496121_0233319 | 3300048924 | Bacteria | 1287 |
| 707 | Ga0496122_0000135 | 3300048925 | Bacteria | 170955 |
| 708 | Ga0496122_0000408 | 3300048925 | Bacteria | 91323 |
| 709 | Ga0496122_0007158 | 3300048925 | Bacteria | 12504 |
| 710 | Ga0496122_0011943 | 3300048925 | Bacteria | 8716 |
| 711 | Ga0496122_0039296 | 3300048925 | Bacteria | 3775 |
| 712 | Ga0496122_0101003 | 3300048925 | Bacteria | 1928 |
| 713 | Ga0496123_0000004 | 3300048926 | Bacteria | 777230 |
| 714 | Ga0496123_0000188 | 3300048926 | Bacteria | 125135 |
| 715 | Ga0496123_0000379 | 3300048926 | Bacteria | 83366 |
| 716 | Ga0496123_0005659 | 3300048926 | Bacteria | 12477 |
| 717 | Ga0496123_0005708 | 3300048926 | Bacteria | 12404 |
| 718 | Ga0496123_0041025 | 3300048926 | Bacteria | 3215 |
| 719 | Ga0496124_0000035 | 3300048927 | Bacteria | 318099 |
| 720 | Ga0496124_0000140 | 3300048927 | Bacteria | 149743 |
| 721 | Ga0496124_0002234 | 3300048927 | Bacteria | 25761 |
| 722 | Ga0496124_0004218 | 3300048927 | Bacteria | 16920 |
| 723 | Ga0496124_0004969 | 3300048927 | Bacteria | 15213 |
| 724 | Ga0496124_0035873 | 3300048927 | Bacteria | 4333 |
| 725 | Ga0496124_0118783 | 3300048927 | Bacteria | 2116 |
| 726 | Ga0496124_0128894 | 3300048927 | Bacteria | 2012 |
| 727 | Ga0496125_0000131 | 3300048928 | Bacteria | 162607 |
| 728 | Ga0496125_0003931 | 3300048928 | Bacteria | 17527 |
| 729 | Ga0496125_0007948 | 3300048928 | Bacteria | 11200 |
| 730 | Ga0496125_0010597 | 3300048928 | Bacteria | 9312 |
| 731 | Ga0496125_0010647 | 3300048928 | Bacteria | 9286 |
| 732 | Ga0496125_0062983 | 3300048928 | Bacteria | 2961 |
| 733 | Ga0496126_0000300 | 3300048929 | Bacteria | 105128 |
| 734 | Ga0495678_000036 | 3300049459 | Bacteria | 198018 |
| 735 | Ga0495678_000120 | 3300049459 | Bacteria | 91473 |
| 736 | Ga0495678_000309 | 3300049459 | Bacteria | 52491 |
| 737 | Ga0495678_000573 | 3300049459 | Bacteria | 34988 |
| 738 | Ga0495678_002641 | 3300049459 | Bacteria | 11904 |
| 739 | Ga0495678_002991 | 3300049459 | Bacteria | 10777 |
| 740 | Ga0495678_005410 | 3300049459 | Bacteria | 7055 |
| 741 | Ga0495678_009248 | 3300049459 | Bacteria | 4895 |
| 742 | Ga0495678_009335 | 3300049459 | Bacteria | 4860 |
| 743 | Ga0495678_022399 | 3300049459 | Bacteria | 2762 |
| 744 | Ga0495682_0001294 | 3300049460 | Bacteria | 13917 |
| 745 | Ga0495682_0002319 | 3300049460 | Bacteria | 9054 |
| 746 | Ga0495682_0003273 | 3300049460 | Bacteria | 7249 |
| 747 | Ga0495682_0035617 | 3300049460 | Bacteria | 1833 |
| 748 | Ga0501040_0172239 | 3300049576 | Bacteria | 1533 |
| 749 | Ga0501047_0000018 | 3300049581 | Bacteria | 274180 |
| 750 | Ga0501069_0040124 | 3300049585 | Bacteria | 2587 |
| 751 | Ga0501073_0117412 | 3300049589 | Bacteria | 1844 |
| 752 | Ga0501075_0021465 | 3300049591 | Bacteria | 4708 |
| 753 | Ga0501076_0304117 | 3300049592 | Bacteria | 1308 |
| 754 | Ga0501222_000941 | 3300049662 | Bacteria | 4186 |
| 755 | Ga0501227_001106 | 3300049665 | Bacteria | 5995 |
| 756 | Ga0501241_000265 | 3300049758 | Bacteria | 11675 |
| 757 | Ga0501269_003058 | 3300049766 | Bacteria | 2033 |
| 758 | nmdc:mga03683_7748_c1 | 3300050489 | Bacteria | 3743 |
| 759 | nmdc:mga03n38_10641_c1 | 3300050490 | Bacteria | 3394 |
| 760 | nmdc:mga00v17_75291_c1 | 3300050491 | Bacteria | 2099 |
| 761 | nmdc:mga0yw44_34475_c1 | 3300050492 | Bacteria | 2967 |
| 762 | nmdc:mga0k408_5928_c1 | 3300050493 | Bacteria | 6517 |
| 763 | nmdc:mga0k408_79045_c1 | 3300050493 | Bacteria | 1925 |
| 764 | nmdc:mga06z11_7119_c1 | 3300050494 | Bacteria | 4591 |
| 765 | nmdc:mga07m45_23895_c1 | 3300050496 | Bacteria | 2844 |
| 766 | nmdc:mga08y16_222829_c1 | 3300050511 | Bacteria | 1952 |
| 767 | nmdc:mga08y16_7016_c1 | 3300050511 | Bacteria | 11816 |
| 768 | nmdc:mga0sz30_20244_c1 | 3300050516 | Bacteria | 2683 |
| 769 | Ga0500646_0000782 | 3300053090 | Bacteria | 8892 |
| 770 | Ga0500572_001586 | 3300053111 | Bacteria | 6030 |
| 771 | Ga0500621_007988 | 3300053126 | Bacteria | 3502 |
| 772 | Ga0500577_0015242 | 3300053142 | Bacteria | 2397 |
| 773 | Ga0500634_0010006 | 3300053161 | Bacteria | 4828 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049585 | Ga0501069_0040124 | Ga0501069_0040124_783_1691 | 270 |
| 2 | 3300049581 | Ga0501047_0000018 | Ga0501047_0000018_267758_268663 | 277 |
| 3 | 3300046501 | Ga0495607_0002076 | Ga0495607_0002076_9093_10037 | 278 |
| 4 | 3300006195 | Ga0075366_10025355 | Ga0075366_100253555 | 281 |
| 5 | 3300050493 | nmdc:mga0k408_79045_c1 | nmdc:mga0k408_79045_c1_757_1674 | 281 |
| 6 | 3300049589 | Ga0501073_0117412 | Ga0501073_0117412_229_1122 | 283 |
| 7 | iso_pu_bacteria | 2511231010 | 2511290649 | 283 |
| 8 | iso_pu_bacteria | 2511231011 | 2511296339 | 283 |
| 9 | iso_pu_bacteria | 2511231018 | 2511340178 | 283 |
| 10 | iso_pu_bacteria | 2511231019 | 2511346442 | 283 |
| 11 | iso_pu_bacteria | 2511231023 | 2511372313 | 283 |
| 12 | iso_pu_bacteria | 2511231031 | 2511415306 | 283 |
| 13 | iso_pu_bacteria | 2599185167 | 2599401770 | 283 |
| 14 | iso_pu_bacteria | 2599185179 | 2599451585 | 283 |
| 15 | iso_pu_bacteria | 2599185190 | 2599515014 | 283 |
| 16 | iso_pu_bacteria | 2599185191 | 2599521115 | 283 |
| 17 | iso_pu_bacteria | 2599185290 | 2599894185 | 283 |
| 18 | iso_pu_bacteria | 2599185307 | 2599973139 | 283 |
| 19 | iso_pu_bacteria | 2600255283 | 2601628005 | 283 |
| 20 | iso_pu_bacteria | 2600255318 | 2601796181 | 283 |
| 21 | iso_pu_bacteria | 2603880185 | 2606073330 | 283 |
| 22 | iso_pu_bacteria | 2603880199 | 2606127024 | 283 |
| 23 | iso_pu_bacteria | 2623620443 | 2624481830 | 283 |
| 24 | iso_pu_bacteria | 2675903420 | 2677900950 | 283 |
| 25 | iso_pu_bacteria | 2713897148 | 2715753163 | 283 |
| 26 | iso_pu_bacteria | 2713897149 | 2715758133 | 283 |
| 27 | iso_pu_bacteria | 2718217725 | 2718635072 | 283 |
| 28 | iso_pu_bacteria | 2738543025 | 2739314161 | 283 |
| 29 | iso_pu_bacteria | 2773857670 | 2774123364 | 283 |
| 30 | iso_pu_bacteria | 2773857673 | 2774132735 | 283 |
| 31 | iso_pu_bacteria | 2784132063 | 2784263451 | 283 |
| 32 | iso_pu_bacteria | 2784132072 | 2784316094 | 283 |
| 33 | iso_pu_bacteria | 2808606361 | 2808854610 | 283 |
| 34 | iso_pu_bacteria | 2808606376 | 2808921746 | 283 |
| 35 | iso_pu_bacteria | 2808606377 | 2808930520 | 283 |
| 36 | iso_pu_bacteria | 2808606378 | 2808934718 | 283 |
| 37 | iso_pu_bacteria | 2808606380 | 2808943867 | 283 |
| 38 | iso_pu_bacteria | 2808606381 | 2808952642 | 283 |
| 39 | iso_pu_bacteria | 2808606382 | 2808957362 | 283 |
| 40 | iso_pu_bacteria | 2808606383 | 2808963115 | 283 |
| 41 | iso_pu_bacteria | 2808606389 | 2808998003 | 283 |
| 42 | iso_pu_bacteria | 2818991456 | 2819655570 | 283 |
| 43 | iso_pu_bacteria | 2834028612 | 2834029839 | 283 |
| 44 | iso_pu_bacteria | 2842832357 | 2842834713 | 283 |
| 45 | iso_pu_bacteria | 2842843487 | 2842843531 | 283 |
| 46 | iso_pu_bacteria | 2852657418 | 2852662430 | 283 |
| 47 | iso_pu_bacteria | 2860339153 | 2860340721 | 283 |
| 48 | iso_pu_bacteria | 2878029506 | 2878033814 | 283 |
| 49 | iso_pu_bacteria | 2880230671 | 2880234436 | 283 |
| 50 | iso_pu_bacteria | 2904518522 | 2904523960 | 283 |
| 51 | iso_pu_bacteria | 2908446538 | 2908448790 | 283 |
| 52 | iso_pu_bacteria | 2919063839 | 2919068800 | 283 |
| 53 | iso_pu_bacteria | 2919487758 | 2919492235 | 283 |
| 54 | iso_pu_bacteria | 2923586266 | 2923586705 | 283 |
| 55 | iso_pu_bacteria | 2931390751 | 2931392909 | 283 |
| 56 | iso_pu_bacteria | 2931396565 | 2931403274 | 283 |
| 57 | iso_pu_bacteria | 2945928738 | 2945928751 | 283 |
| 58 | iso_pu_bacteria | 2945961074 | 2945964967 | 283 |
| 59 | iso_pu_bacteria | 2946006987 | 2946010937 | 283 |
| 60 | iso_pu_bacteria | 2969304461 | 2969308586 | 283 |
| 61 | iso_pu_bacteria | 2998139840 | 2998142943 | 283 |
| 62 | iso_pu_bacteria | 3007419365 | 3007422262 | 283 |
| 63 | iso_pu_bacteria | 3007511990 | 3007515590 | 283 |
| 64 | iso_pu_bacteria | 3007614139 | 3007617247 | 283 |
| 65 | iso_pu_bacteria | 3007718800 | 3007718820 | 283 |
| 66 | iso_pu_bacteria | 8054285046 | 8054287587 | 283 |
| 67 | iso_pu_bacteria | 8055817908 | 8055819977 | 283 |
| 68 | iso_pu_bacteria | 8056161164 | 8056165162 | 283 |
| 69 | iso_pu_bacteria | 8056177738 | 8056179561 | 283 |
| 70 | 3300005334 | Ga0068869_100071545 | Ga0068869_1000715452 | 284 |
| 71 | 3300005438 | Ga0070701_10167209 | Ga0070701_101672091 | 284 |
| 72 | 3300005441 | Ga0070700_100001656 | Ga0070700_1000016567 | 284 |
| 73 | 3300005617 | Ga0068859_100056948 | Ga0068859_1000569483 | 284 |
| 74 | 3300005719 | Ga0068861_100060140 | Ga0068861_1000601402 | 284 |
| 75 | 3300006844 | Ga0075428_100078978 | Ga0075428_1000789783 | 284 |
| 76 | 3300006846 | Ga0075430_100079162 | Ga0075430_1000791623 | 284 |
| 77 | 3300006880 | Ga0075429_100107193 | Ga0075429_1001071933 | 284 |
| 78 | 3300006881 | Ga0068865_100123527 | Ga0068865_1001235272 | 284 |
| 79 | 3300006931 | Ga0097620_100056947 | Ga0097620_1000569473 | 284 |
| 80 | 3300009094 | Ga0111539_10034048 | Ga0111539_100340483 | 284 |
| 81 | 3300009148 | Ga0105243_10041967 | Ga0105243_100419672 | 284 |
| 82 | 3300009553 | Ga0105249_10230243 | Ga0105249_102302432 | 284 |
| 83 | 3300025254 | Ga0209148_1000603 | Ga0209148_100060337 | 284 |
| 84 | 3300025272 | Ga0209455_1000613 | Ga0209455_10006139 | 284 |
| 85 | 3300025942 | Ga0207689_10157497 | Ga0207689_101574972 | 284 |
| 86 | 3300026075 | Ga0207708_10008158 | Ga0207708_100081588 | 284 |
| 87 | 3300026089 | Ga0207648_10066643 | Ga0207648_100666432 | 284 |
| 88 | 3300026118 | Ga0207675_100008666 | Ga0207675_1000086663 | 284 |
| 89 | 3300028380 | Ga0268265_10028981 | Ga0268265_100289812 | 284 |
| 90 | 3300045836 | Ga0466958_0084182 | Ga0466958_0084182_968_1849 | 284 |
| 91 | 3300045976 | Ga0466967_0062113 | Ga0466967_0062113_1622_2503 | 284 |
| 92 | 3300049576 | Ga0501040_0172239 | Ga0501040_0172239_360_1259 | 284 |
| 93 | 3300049591 | Ga0501075_0021465 | Ga0501075_0021465_2803_3702 | 284 |
| 94 | 3300050511 | nmdc:mga08y16_222829_c1 | nmdc:mga08y16_222829_c1_334_1233 | 284 |
| 95 | 3300050511 | nmdc:mga08y16_7016_c1 | nmdc:mga08y16_7016_c1_8121_9020 | 284 |
| 96 | iso_pu_bacteria | 2643221571 | 2643870727 | 284 |
| 97 | iso_pu_bacteria | 2842854478 | 2842855248 | 284 |
| 98 | iso_pu_bacteria | 2860867994 | 2860873271 | 284 |
| 99 | iso_pu_bacteria | 2946027586 | 2946028150 | 284 |
| 100 | iso_pu_bacteria | 2947233263 | 2947236665 | 284 |
| 101 | iso_pu_bacteria | 3007619802 | 3007623786 | 284 |
| 102 | iso_pu_bacteria | 3007866637 | 3007868805 | 284 |
| 103 | iso_pu_bacteria | 8056143049 | 8056146597 | 284 |
| 104 | iso_pu_bacteria | 8056148874 | 8056151037 | 284 |
| 105 | 3300031995 | Ga0307409_100164730 | Ga0307409_1001647302 | 285 |
| 106 | 3300032002 | Ga0307416_100201264 | Ga0307416_1002012642 | 285 |
| 107 | 3300005347 | Ga0070668_100002511 | Ga0070668_10000251110 | 286 |
| 108 | 3300005353 | Ga0070669_100063928 | Ga0070669_1000639284 | 286 |
| 109 | 3300005354 | Ga0070675_100111992 | Ga0070675_1001119924 | 286 |
| 110 | 3300005367 | Ga0070667_100287197 | Ga0070667_1002871973 | 286 |
| 111 | 3300005543 | Ga0070672_100091113 | Ga0070672_1000911132 | 286 |
| 112 | 3300005548 | Ga0070665_100013666 | Ga0070665_1000136667 | 286 |
| 113 | 3300025926 | Ga0207659_10026434 | Ga0207659_100264343 | 286 |
| 114 | 3300025940 | Ga0207691_10025239 | Ga0207691_100252395 | 286 |
| 115 | 3300025972 | Ga0207668_10001796 | Ga0207668_100017963 | 286 |
| 116 | 3300026095 | Ga0207676_10282026 | Ga0207676_102820262 | 286 |
| 117 | 3300031548 | Ga0307408_100270786 | Ga0307408_1002707862 | 286 |
| 118 | 3300032005 | Ga0307411_10005887 | Ga0307411_100058875 | 286 |
| 119 | 3300044712 | Ga0453684_0044496 | Ga0453684_0044496_4062_4961 | 286 |
| 120 | 3300047469 | Ga0495673_0017386 | Ga0495673_0017386_1998_2873 | 286 |
| 121 | iso_pu_bacteria | 2667528173 | 2671106975 | 286 |
| 122 | iso_pu_bacteria | 2904474040 | 2904475900 | 286 |
| 123 | iso_pu_bacteria | 2919150387 | 2919152069 | 286 |
| 124 | iso_pu_bacteria | 2927143783 | 2927144738 | 286 |
| 125 | 3300003781 | Ga0055536_1000198 | Ga0055536_100019822 | 287 |
| 126 | 3300003791 | Ga0055530_10000259 | Ga0055530_1000025922 | 287 |
| 127 | 3300003792 | Ga0055540_1000105 | Ga0055540_100010522 | 287 |
| 128 | 3300003794 | Ga0055531_10000081 | Ga0055531_1000008122 | 287 |
| 129 | 3300003841 | Ga0055541_1008295 | Ga0055541_10082952 | 287 |
| 130 | 3300005288 | Ga0065714_10002505 | Ga0065714_1000250518 | 287 |
| 131 | 3300005288 | Ga0065714_10067698 | Ga0065714_100676987 | 287 |
| 132 | 3300005288 | Ga0065714_10071937 | Ga0065714_100719372 | 287 |
| 133 | 3300005288 | Ga0065714_10098434 | Ga0065714_100984341 | 287 |
| 134 | 3300005288 | Ga0065714_10108719 | Ga0065714_101087192 | 287 |
| 135 | 3300005331 | Ga0070670_100007654 | Ga0070670_1000076544 | 287 |
| 136 | 3300005353 | Ga0070669_100006394 | Ga0070669_1000063946 | 287 |
| 137 | 3300005366 | Ga0070659_100001434 | Ga0070659_1000014347 | 287 |
| 138 | 3300005457 | Ga0070662_100019335 | Ga0070662_1000193356 | 287 |
| 139 | 3300005539 | Ga0068853_100048670 | Ga0068853_1000486704 | 287 |
| 140 | 3300005548 | Ga0070665_100034111 | Ga0070665_1000341116 | 287 |
| 141 | 3300005564 | Ga0070664_100192217 | Ga0070664_1001922172 | 287 |
| 142 | 3300005578 | Ga0068854_100079243 | Ga0068854_1000792432 | 287 |
| 143 | 3300005834 | Ga0068851_10000251 | Ga0068851_1000025125 | 287 |
| 144 | 3300006177 | Ga0075362_10045025 | Ga0075362_100450252 | 287 |
| 145 | 3300006946 | Ga0079104_1002600 | Ga0079104_10026002 | 287 |
| 146 | 3300006946 | Ga0079104_1012703 | Ga0079104_10127031 | 287 |
| 147 | 3300009011 | Ga0105251_10000078 | Ga0105251_1000007835 | 287 |
| 148 | 3300009011 | Ga0105251_10001024 | Ga0105251_1000102414 | 287 |
| 149 | 3300009011 | Ga0105251_10007444 | Ga0105251_100074447 | 287 |
| 150 | 3300009011 | Ga0105251_10008460 | Ga0105251_100084602 | 287 |
| 151 | 3300009011 | Ga0105251_10033813 | Ga0105251_100338132 | 287 |
| 152 | 3300009036 | Ga0105244_10001075 | Ga0105244_100010757 | 287 |
| 153 | 3300009036 | Ga0105244_10002651 | Ga0105244_100026514 | 287 |
| 154 | 3300009036 | Ga0105244_10002693 | Ga0105244_1000269313 | 287 |
| 155 | 3300009036 | Ga0105244_10008972 | Ga0105244_100089722 | 287 |
| 156 | 3300009036 | Ga0105244_10034704 | Ga0105244_100347042 | 287 |
| 157 | 3300009036 | Ga0105244_10098827 | Ga0105244_100988272 | 287 |
| 158 | 3300009092 | Ga0105250_10000560 | Ga0105250_1000056017 | 287 |
| 159 | 3300009092 | Ga0105250_10000898 | Ga0105250_1000089812 | 287 |
| 160 | 3300009092 | Ga0105250_10004003 | Ga0105250_100040035 | 287 |
| 161 | 3300009092 | Ga0105250_10024377 | Ga0105250_100243771 | 287 |
| 162 | 3300009092 | Ga0105250_10086517 | Ga0105250_100865172 | 287 |
| 163 | 3300009092 | Ga0105250_10096169 | Ga0105250_100961691 | 287 |
| 164 | 3300009148 | Ga0105243_10000103 | Ga0105243_1000010369 | 287 |
| 165 | 3300011119 | Ga0105246_10000793 | Ga0105246_1000079316 | 287 |
| 166 | 3300012498 | Ga0157345_1000009 | Ga0157345_100000930 | 287 |
| 167 | 3300013100 | Ga0157373_10000151 | Ga0157373_1000015117 | 287 |
| 168 | 3300013100 | Ga0157373_10001540 | Ga0157373_1000154014 | 287 |
| 169 | 3300013100 | Ga0157373_10005442 | Ga0157373_100054427 | 287 |
| 170 | 3300013100 | Ga0157373_10006919 | Ga0157373_100069195 | 287 |
| 171 | 3300013100 | Ga0157373_10014276 | Ga0157373_100142764 | 287 |
| 172 | 3300013100 | Ga0157373_10119422 | Ga0157373_101194222 | 287 |
| 173 | 3300013102 | Ga0157371_10000306 | Ga0157371_100003069 | 287 |
| 174 | 3300013102 | Ga0157371_10156859 | Ga0157371_101568592 | 287 |
| 175 | 3300013105 | Ga0157369_10000424 | Ga0157369_1000042417 | 287 |
| 176 | 3300013105 | Ga0157369_10002940 | Ga0157369_1000294015 | 287 |
| 177 | 3300013105 | Ga0157369_10017481 | Ga0157369_100174818 | 287 |
| 178 | 3300013306 | Ga0163162_10000072 | Ga0163162_1000007273 | 287 |
| 179 | 3300013306 | Ga0163162_10022682 | Ga0163162_100226822 | 287 |
| 180 | 3300013306 | Ga0163162_10115389 | Ga0163162_101153892 | 287 |
| 181 | 3300013307 | Ga0157372_10006797 | Ga0157372_1000679711 | 287 |
| 182 | 3300013308 | Ga0157375_10001580 | Ga0157375_1000158015 | 287 |
| 183 | 3300013308 | Ga0157375_10033744 | Ga0157375_100337442 | 287 |
| 184 | 3300013308 | Ga0157375_10092800 | Ga0157375_100928004 | 287 |
| 185 | 3300014497 | Ga0182008_10001385 | Ga0182008_1000138511 | 287 |
| 186 | 3300014497 | Ga0182008_10006061 | Ga0182008_100060615 | 287 |
| 187 | 3300014497 | Ga0182008_10115977 | Ga0182008_101159771 | 287 |
| 188 | 3300015261 | Ga0182006_1001126 | Ga0182006_100112620 | 287 |
| 189 | 3300015261 | Ga0182006_1008860 | Ga0182006_10088604 | 287 |
| 190 | 3300015261 | Ga0182006_1024079 | Ga0182006_10240792 | 287 |
| 191 | 3300015261 | Ga0182006_1042833 | Ga0182006_10428331 | 287 |
| 192 | 3300015262 | Ga0182007_10001148 | Ga0182007_1000114810 | 287 |
| 193 | 3300015262 | Ga0182007_10003193 | Ga0182007_100031935 | 287 |
| 194 | 3300015262 | Ga0182007_10008808 | Ga0182007_100088085 | 287 |
| 195 | 3300017792 | Ga0163161_10000156 | Ga0163161_1000015637 | 287 |
| 196 | 3300017792 | Ga0163161_10009883 | Ga0163161_100098835 | 287 |
| 197 | 3300017792 | Ga0163161_10011283 | Ga0163161_100112832 | 287 |
| 198 | 3300017792 | Ga0163161_10219868 | Ga0163161_102198682 | 287 |
| 199 | 3300025230 | Ga0209563_100345 | Ga0209563_1003456 | 287 |
| 200 | 3300025256 | Ga0209759_1025262 | Ga0209759_10252621 | 287 |
| 201 | 3300025292 | Ga0209676_1000010 | Ga0209676_100001022 | 287 |
| 202 | 3300025298 | Ga0209050_1000081 | Ga0209050_1000081228 | 287 |
| 203 | 3300025303 | Ga0209051_1000185 | Ga0209051_100018579 | 287 |
| 204 | 3300025304 | Ga0209257_1000040 | Ga0209257_1000040503 | 287 |
| 205 | 3300025321 | Ga0207656_10000094 | Ga0207656_1000009422 | 287 |
| 206 | 3300025711 | Ga0207696_1000193 | Ga0207696_100019317 | 287 |
| 207 | 3300025711 | Ga0207696_1002805 | Ga0207696_10028051 | 287 |
| 208 | 3300025711 | Ga0207696_1015195 | Ga0207696_10151952 | 287 |
| 209 | 3300025711 | Ga0207696_1016556 | Ga0207696_10165563 | 287 |
| 210 | 3300025711 | Ga0207696_1030319 | Ga0207696_10303191 | 287 |
| 211 | 3300025728 | Ga0207655_1000006 | Ga0207655_1000006367 | 287 |
| 212 | 3300025728 | Ga0207655_1000551 | Ga0207655_100055120 | 287 |
| 213 | 3300025728 | Ga0207655_1004649 | Ga0207655_100464911 | 287 |
| 214 | 3300025728 | Ga0207655_1005210 | Ga0207655_10052107 | 287 |
| 215 | 3300025728 | Ga0207655_1005395 | Ga0207655_10053959 | 287 |
| 216 | 3300025728 | Ga0207655_1005834 | Ga0207655_10058345 | 287 |
| 217 | 3300025728 | Ga0207655_1018643 | Ga0207655_10186432 | 287 |
| 218 | 3300025728 | Ga0207655_1022189 | Ga0207655_10221892 | 287 |
| 219 | 3300025735 | Ga0207713_1000060 | Ga0207713_10000609 | 287 |
| 220 | 3300025735 | Ga0207713_1001221 | Ga0207713_100122120 | 287 |
| 221 | 3300025735 | Ga0207713_1002183 | Ga0207713_10021836 | 287 |
| 222 | 3300025735 | Ga0207713_1007911 | Ga0207713_10079112 | 287 |
| 223 | 3300025735 | Ga0207713_1011205 | Ga0207713_10112052 | 287 |
| 224 | 3300025735 | Ga0207713_1013068 | Ga0207713_10130682 | 287 |
| 225 | 3300025735 | Ga0207713_1029853 | Ga0207713_10298532 | 287 |
| 226 | 3300025923 | Ga0207681_10002725 | Ga0207681_100027259 | 287 |
| 227 | 3300025923 | Ga0207681_10004592 | Ga0207681_100045928 | 287 |
| 228 | 3300025925 | Ga0207650_10001093 | Ga0207650_1000109312 | 287 |
| 229 | 3300025932 | Ga0207690_10007146 | Ga0207690_100071463 | 287 |
| 230 | 3300025933 | Ga0207706_10000668 | Ga0207706_100006686 | 287 |
| 231 | 3300025933 | Ga0207706_10020727 | Ga0207706_100207275 | 287 |
| 232 | 3300025935 | Ga0207709_10000035 | Ga0207709_1000003520 | 287 |
| 233 | 3300025945 | Ga0207679_10256009 | Ga0207679_102560092 | 287 |
| 234 | 3300025981 | Ga0207640_10058929 | Ga0207640_100589292 | 287 |
| 235 | 3300027111 | Ga0209281_1008310 | Ga0209281_10083102 | 287 |
| 236 | 3300028379 | Ga0268266_10279974 | Ga0268266_102799742 | 287 |
| 237 | 3300028379 | Ga0268266_10307467 | Ga0268266_103074672 | 287 |
| 238 | 3300031548 | Ga0307408_100022868 | Ga0307408_1000228682 | 287 |
| 239 | 3300031727 | Ga0316576_10140034 | Ga0316576_101400341 | 287 |
| 240 | 3300031995 | Ga0307409_100164708 | Ga0307409_1001647082 | 287 |
| 241 | 3300032004 | Ga0307414_10048154 | Ga0307414_100481542 | 287 |
| 242 | 3300032004 | Ga0307414_10307432 | Ga0307414_103074321 | 287 |
| 243 | 3300032005 | Ga0307411_10002996 | Ga0307411_100029965 | 287 |
| 244 | 3300032005 | Ga0307411_10111223 | Ga0307411_101112231 | 287 |
| 245 | 3300033180 | Ga0307510_10000265 | Ga0307510_1000026532 | 287 |
| 246 | 3300035398 | Ga0316574_0127431 | Ga0316574_0127431_628_1533 | 287 |
| 247 | 3300038705 | Ga0237819_00585 | Ga0237819_00585_10651_11526 | 287 |
| 248 | 3300041407 | Ga0439447_012306 | Ga0439447_012306_1260_2135 | 287 |
| 249 | 3300042006 | Ga0439432_002490 | Ga0439432_002490_977_1852 | 287 |
| 250 | 3300042016 | Ga0439463_000246 | Ga0439463_000246_9481_10386 | 287 |
| 251 | 3300042016 | Ga0439463_005777 | Ga0439463_005777_2020_2895 | 287 |
| 252 | 3300042115 | Ga0450911_000060 | Ga0450911_000060_41158_42033 | 287 |
| 253 | 3300042138 | Ga0450903_006129 | Ga0450903_006129_987_1862 | 287 |
| 254 | 3300042144 | Ga0450889_006281 | Ga0450889_006281_296_1171 | 287 |
| 255 | 3300042145 | Ga0450906_000025 | Ga0450906_000025_25314_26189 | 287 |
| 256 | 3300042532 | Ga0450893_0000671 | Ga0450893_0000671_2030_2905 | 287 |
| 257 | 3300046452 | Ga0495617_005002 | Ga0495617_005002_3542_4417 | 287 |
| 258 | 3300046452 | Ga0495617_005622 | Ga0495617_005622_1852_2727 | 287 |
| 259 | 3300046452 | Ga0495617_021300 | Ga0495617_021300_970_1845 | 287 |
| 260 | 3300046453 | Ga0495627_000062 | Ga0495627_000062_20376_21290 | 287 |
| 261 | 3300046453 | Ga0495627_000239 | Ga0495627_000239_14128_15003 | 287 |
| 262 | 3300046453 | Ga0495627_001016 | Ga0495627_001016_5076_5951 | 287 |
| 263 | 3300046453 | Ga0495627_001778 | Ga0495627_001778_7681_8556 | 287 |
| 264 | 3300046453 | Ga0495627_002540 | Ga0495627_002540_5072_5977 | 287 |
| 265 | 3300046453 | Ga0495627_004978 | Ga0495627_004978_2961_3836 | 287 |
| 266 | 3300046453 | Ga0495627_023743 | Ga0495627_023743_1065_1940 | 287 |
| 267 | 3300046453 | Ga0495627_028690 | Ga0495627_028690_702_1577 | 287 |
| 268 | 3300046455 | Ga0495603_0002114 | Ga0495603_0002114_2952_3827 | 287 |
| 269 | 3300046457 | Ga0495590_0010664 | Ga0495590_0010664_1606_2481 | 287 |
| 270 | 3300046457 | Ga0495590_0026410 | Ga0495590_0026410_704_1579 | 287 |
| 271 | 3300046458 | Ga0495591_000107 | Ga0495591_000107_80816_81763 | 287 |
| 272 | 3300046458 | Ga0495591_000323 | Ga0495591_000323_25392_26297 | 287 |
| 273 | 3300046458 | Ga0495591_000774 | Ga0495591_000774_14255_15130 | 287 |
| 274 | 3300046458 | Ga0495591_001826 | Ga0495591_001826_7411_8286 | 287 |
| 275 | 3300046458 | Ga0495591_002165 | Ga0495591_002165_6777_7652 | 287 |
| 276 | 3300046458 | Ga0495591_003014 | Ga0495591_003014_1929_2804 | 287 |
| 277 | 3300046458 | Ga0495591_003018 | Ga0495591_003018_5837_6712 | 287 |
| 278 | 3300046458 | Ga0495591_003943 | Ga0495591_003943_4822_5697 | 287 |
| 279 | 3300046458 | Ga0495591_005561 | Ga0495591_005561_2686_3561 | 287 |
| 280 | 3300046458 | Ga0495591_008120 | Ga0495591_008120_214_1089 | 287 |
| 281 | 3300046458 | Ga0495591_008413 | Ga0495591_008413_3200_4075 | 287 |
| 282 | 3300046458 | Ga0495591_013632 | Ga0495591_013632_632_1507 | 287 |
| 283 | 3300046460 | Ga0495638_0004844 | Ga0495638_0004844_6511_7449 | 287 |
| 284 | 3300046460 | Ga0495638_0005423 | Ga0495638_0005423_3090_3965 | 287 |
| 285 | 3300046460 | Ga0495638_0008482 | Ga0495638_0008482_189_1064 | 287 |
| 286 | 3300046460 | Ga0495638_0013249 | Ga0495638_0013249_3089_3964 | 287 |
| 287 | 3300046460 | Ga0495638_0062264 | Ga0495638_0062264_976_1851 | 287 |
| 288 | 3300046460 | Ga0495638_0113909 | Ga0495638_0113909_550_1425 | 287 |
| 289 | 3300046460 | Ga0495638_0132234 | Ga0495638_0132234_244_1119 | 287 |
| 290 | 3300046463 | Ga0495653_0000110 | Ga0495653_0000110_4780_5664 | 287 |
| 291 | 3300046463 | Ga0495653_0000525 | Ga0495653_0000525_14474_15436 | 287 |
| 292 | 3300046463 | Ga0495653_0035825 | Ga0495653_0035825_1399_2274 | 287 |
| 293 | 3300046471 | Ga0495650_0003078 | Ga0495650_0003078_2122_3081 | 287 |
| 294 | 3300046471 | Ga0495650_0003101 | Ga0495650_0003101_8273_9148 | 287 |
| 295 | 3300046471 | Ga0495650_0004460 | Ga0495650_0004460_2428_3303 | 287 |
| 296 | 3300046471 | Ga0495650_0016488 | Ga0495650_0016488_1861_2736 | 287 |
| 297 | 3300046471 | Ga0495650_0021032 | Ga0495650_0021032_1915_2790 | 287 |
| 298 | 3300046471 | Ga0495650_0021270 | Ga0495650_0021270_279_1154 | 287 |
| 299 | 3300046471 | Ga0495650_0029555 | Ga0495650_0029555_654_1601 | 287 |
| 300 | 3300046471 | Ga0495650_0096238 | Ga0495650_0096238_15_893 | 287 |
| 301 | 3300046474 | Ga0495605_0000123 | Ga0495605_0000123_32048_32923 | 287 |
| 302 | 3300046474 | Ga0495605_0001256 | Ga0495605_0001256_11637_12578 | 287 |
| 303 | 3300046474 | Ga0495605_0001744 | Ga0495605_0001744_8187_9062 | 287 |
| 304 | 3300046474 | Ga0495605_0001919 | Ga0495605_0001919_4520_5467 | 287 |
| 305 | 3300046474 | Ga0495605_0003862 | Ga0495605_0003862_3429_4334 | 287 |
| 306 | 3300046474 | Ga0495605_0008675 | Ga0495605_0008675_3271_4146 | 287 |
| 307 | 3300046474 | Ga0495605_0030415 | Ga0495605_0030415_1787_2662 | 287 |
| 308 | 3300046491 | Ga0495584_0000505 | Ga0495584_0000505_19009_20019 | 287 |
| 309 | 3300046491 | Ga0495584_0002338 | Ga0495584_0002338_6503_7378 | 287 |
| 310 | 3300046491 | Ga0495584_0002358 | Ga0495584_0002358_4204_5079 | 287 |
| 311 | 3300046491 | Ga0495584_0002635 | Ga0495584_0002635_4127_5002 | 287 |
| 312 | 3300046491 | Ga0495584_0005572 | Ga0495584_0005572_1659_2534 | 287 |
| 313 | 3300046491 | Ga0495584_0005622 | Ga0495584_0005622_3533_4408 | 287 |
| 314 | 3300046491 | Ga0495584_0012680 | Ga0495584_0012680_3314_4189 | 287 |
| 315 | 3300046492 | Ga0495585_0000228 | Ga0495585_0000228_40017_40892 | 287 |
| 316 | 3300046492 | Ga0495585_0001140 | Ga0495585_0001140_6515_7531 | 287 |
| 317 | 3300046492 | Ga0495585_0003921 | Ga0495585_0003921_3813_4688 | 287 |
| 318 | 3300046492 | Ga0495585_0004209 | Ga0495585_0004209_1749_2624 | 287 |
| 319 | 3300046492 | Ga0495585_0005289 | Ga0495585_0005289_3607_4482 | 287 |
| 320 | 3300046492 | Ga0495585_0007152 | Ga0495585_0007152_565_1440 | 287 |
| 321 | 3300046499 | Ga0495594_0018727 | Ga0495594_0018727_1011_1886 | 287 |
| 322 | 3300046500 | Ga0495596_0010024 | Ga0495596_0010024_1348_2223 | 287 |
| 323 | 3300046500 | Ga0495596_0066571 | Ga0495596_0066571_473_1348 | 287 |
| 324 | 3300046500 | Ga0495596_0075126 | Ga0495596_0075126_162_1037 | 287 |
| 325 | 3300046501 | Ga0495607_0000210 | Ga0495607_0000210_56925_57830 | 287 |
| 326 | 3300046501 | Ga0495607_0001376 | Ga0495607_0001376_14354_15229 | 287 |
| 327 | 3300046501 | Ga0495607_0001798 | Ga0495607_0001798_3200_4075 | 287 |
| 328 | 3300046501 | Ga0495607_0001929 | Ga0495607_0001929_5256_6131 | 287 |
| 329 | 3300046501 | Ga0495607_0007597 | Ga0495607_0007597_1875_2780 | 287 |
| 330 | 3300046501 | Ga0495607_0011178 | Ga0495607_0011178_3825_4700 | 287 |
| 331 | 3300046501 | Ga0495607_0012233 | Ga0495607_0012233_2234_3109 | 287 |
| 332 | 3300046501 | Ga0495607_0038502 | Ga0495607_0038502_566_1441 | 287 |
| 333 | 3300046501 | Ga0495607_0058363 | Ga0495607_0058363_437_1312 | 287 |
| 334 | 3300046501 | Ga0495607_0063015 | Ga0495607_0063015_1029_1904 | 287 |
| 335 | 3300046501 | Ga0495607_0067003 | Ga0495607_0067003_47_922 | 287 |
| 336 | 3300046501 | Ga0495607_0092095 | Ga0495607_0092095_421_1296 | 287 |
| 337 | 3300046501 | Ga0495607_0108084 | Ga0495607_0108084_474_1349 | 287 |
| 338 | 3300046506 | Ga0495583_0000036 | Ga0495583_0000036_41413_42288 | 287 |
| 339 | 3300046506 | Ga0495583_0000798 | Ga0495583_0000798_19928_20803 | 287 |
| 340 | 3300046506 | Ga0495583_0000984 | Ga0495583_0000984_1838_2713 | 287 |
| 341 | 3300046506 | Ga0495583_0001347 | Ga0495583_0001347_19832_20737 | 287 |
| 342 | 3300046506 | Ga0495583_0002613 | Ga0495583_0002613_4050_4925 | 287 |
| 343 | 3300046506 | Ga0495583_0005174 | Ga0495583_0005174_4262_5311 | 287 |
| 344 | 3300046506 | Ga0495583_0006457 | Ga0495583_0006457_3401_4276 | 287 |
| 345 | 3300046506 | Ga0495583_0007233 | Ga0495583_0007233_999_2009 | 287 |
| 346 | 3300046506 | Ga0495583_0042430 | Ga0495583_0042430_995_1870 | 287 |
| 347 | 3300046507 | Ga0495606_0000098 | Ga0495606_0000098_79093_79968 | 287 |
| 348 | 3300046507 | Ga0495606_0000421 | Ga0495606_0000421_4931_5815 | 287 |
| 349 | 3300046507 | Ga0495606_0000782 | Ga0495606_0000782_40305_41321 | 287 |
| 350 | 3300046507 | Ga0495606_0000988 | Ga0495606_0000988_26432_27307 | 287 |
| 351 | 3300046507 | Ga0495606_0002509 | Ga0495606_0002509_3740_4615 | 287 |
| 352 | 3300046507 | Ga0495606_0002630 | Ga0495606_0002630_14553_15428 | 287 |
| 353 | 3300046507 | Ga0495606_0004727 | Ga0495606_0004727_10780_11655 | 287 |
| 354 | 3300046507 | Ga0495606_0013803 | Ga0495606_0013803_5131_6006 | 287 |
| 355 | 3300046507 | Ga0495606_0027248 | Ga0495606_0027248_1633_2508 | 287 |
| 356 | 3300046507 | Ga0495606_0042999 | Ga0495606_0042999_282_1157 | 287 |
| 357 | 3300046507 | Ga0495606_0182470 | Ga0495606_0182470_227_1102 | 287 |
| 358 | 3300046512 | Ga0495610_0000780 | Ga0495610_0000780_1348_2223 | 287 |
| 359 | 3300046512 | Ga0495610_0000916 | Ga0495610_0000916_4291_5166 | 287 |
| 360 | 3300046512 | Ga0495610_0003306 | Ga0495610_0003306_5775_6650 | 287 |
| 361 | 3300046512 | Ga0495610_0009530 | Ga0495610_0009530_2230_3105 | 287 |
| 362 | 3300046512 | Ga0495610_0013697 | Ga0495610_0013697_2005_2880 | 287 |
| 363 | 3300046512 | Ga0495610_0024880 | Ga0495610_0024880_2121_2996 | 287 |
| 364 | 3300046512 | Ga0495610_0101475 | Ga0495610_0101475_375_1250 | 287 |
| 365 | 3300046513 | Ga0495616_0000168 | Ga0495616_0000168_40730_41677 | 287 |
| 366 | 3300046513 | Ga0495616_0001463 | Ga0495616_0001463_14501_15376 | 287 |
| 367 | 3300046513 | Ga0495616_0005711 | Ga0495616_0005711_6697_7572 | 287 |
| 368 | 3300046513 | Ga0495616_0005991 | Ga0495616_0005991_48_923 | 287 |
| 369 | 3300046513 | Ga0495616_0023032 | Ga0495616_0023032_1843_2718 | 287 |
| 370 | 3300046513 | Ga0495616_0051554 | Ga0495616_0051554_989_1864 | 287 |
| 371 | 3300046513 | Ga0495616_0108712 | Ga0495616_0108712_371_1246 | 287 |
| 372 | 3300046513 | Ga0495616_0134382 | Ga0495616_0134382_174_1049 | 287 |
| 373 | 3300046515 | Ga0495620_0000001 | Ga0495620_0000001_316571_317446 | 287 |
| 374 | 3300046515 | Ga0495620_0000184 | Ga0495620_0000184_14213_15088 | 287 |
| 375 | 3300046515 | Ga0495620_0000955 | Ga0495620_0000955_12407_13312 | 287 |
| 376 | 3300046515 | Ga0495620_0001469 | Ga0495620_0001469_11007_11882 | 287 |
| 377 | 3300046515 | Ga0495620_0002022 | Ga0495620_0002022_5199_6074 | 287 |
| 378 | 3300046515 | Ga0495620_0003675 | Ga0495620_0003675_6993_7952 | 287 |
| 379 | 3300046515 | Ga0495620_0006280 | Ga0495620_0006280_4607_5554 | 287 |
| 380 | 3300046515 | Ga0495620_0007910 | Ga0495620_0007910_1921_2826 | 287 |
| 381 | 3300046515 | Ga0495620_0013303 | Ga0495620_0013303_1892_2767 | 287 |
| 382 | 3300046515 | Ga0495620_0041153 | Ga0495620_0041153_473_1348 | 287 |
| 383 | 3300046518 | Ga0495631_0000221 | Ga0495631_0000221_23961_24836 | 287 |
| 384 | 3300046518 | Ga0495631_0003793 | Ga0495631_0003793_6411_7286 | 287 |
| 385 | 3300046518 | Ga0495631_0046869 | Ga0495631_0046869_874_1749 | 287 |
| 386 | 3300046519 | Ga0495632_0000222 | Ga0495632_0000222_42749_43624 | 287 |
| 387 | 3300046519 | Ga0495632_0003153 | Ga0495632_0003153_4448_5395 | 287 |
| 388 | 3300046519 | Ga0495632_0003661 | Ga0495632_0003661_1109_2014 | 287 |
| 389 | 3300046519 | Ga0495632_0003969 | Ga0495632_0003969_5832_6746 | 287 |
| 390 | 3300046519 | Ga0495632_0007269 | Ga0495632_0007269_694_1569 | 287 |
| 391 | 3300046519 | Ga0495632_0022406 | Ga0495632_0022406_2417_3292 | 287 |
| 392 | 3300046519 | Ga0495632_0023538 | Ga0495632_0023538_423_1298 | 287 |
| 393 | 3300046519 | Ga0495632_0024825 | Ga0495632_0024825_1000_1875 | 287 |
| 394 | 3300046519 | Ga0495632_0033388 | Ga0495632_0033388_328_1203 | 287 |
| 395 | 3300046519 | Ga0495632_0054912 | Ga0495632_0054912_133_1008 | 287 |
| 396 | 3300046519 | Ga0495632_0067709 | Ga0495632_0067709_624_1499 | 287 |
| 397 | 3300046519 | Ga0495632_0073817 | Ga0495632_0073817_338_1237 | 287 |
| 398 | 3300046519 | Ga0495632_0075300 | Ga0495632_0075300_591_1502 | 287 |
| 399 | 3300046520 | Ga0495637_0000181 | Ga0495637_0000181_26032_26907 | 287 |
| 400 | 3300046520 | Ga0495637_0000465 | Ga0495637_0000465_14323_15198 | 287 |
| 401 | 3300046520 | Ga0495637_0000590 | Ga0495637_0000590_2849_3724 | 287 |
| 402 | 3300046520 | Ga0495637_0001443 | Ga0495637_0001443_2183_3058 | 287 |
| 403 | 3300046520 | Ga0495637_0001971 | Ga0495637_0001971_7847_8722 | 287 |
| 404 | 3300046520 | Ga0495637_0002205 | Ga0495637_0002205_3589_4464 | 287 |
| 405 | 3300046520 | Ga0495637_0004032 | Ga0495637_0004032_1756_2715 | 287 |
| 406 | 3300046520 | Ga0495637_0006073 | Ga0495637_0006073_3531_4406 | 287 |
| 407 | 3300046520 | Ga0495637_0038036 | Ga0495637_0038036_265_1170 | 287 |
| 408 | 3300046520 | Ga0495637_0044395 | Ga0495637_0044395_830_1705 | 287 |
| 409 | 3300046520 | Ga0495637_0072503 | Ga0495637_0072503_148_1023 | 287 |
| 410 | 3300046520 | Ga0495637_0080572 | Ga0495637_0080572_253_1128 | 287 |
| 411 | 3300046522 | Ga0495643_0002208 | Ga0495643_0002208_7147_8022 | 287 |
| 412 | 3300046522 | Ga0495643_0006539 | Ga0495643_0006539_195_1070 | 287 |
| 413 | 3300046522 | Ga0495643_0008185 | Ga0495643_0008185_954_1829 | 287 |
| 414 | 3300046522 | Ga0495643_0008354 | Ga0495643_0008354_3574_4449 | 287 |
| 415 | 3300046522 | Ga0495643_0056022 | Ga0495643_0056022_556_1431 | 287 |
| 416 | 3300046523 | Ga0495644_0000783 | Ga0495644_0000783_4563_5438 | 287 |
| 417 | 3300046523 | Ga0495644_0005330 | Ga0495644_0005330_1784_2659 | 287 |
| 418 | 3300046524 | Ga0495648_0001614 | Ga0495648_0001614_14096_14971 | 287 |
| 419 | 3300046524 | Ga0495648_0001703 | Ga0495648_0001703_20001_20876 | 287 |
| 420 | 3300046524 | Ga0495648_0002271 | Ga0495648_0002271_6292_7167 | 287 |
| 421 | 3300046524 | Ga0495648_0002636 | Ga0495648_0002636_14237_15184 | 287 |
| 422 | 3300046524 | Ga0495648_0004515 | Ga0495648_0004515_5831_6706 | 287 |
| 423 | 3300046524 | Ga0495648_0004683 | Ga0495648_0004683_8877_9752 | 287 |
| 424 | 3300046524 | Ga0495648_0009594 | Ga0495648_0009594_2801_3676 | 287 |
| 425 | 3300046524 | Ga0495648_0010027 | Ga0495648_0010027_5346_6221 | 287 |
| 426 | 3300046526 | Ga0495666_0027101 | Ga0495666_0027101_1590_2552 | 287 |
| 427 | 3300046526 | Ga0495666_0167631 | Ga0495666_0167631_75_950 | 287 |
| 428 | 3300046530 | Ga0495654_0000111 | Ga0495654_0000111_78034_78981 | 287 |
| 429 | 3300046530 | Ga0495654_0000192 | Ga0495654_0000192_44379_45293 | 287 |
| 430 | 3300046530 | Ga0495654_0000478 | Ga0495654_0000478_15893_16798 | 287 |
| 431 | 3300046530 | Ga0495654_0001785 | Ga0495654_0001785_7558_8433 | 287 |
| 432 | 3300046530 | Ga0495654_0002127 | Ga0495654_0002127_11157_12032 | 287 |
| 433 | 3300046530 | Ga0495654_0007333 | Ga0495654_0007333_3023_3898 | 287 |
| 434 | 3300046530 | Ga0495654_0011790 | Ga0495654_0011790_3624_4499 | 287 |
| 435 | 3300046530 | Ga0495654_0027206 | Ga0495654_0027206_1972_2847 | 287 |
| 436 | 3300046530 | Ga0495654_0035686 | Ga0495654_0035686_533_1408 | 287 |
| 437 | 3300046530 | Ga0495654_0036637 | Ga0495654_0036637_956_1831 | 287 |
| 438 | 3300046530 | Ga0495654_0044214 | Ga0495654_0044214_400_1275 | 287 |
| 439 | 3300046530 | Ga0495654_0109104 | Ga0495654_0109104_15_890 | 287 |
| 440 | 3300046536 | Ga0495587_0001739 | Ga0495587_0001739_13529_14470 | 287 |
| 441 | 3300046536 | Ga0495587_0017000 | Ga0495587_0017000_1933_2895 | 287 |
| 442 | 3300046538 | Ga0495609_0000029 | Ga0495609_0000029_33301_34176 | 287 |
| 443 | 3300046538 | Ga0495609_0000035 | Ga0495609_0000035_136397_137272 | 287 |
| 444 | 3300046538 | Ga0495609_0000329 | Ga0495609_0000329_14189_15064 | 287 |
| 445 | 3300046538 | Ga0495609_0002051 | Ga0495609_0002051_59_934 | 287 |
| 446 | 3300046538 | Ga0495609_0005908 | Ga0495609_0005908_3362_4237 | 287 |
| 447 | 3300046538 | Ga0495609_0010480 | Ga0495609_0010480_62_937 | 287 |
| 448 | 3300046538 | Ga0495609_0026795 | Ga0495609_0026795_163_1038 | 287 |
| 449 | 3300046538 | Ga0495609_0041341 | Ga0495609_0041341_89_1036 | 287 |
| 450 | 3300046542 | Ga0495597_0001453 | Ga0495597_0001453_14257_15132 | 287 |
| 451 | 3300046542 | Ga0495597_0009066 | Ga0495597_0009066_1938_2813 | 287 |
| 452 | 3300046542 | Ga0495597_0011627 | Ga0495597_0011627_139_1014 | 287 |
| 453 | 3300046542 | Ga0495597_0013245 | Ga0495597_0013245_928_1803 | 287 |
| 454 | 3300046542 | Ga0495597_0029599 | Ga0495597_0029599_1453_2445 | 287 |
| 455 | 3300046542 | Ga0495597_0035257 | Ga0495597_0035257_1257_2132 | 287 |
| 456 | 3300046542 | Ga0495597_0050781 | Ga0495597_0050781_752_1627 | 287 |
| 457 | 3300046542 | Ga0495597_0079311 | Ga0495597_0079311_432_1307 | 287 |
| 458 | 3300046543 | Ga0495645_0066767 | Ga0495645_0066767_1458_2420 | 287 |
| 459 | 3300046557 | Ga0495622_0000911 | Ga0495622_0000911_1025_1900 | 287 |
| 460 | 3300046557 | Ga0495622_0012641 | Ga0495622_0012641_1381_2256 | 287 |
| 461 | 3300046557 | Ga0495622_0097134 | Ga0495622_0097134_184_1059 | 287 |
| 462 | 3300046558 | Ga0495633_0000016 | Ga0495633_0000016_180591_181466 | 287 |
| 463 | 3300046558 | Ga0495633_0002557 | Ga0495633_0002557_5162_6037 | 287 |
| 464 | 3300046558 | Ga0495633_0006318 | Ga0495633_0006318_6049_6924 | 287 |
| 465 | 3300046616 | Ga0495668_0001572 | Ga0495668_0001572_14385_15260 | 287 |
| 466 | 3300046616 | Ga0495668_0007142 | Ga0495668_0007142_6244_7119 | 287 |
| 467 | 3300046616 | Ga0495668_0035052 | Ga0495668_0035052_40_915 | 287 |
| 468 | 3300046616 | Ga0495668_0047839 | Ga0495668_0047839_446_1321 | 287 |
| 469 | 3300046616 | Ga0495668_0081718 | Ga0495668_0081718_26_901 | 287 |
| 470 | 3300046642 | Ga0495634_0001755 | Ga0495634_0001755_13640_14515 | 287 |
| 471 | 3300046642 | Ga0495634_0013585 | Ga0495634_0013585_2962_3924 | 287 |
| 472 | 3300046648 | Ga0495611_0000107 | Ga0495611_0000107_42900_43775 | 287 |
| 473 | 3300046648 | Ga0495611_0000904 | Ga0495611_0000904_879_1754 | 287 |
| 474 | 3300046648 | Ga0495611_0001132 | Ga0495611_0001132_11839_12714 | 287 |
| 475 | 3300046648 | Ga0495611_0152072 | Ga0495611_0152072_59_934 | 287 |
| 476 | 3300046660 | Ga0495625_0000004 | Ga0495625_0000004_147040_147915 | 287 |
| 477 | 3300046660 | Ga0495625_0001089 | Ga0495625_0001089_20111_21058 | 287 |
| 478 | 3300046660 | Ga0495625_0001350 | Ga0495625_0001350_8279_9154 | 287 |
| 479 | 3300046660 | Ga0495625_0010814 | Ga0495625_0010814_6445_7320 | 287 |
| 480 | 3300046660 | Ga0495625_0035582 | Ga0495625_0035582_73_948 | 287 |
| 481 | 3300046660 | Ga0495625_0171577 | Ga0495625_0171577_191_1066 | 287 |
| 482 | 3300046660 | Ga0495625_0213761 | Ga0495625_0213761_261_1136 | 287 |
| 483 | 3300046663 | Ga0495635_0000856 | Ga0495635_0000856_18887_19828 | 287 |
| 484 | 3300046665 | Ga0495661_0000004 | Ga0495661_0000004_189403_190278 | 287 |
| 485 | 3300046665 | Ga0495661_0000041 | Ga0495661_0000041_126832_127707 | 287 |
| 486 | 3300046665 | Ga0495661_0000288 | Ga0495661_0000288_37953_38858 | 287 |
| 487 | 3300046665 | Ga0495661_0000443 | Ga0495661_0000443_628_1533 | 287 |
| 488 | 3300046665 | Ga0495661_0007133 | Ga0495661_0007133_1481_2356 | 287 |
| 489 | 3300046665 | Ga0495661_0011031 | Ga0495661_0011031_3841_4716 | 287 |
| 490 | 3300046665 | Ga0495661_0011768 | Ga0495661_0011768_468_1373 | 287 |
| 491 | 3300046665 | Ga0495661_0098561 | Ga0495661_0098561_730_1605 | 287 |
| 492 | 3300046665 | Ga0495661_0157789 | Ga0495661_0157789_181_1056 | 287 |
| 493 | 3300046674 | Ga0495588_0003508 | Ga0495588_0003508_3141_4016 | 287 |
| 494 | 3300046679 | Ga0495623_0001646 | Ga0495623_0001646_3425_4300 | 287 |
| 495 | 3300046680 | Ga0495646_0003121 | Ga0495646_0003121_337_1212 | 287 |
| 496 | 3300046680 | Ga0495646_0046235 | Ga0495646_0046235_627_1589 | 287 |
| 497 | 3300046689 | Ga0495613_0016575 | Ga0495613_0016575_2490_3452 | 287 |
| 498 | 3300046689 | Ga0495613_0229319 | Ga0495613_0229319_327_1202 | 287 |
| 499 | 3300046690 | Ga0495624_0000637 | Ga0495624_0000637_12437_13399 | 287 |
| 500 | 3300046690 | Ga0495624_0031549 | Ga0495624_0031549_2204_3079 | 287 |
| 501 | 3300046691 | Ga0495670_0000105 | Ga0495670_0000105_22290_23165 | 287 |
| 502 | 3300046691 | Ga0495670_0004953 | Ga0495670_0004953_4409_5284 | 287 |
| 503 | 3300046691 | Ga0495670_0062655 | Ga0495670_0062655_195_1070 | 287 |
| 504 | 3300046692 | Ga0495671_0001925 | Ga0495671_0001925_11335_12282 | 287 |
| 505 | 3300046692 | Ga0495671_0002727 | Ga0495671_0002727_6670_7545 | 287 |
| 506 | 3300046692 | Ga0495671_0003072 | Ga0495671_0003072_8098_9009 | 287 |
| 507 | 3300046692 | Ga0495671_0003848 | Ga0495671_0003848_6522_7397 | 287 |
| 508 | 3300046692 | Ga0495671_0005396 | Ga0495671_0005396_3709_4584 | 287 |
| 509 | 3300046692 | Ga0495671_0016959 | Ga0495671_0016959_1001_1876 | 287 |
| 510 | 3300046692 | Ga0495671_0023908 | Ga0495671_0023908_530_1405 | 287 |
| 511 | 3300046692 | Ga0495671_0070792 | Ga0495671_0070792_214_1089 | 287 |
| 512 | 3300046694 | Ga0495649_0002385 | Ga0495649_0002385_8045_8992 | 287 |
| 513 | 3300046694 | Ga0495649_0003729 | Ga0495649_0003729_2858_3733 | 287 |
| 514 | 3300046694 | Ga0495649_0005030 | Ga0495649_0005030_2223_3098 | 287 |
| 515 | 3300046694 | Ga0495649_0024414 | Ga0495649_0024414_2279_3154 | 287 |
| 516 | 3300046694 | Ga0495649_0031427 | Ga0495649_0031427_1619_2494 | 287 |
| 517 | 3300046694 | Ga0495649_0032146 | Ga0495649_0032146_213_1088 | 287 |
| 518 | 3300046694 | Ga0495649_0058343 | Ga0495649_0058343_1102_1977 | 287 |
| 519 | 3300046694 | Ga0495649_0060925 | Ga0495649_0060925_682_1557 | 287 |
| 520 | 3300046794 | Ga0495589_0000278 | Ga0495589_0000278_14213_15088 | 287 |
| 521 | 3300046794 | Ga0495589_0007278 | Ga0495589_0007278_1725_2600 | 287 |
| 522 | 3300046794 | Ga0495589_0009224 | Ga0495589_0009224_3356_4231 | 287 |
| 523 | 3300046794 | Ga0495589_0017355 | Ga0495589_0017355_2153_3028 | 287 |
| 524 | 3300046809 | Ga0495600_0023735 | Ga0495600_0023735_1757_2719 | 287 |
| 525 | 3300046810 | Ga0495660_0000998 | Ga0495660_0000998_13192_14067 | 287 |
| 526 | 3300046810 | Ga0495660_0001470 | Ga0495660_0001470_13949_14896 | 287 |
| 527 | 3300046810 | Ga0495660_0001702 | Ga0495660_0001702_6512_7387 | 287 |
| 528 | 3300046810 | Ga0495660_0002168 | Ga0495660_0002168_5895_6770 | 287 |
| 529 | 3300046810 | Ga0495660_0002263 | Ga0495660_0002263_7834_8718 | 287 |
| 530 | 3300046810 | Ga0495660_0007379 | Ga0495660_0007379_2451_3326 | 287 |
| 531 | 3300046810 | Ga0495660_0007452 | Ga0495660_0007452_4613_5488 | 287 |
| 532 | 3300046810 | Ga0495660_0010816 | Ga0495660_0010816_3242_4117 | 287 |
| 533 | 3300046810 | Ga0495660_0013777 | Ga0495660_0013777_10_885 | 287 |
| 534 | 3300046810 | Ga0495660_0044274 | Ga0495660_0044274_446_1321 | 287 |
| 535 | 3300046810 | Ga0495660_0058751 | Ga0495660_0058751_200_1075 | 287 |
| 536 | 3300047317 | Ga0495604_0098533 | Ga0495604_0098533_910_1872 | 287 |
| 537 | 3300047319 | Ga0495674_0024635 | Ga0495674_0024635_1612_2487 | 287 |
| 538 | 3300047320 | Ga0495672_0000672 | Ga0495672_0000672_22946_23908 | 287 |
| 539 | 3300047320 | Ga0495672_0002204 | Ga0495672_0002204_11656_12570 | 287 |
| 540 | 3300047320 | Ga0495672_0003725 | Ga0495672_0003725_4410_5285 | 287 |
| 541 | 3300047320 | Ga0495672_0013260 | Ga0495672_0013260_3296_4171 | 287 |
| 542 | 3300047320 | Ga0495672_0044424 | Ga0495672_0044424_529_1404 | 287 |
| 543 | 3300047320 | Ga0495672_0064285 | Ga0495672_0064285_304_1179 | 287 |
| 544 | 3300047320 | Ga0495672_0145022 | Ga0495672_0145022_250_1125 | 287 |
| 545 | 3300047321 | Ga0495676_0000023 | Ga0495676_0000023_9212_10087 | 287 |
| 546 | 3300047321 | Ga0495676_0000286 | Ga0495676_0000286_25807_26682 | 287 |
| 547 | 3300047321 | Ga0495676_0008721 | Ga0495676_0008721_1963_2925 | 287 |
| 548 | 3300047322 | Ga0495680_0020625 | Ga0495680_0020625_1234_2196 | 287 |
| 549 | 3300047322 | Ga0495680_0033183 | Ga0495680_0033183_1784_2659 | 287 |
| 550 | 3300047323 | Ga0495683_0000074 | Ga0495683_0000074_30818_31693 | 287 |
| 551 | 3300047323 | Ga0495683_0000270 | Ga0495683_0000270_38111_38986 | 287 |
| 552 | 3300047323 | Ga0495683_0004249 | Ga0495683_0004249_6210_7085 | 287 |
| 553 | 3300047323 | Ga0495683_0006486 | Ga0495683_0006486_5397_6344 | 287 |
| 554 | 3300047323 | Ga0495683_0082963 | Ga0495683_0082963_628_1503 | 287 |
| 555 | 3300047444 | Ga0495675_0044149 | Ga0495675_0044149_1238_2179 | 287 |
| 556 | 3300047444 | Ga0495675_0048647 | Ga0495675_0048647_1495_2457 | 287 |
| 557 | 3300047446 | Ga0495679_000127 | Ga0495679_000127_49907_50782 | 287 |
| 558 | 3300047446 | Ga0495679_000256 | Ga0495679_000256_22920_23795 | 287 |
| 559 | 3300047446 | Ga0495679_000689 | Ga0495679_000689_7420_8367 | 287 |
| 560 | 3300047446 | Ga0495679_001938 | Ga0495679_001938_5297_6172 | 287 |
| 561 | 3300047446 | Ga0495679_003360 | Ga0495679_003360_4991_5866 | 287 |
| 562 | 3300047446 | Ga0495679_021316 | Ga0495679_021316_894_1769 | 287 |
| 563 | 3300047446 | Ga0495679_024054 | Ga0495679_024054_117_992 | 287 |
| 564 | 3300047446 | Ga0495679_035967 | Ga0495679_035967_156_1031 | 287 |
| 565 | 3300047469 | Ga0495673_0000297 | Ga0495673_0000297_48418_49293 | 287 |
| 566 | 3300047469 | Ga0495673_0000525 | Ga0495673_0000525_19136_20095 | 287 |
| 567 | 3300047469 | Ga0495673_0000537 | Ga0495673_0000537_24262_25209 | 287 |
| 568 | 3300047469 | Ga0495673_0001706 | Ga0495673_0001706_12888_13763 | 287 |
| 569 | 3300047469 | Ga0495673_0002220 | Ga0495673_0002220_392_1267 | 287 |
| 570 | 3300047469 | Ga0495673_0002230 | Ga0495673_0002230_9529_10404 | 287 |
| 571 | 3300047469 | Ga0495673_0005283 | Ga0495673_0005283_2577_3452 | 287 |
| 572 | 3300047469 | Ga0495673_0008780 | Ga0495673_0008780_3173_4078 | 287 |
| 573 | 3300047469 | Ga0495673_0021649 | Ga0495673_0021649_1369_2244 | 287 |
| 574 | 3300047469 | Ga0495673_0038788 | Ga0495673_0038788_867_1742 | 287 |
| 575 | 3300047469 | Ga0495673_0040226 | Ga0495673_0040226_1042_1917 | 287 |
| 576 | 3300047469 | Ga0495673_0112697 | Ga0495673_0112697_16_891 | 287 |
| 577 | 3300047470 | Ga0495681_0000448 | Ga0495681_0000448_19141_20016 | 287 |
| 578 | 3300047470 | Ga0495681_0000997 | Ga0495681_0000997_14355_15230 | 287 |
| 579 | 3300047470 | Ga0495681_0002274 | Ga0495681_0002274_9733_10608 | 287 |
| 580 | 3300047470 | Ga0495681_0002776 | Ga0495681_0002776_6531_7406 | 287 |
| 581 | 3300047470 | Ga0495681_0020296 | Ga0495681_0020296_612_1487 | 287 |
| 582 | 3300047471 | Ga0495684_0012161 | Ga0495684_0012161_4026_4988 | 287 |
| 583 | 3300047472 | Ga0495686_0001277 | Ga0495686_0001277_5210_6085 | 287 |
| 584 | 3300047472 | Ga0495686_0005723 | Ga0495686_0005723_5621_6496 | 287 |
| 585 | 3300047472 | Ga0495686_0014979 | Ga0495686_0014979_3302_4177 | 287 |
| 586 | 3300047472 | Ga0495686_0021387 | Ga0495686_0021387_2170_3045 | 287 |
| 587 | 3300047673 | Ga0495593_0014260 | Ga0495593_0014260_1450_2412 | 287 |
| 588 | 3300048088 | Ga0495602_0001722 | Ga0495602_0001722_2401_3363 | 287 |
| 589 | 3300048091 | Ga0495626_0000213 | Ga0495626_0000213_43905_44780 | 287 |
| 590 | 3300048091 | Ga0495626_0000679 | Ga0495626_0000679_13997_14944 | 287 |
| 591 | 3300048091 | Ga0495626_0001952 | Ga0495626_0001952_200_1075 | 287 |
| 592 | 3300048091 | Ga0495626_0003061 | Ga0495626_0003061_7499_8374 | 287 |
| 593 | 3300048091 | Ga0495626_0005451 | Ga0495626_0005451_6391_7266 | 287 |
| 594 | 3300048091 | Ga0495626_0035602 | Ga0495626_0035602_1286_2161 | 287 |
| 595 | 3300048091 | Ga0495626_0043695 | Ga0495626_0043695_1058_1933 | 287 |
| 596 | 3300048905 | Ga0496102_0000250 | Ga0496102_0000250_13613_14554 | 287 |
| 597 | 3300048905 | Ga0496102_0097756 | Ga0496102_0097756_1272_2231 | 287 |
| 598 | 3300048905 | Ga0496102_0257696 | Ga0496102_0257696_685_1590 | 287 |
| 599 | 3300048906 | Ga0496103_0005141 | Ga0496103_0005141_5362_6303 | 287 |
| 600 | 3300048913 | Ga0496110_0351768 | Ga0496110_0351768_289_1164 | 287 |
| 601 | 3300048918 | Ga0496115_0018650 | Ga0496115_0018650_2878_3753 | 287 |
| 602 | 3300048919 | Ga0496116_0000869 | Ga0496116_0000869_14234_15109 | 287 |
| 603 | 3300048919 | Ga0496116_0007720 | Ga0496116_0007720_6509_7384 | 287 |
| 604 | 3300048919 | Ga0496116_0033974 | Ga0496116_0033974_736_1695 | 287 |
| 605 | 3300048920 | Ga0496117_0003912 | Ga0496117_0003912_2717_3622 | 287 |
| 606 | 3300048920 | Ga0496117_0019755 | Ga0496117_0019755_4495_5436 | 287 |
| 607 | 3300048920 | Ga0496117_0031230 | Ga0496117_0031230_2909_3784 | 287 |
| 608 | 3300048920 | Ga0496117_0034545 | Ga0496117_0034545_1763_2638 | 287 |
| 609 | 3300048921 | Ga0496118_0030089 | Ga0496118_0030089_115_1056 | 287 |
| 610 | 3300048921 | Ga0496118_0037003 | Ga0496118_0037003_1562_2437 | 287 |
| 611 | 3300048921 | Ga0496118_0043591 | Ga0496118_0043591_312_1187 | 287 |
| 612 | 3300048921 | Ga0496118_0056868 | Ga0496118_0056868_1377_2252 | 287 |
| 613 | 3300048921 | Ga0496118_0069452 | Ga0496118_0069452_59_1018 | 287 |
| 614 | 3300048921 | Ga0496118_0072593 | Ga0496118_0072593_1389_2264 | 287 |
| 615 | 3300048922 | Ga0496119_0032479 | Ga0496119_0032479_1095_1970 | 287 |
| 616 | 3300048922 | Ga0496119_0073694 | Ga0496119_0073694_582_1457 | 287 |
| 617 | 3300048923 | Ga0496120_0024888 | Ga0496120_0024888_1248_2123 | 287 |
| 618 | 3300048923 | Ga0496120_0066605 | Ga0496120_0066605_583_1458 | 287 |
| 619 | 3300048924 | Ga0496121_0001304 | Ga0496121_0001304_34068_34943 | 287 |
| 620 | 3300048924 | Ga0496121_0003384 | Ga0496121_0003384_1890_2765 | 287 |
| 621 | 3300048924 | Ga0496121_0013817 | Ga0496121_0013817_4287_5162 | 287 |
| 622 | 3300048924 | Ga0496121_0077266 | Ga0496121_0077266_487_1362 | 287 |
| 623 | 3300048924 | Ga0496121_0233319 | Ga0496121_0233319_92_1033 | 287 |
| 624 | 3300048925 | Ga0496122_0011943 | Ga0496122_0011943_82_957 | 287 |
| 625 | 3300048925 | Ga0496122_0039296 | Ga0496122_0039296_1299_2174 | 287 |
| 626 | 3300048925 | Ga0496122_0101003 | Ga0496122_0101003_1029_1904 | 287 |
| 627 | 3300048926 | Ga0496123_0000379 | Ga0496123_0000379_7760_8635 | 287 |
| 628 | 3300048926 | Ga0496123_0005708 | Ga0496123_0005708_5045_5920 | 287 |
| 629 | 3300048926 | Ga0496123_0041025 | Ga0496123_0041025_385_1260 | 287 |
| 630 | 3300048927 | Ga0496124_0002234 | Ga0496124_0002234_21533_22408 | 287 |
| 631 | 3300048927 | Ga0496124_0004218 | Ga0496124_0004218_2762_3637 | 287 |
| 632 | 3300048927 | Ga0496124_0004969 | Ga0496124_0004969_9853_10728 | 287 |
| 633 | 3300048927 | Ga0496124_0035873 | Ga0496124_0035873_727_1602 | 287 |
| 634 | 3300048927 | Ga0496124_0128894 | Ga0496124_0128894_552_1427 | 287 |
| 635 | 3300048928 | Ga0496125_0003931 | Ga0496125_0003931_13739_14644 | 287 |
| 636 | 3300048928 | Ga0496125_0010647 | Ga0496125_0010647_6380_7255 | 287 |
| 637 | 3300048928 | Ga0496125_0062983 | Ga0496125_0062983_1124_1999 | 287 |
| 638 | 3300049459 | Ga0495678_000036 | Ga0495678_000036_5875_6750 | 287 |
| 639 | 3300049459 | Ga0495678_000120 | Ga0495678_000120_39643_40518 | 287 |
| 640 | 3300049459 | Ga0495678_000309 | Ga0495678_000309_42837_43712 | 287 |
| 641 | 3300049459 | Ga0495678_000573 | Ga0495678_000573_13997_14944 | 287 |
| 642 | 3300049459 | Ga0495678_002641 | Ga0495678_002641_4866_5741 | 287 |
| 643 | 3300049459 | Ga0495678_002991 | Ga0495678_002991_6240_7115 | 287 |
| 644 | 3300049459 | Ga0495678_005410 | Ga0495678_005410_5390_6274 | 287 |
| 645 | 3300049459 | Ga0495678_009248 | Ga0495678_009248_1114_1989 | 287 |
| 646 | 3300049459 | Ga0495678_009335 | Ga0495678_009335_2612_3487 | 287 |
| 647 | 3300049459 | Ga0495678_022399 | Ga0495678_022399_35_910 | 287 |
| 648 | 3300049460 | Ga0495682_0001294 | Ga0495682_0001294_5075_5950 | 287 |
| 649 | 3300049460 | Ga0495682_0002319 | Ga0495682_0002319_4788_5693 | 287 |
| 650 | 3300049460 | Ga0495682_0003273 | Ga0495682_0003273_266_1141 | 287 |
| 651 | 3300049460 | Ga0495682_0035617 | Ga0495682_0035617_30_905 | 287 |
| 652 | 3300049758 | Ga0501241_000265 | Ga0501241_000265_6555_7430 | 287 |
| 653 | 3300049766 | Ga0501269_003058 | Ga0501269_003058_986_1861 | 287 |
| 654 | 3300053111 | Ga0500572_001586 | Ga0500572_001586_3443_4318 | 287 |
| 655 | 3300053126 | Ga0500621_007988 | Ga0500621_007988_741_1616 | 287 |
| 656 | 3300053161 | Ga0500634_0010006 | Ga0500634_0010006_1327_2202 | 287 |
| 657 | iso_pu_bacteria | 2885266251 | 2885270052 | 287 |
| 658 | 3300005328 | Ga0070676_10275990 | Ga0070676_102759901 | 288 |
| 659 | 3300005356 | Ga0070674_100095734 | Ga0070674_1000957344 | 288 |
| 660 | 3300005459 | Ga0068867_100049492 | Ga0068867_1000494922 | 288 |
| 661 | 3300005539 | Ga0068853_100404867 | Ga0068853_1004048672 | 288 |
| 662 | 3300005543 | Ga0070672_100078917 | Ga0070672_1000789172 | 288 |
| 663 | 3300005548 | Ga0070665_100345641 | Ga0070665_1003456412 | 288 |
| 664 | 3300005616 | Ga0068852_100304461 | Ga0068852_1003044612 | 288 |
| 665 | 3300005834 | Ga0068851_10040259 | Ga0068851_100402594 | 288 |
| 666 | 3300009011 | Ga0105251_10000032 | Ga0105251_100000322 | 288 |
| 667 | 3300009011 | Ga0105251_10015827 | Ga0105251_100158271 | 288 |
| 668 | 3300009092 | Ga0105250_10000241 | Ga0105250_1000024146 | 288 |
| 669 | 3300013102 | Ga0157371_10000115 | Ga0157371_1000011581 | 288 |
| 670 | 3300025711 | Ga0207696_1000363 | Ga0207696_100036346 | 288 |
| 671 | 3300025735 | Ga0207713_1000020 | Ga0207713_1000020223 | 288 |
| 672 | 3300025735 | Ga0207713_1061162 | Ga0207713_10611621 | 288 |
| 673 | 3300025986 | Ga0207658_10264705 | Ga0207658_102647052 | 288 |
| 674 | 3300027312 | Ga0209371_1001498 | Ga0209371_10014982 | 288 |
| 675 | 3300030500 | Ga0268256_1003139 | Ga0268256_10031392 | 288 |
| 676 | 3300031548 | Ga0307408_100000074 | Ga0307408_10000007424 | 288 |
| 677 | 3300031901 | Ga0307406_10157227 | Ga0307406_101572271 | 288 |
| 678 | 3300031903 | Ga0307407_10154153 | Ga0307407_101541532 | 288 |
| 679 | 3300031911 | Ga0307412_10000459 | Ga0307412_1000045918 | 288 |
| 680 | 3300031911 | Ga0307412_10000594 | Ga0307412_1000059415 | 288 |
| 681 | 3300032004 | Ga0307414_10012907 | Ga0307414_100129074 | 288 |
| 682 | 3300032004 | Ga0307414_10167632 | Ga0307414_101676322 | 288 |
| 683 | 3300032005 | Ga0307411_10032567 | Ga0307411_100325672 | 288 |
| 684 | 3300041405 | Ga0439438_000190 | Ga0439438_000190_8550_9446 | 288 |
| 685 | 3300042006 | Ga0439432_000450 | Ga0439432_000450_8777_9673 | 288 |
| 686 | 3300042013 | Ga0439456_009091 | Ga0439456_009091_921_1805 | 288 |
| 687 | 3300046460 | Ga0495638_0008864 | Ga0495638_0008864_1332_2270 | 288 |
| 688 | 3300046474 | Ga0495605_0000006 | Ga0495605_0000006_290747_291625 | 288 |
| 689 | 3300046474 | Ga0495605_0019405 | Ga0495605_0019405_1283_2167 | 288 |
| 690 | 3300046474 | Ga0495605_0021867 | Ga0495605_0021867_981_1976 | 288 |
| 691 | 3300046501 | Ga0495607_0013606 | Ga0495607_0013606_2382_3290 | 288 |
| 692 | 3300046501 | Ga0495607_0044697 | Ga0495607_0044697_866_1744 | 288 |
| 693 | 3300046506 | Ga0495583_0001142 | Ga0495583_0001142_14432_15310 | 288 |
| 694 | 3300046515 | Ga0495620_0001339 | Ga0495620_0001339_1101_2054 | 288 |
| 695 | 3300046529 | Ga0495652_0400853 | Ga0495652_0400853_75_959 | 288 |
| 696 | 3300046538 | Ga0495609_0000034 | Ga0495609_0000034_139891_140769 | 288 |
| 697 | 3300046810 | Ga0495660_0008421 | Ga0495660_0008421_1502_2386 | 288 |
| 698 | 3300047469 | Ga0495673_0048287 | Ga0495673_0048287_911_1789 | 288 |
| 699 | 3300048920 | Ga0496117_0007554 | Ga0496117_0007554_3274_4158 | 288 |
| 700 | 3300048921 | Ga0496118_0010389 | Ga0496118_0010389_6310_7194 | 288 |
| 701 | 3300048927 | Ga0496124_0000035 | Ga0496124_0000035_211735_212619 | 288 |
| 702 | 3300048927 | Ga0496124_0118783 | Ga0496124_0118783_803_1687 | 288 |
| 703 | 3300048928 | Ga0496125_0010597 | Ga0496125_0010597_5511_6395 | 288 |
| 704 | 3300049592 | Ga0501076_0304117 | Ga0501076_0304117_224_1117 | 288 |
| 705 | 3300049662 | Ga0501222_000941 | Ga0501222_000941_1176_2072 | 288 |
| 706 | 3300049665 | Ga0501227_001106 | Ga0501227_001106_1745_2740 | 288 |
| 707 | 3300053142 | Ga0500577_0015242 | Ga0500577_0015242_1014_1892 | 288 |
| 708 | iso_pu_bacteria | 2511231003 | 2511248439 | 288 |
| 709 | iso_pu_bacteria | 2884811622 | 2884816095 | 288 |
| 710 | iso_pu_bacteria | 2884836552 | 2884839426 | 288 |
| 711 | iso_pu_bacteria | 2884852848 | 2884856764 | 288 |
| 712 | iso_pu_bacteria | 2896154374 | 2896158110 | 288 |
| 713 | 3300006038 | Ga0075365_10027755 | Ga0075365_100277552 | 289 |
| 714 | 3300006042 | Ga0075368_10002741 | Ga0075368_100027413 | 289 |
| 715 | 3300006048 | Ga0075363_100003970 | Ga0075363_1000039709 | 289 |
| 716 | 3300006051 | Ga0075364_10019688 | Ga0075364_100196882 | 289 |
| 717 | 3300006177 | Ga0075362_10006218 | Ga0075362_100062182 | 289 |
| 718 | 3300006178 | Ga0075367_10004049 | Ga0075367_100040492 | 289 |
| 719 | 3300006186 | Ga0075369_10008317 | Ga0075369_100083172 | 289 |
| 720 | 3300006195 | Ga0075366_10008293 | Ga0075366_100082932 | 289 |
| 721 | 3300006353 | Ga0075370_10044048 | Ga0075370_100440482 | 289 |
| 722 | 3300026041 | Ga0207639_10064389 | Ga0207639_100643892 | 289 |
| 723 | 3300046471 | Ga0495650_0046200 | Ga0495650_0046200_938_1813 | 289 |
| 724 | 3300050489 | nmdc:mga03683_7748_c1 | nmdc:mga03683_7748_c1_2550_3431 | 289 |
| 725 | 3300050490 | nmdc:mga03n38_10641_c1 | nmdc:mga03n38_10641_c1_1030_1911 | 289 |
| 726 | 3300050491 | nmdc:mga00v17_75291_c1 | nmdc:mga00v17_75291_c1_906_1787 | 289 |
| 727 | 3300050492 | nmdc:mga0yw44_34475_c1 | nmdc:mga0yw44_34475_c1_1104_1985 | 289 |
| 728 | 3300050493 | nmdc:mga0k408_5928_c1 | nmdc:mga0k408_5928_c1_1569_2450 | 289 |
| 729 | 3300050494 | nmdc:mga06z11_7119_c1 | nmdc:mga06z11_7119_c1_2142_3023 | 289 |
| 730 | 3300050496 | nmdc:mga07m45_23895_c1 | nmdc:mga07m45_23895_c1_1233_2114 | 289 |
| 731 | 3300050516 | nmdc:mga0sz30_20244_c1 | nmdc:mga0sz30_20244_c1_270_1151 | 289 |
| 732 | 3300053090 | Ga0500646_0000782 | Ga0500646_0000782_7281_8162 | 289 |
| 733 | 3300002771 | JGI25163J39215_1000003 | JGI25163J39215_1000003101 | 290 |
| 734 | 3300002772 | JGI25164J39214_1000041 | JGI25164J39214_1000041101 | 290 |
| 735 | 3300003187 | JGI25151J46595_10001449 | JGI25151J46595_1000144917 | 290 |
| 736 | 3300003751 | Ga0055538_1000003 | Ga0055538_1000003519 | 290 |
| 737 | 3300003752 | Ga0055539_1000003 | Ga0055539_1000003101 | 290 |
| 738 | 3300003756 | Ga0055533_1000005 | Ga0055533_1000005101 | 290 |
| 739 | 3300003759 | Ga0055525_1000005 | Ga0055525_1000005519 | 290 |
| 740 | 3300003771 | Ga0055526_1000917 | Ga0055526_10009172 | 290 |
| 741 | 3300003771 | Ga0055526_1002371 | Ga0055526_100237112 | 290 |
| 742 | 3300003771 | Ga0055526_1008492 | Ga0055526_10084923 | 290 |
| 743 | 3300003771 | Ga0055526_1011889 | Ga0055526_10118893 | 290 |
| 744 | 3300003771 | Ga0055526_1013063 | Ga0055526_10130633 | 290 |
| 745 | 3300003775 | Ga0055524_1000557 | Ga0055524_10005575 | 290 |
| 746 | 3300003775 | Ga0055524_1012040 | Ga0055524_10120403 | 290 |
| 747 | 3300003781 | Ga0055536_1000031 | Ga0055536_100003192 | 290 |
| 748 | 3300003784 | Ga0055534_1001179 | Ga0055534_10011796 | 290 |
| 749 | 3300003841 | Ga0055541_1000003 | Ga0055541_1000003519 | 290 |
| 750 | 3300006948 | Ga0099826_10000007 | Ga0099826_10000007236 | 290 |
| 751 | 3300009036 | Ga0105244_10000190 | Ga0105244_1000019024 | 290 |
| 752 | 3300009092 | Ga0105250_10000265 | Ga0105250_1000026516 | 290 |
| 753 | 3300025207 | Ga0209760_100002 | Ga0209760_100002193 | 290 |
| 754 | 3300025224 | Ga0209784_100001 | Ga0209784_1000012860 | 290 |
| 755 | 3300025225 | Ga0209566_100001 | Ga0209566_1000012860 | 290 |
| 756 | 3300025226 | Ga0209674_100002 | Ga0209674_1000022860 | 290 |
| 757 | 3300025230 | Ga0209563_100002 | Ga0209563_1000021395 | 290 |
| 758 | 3300025231 | Ga0207427_100009 | Ga0207427_100009513 | 290 |
| 759 | 3300025233 | Ga0209437_100001 | Ga0209437_1000011395 | 290 |
| 760 | 3300025253 | Ga0209677_100002 | Ga0209677_1000021395 | 290 |
| 761 | 3300025263 | Ga0209565_1000374 | Ga0209565_100037411 | 290 |
| 762 | 3300025273 | Ga0209673_1009477 | Ga0209673_10094773 | 290 |
| 763 | 3300025291 | Ga0209675_1000231 | Ga0209675_100023117 | 290 |
| 764 | 3300025291 | Ga0209675_1003651 | Ga0209675_10036513 | 290 |
| 765 | 3300025291 | Ga0209675_1004819 | Ga0209675_10048193 | 290 |
| 766 | 3300025292 | Ga0209676_1000036 | Ga0209676_1000036319 | 290 |
| 767 | 3300025294 | Ga0209025_1000345 | Ga0209025_100034538 | 290 |
| 768 | 3300025294 | Ga0209025_1001077 | Ga0209025_100107717 | 290 |
| 769 | 3300025294 | Ga0209025_1001122 | Ga0209025_10011229 | 290 |
| 770 | 3300025294 | Ga0209025_1031182 | Ga0209025_10311823 | 290 |
| 771 | 3300025295 | Ga0209564_1000878 | Ga0209564_100087812 | 290 |
| 772 | 3300025295 | Ga0209564_1001207 | Ga0209564_100120712 | 290 |
| 773 | 3300025295 | Ga0209564_1001260 | Ga0209564_10012605 | 290 |
| 774 | 3300025299 | Ga0209256_1000244 | Ga0209256_100024432 | 290 |
| 775 | 3300025299 | Ga0209256_1000846 | Ga0209256_100084611 | 290 |
| 776 | 3300025303 | Ga0209051_1035482 | Ga0209051_10354822 | 290 |
| 777 | 3300025711 | Ga0207696_1000169 | Ga0207696_100016974 | 290 |
| 778 | 3300025728 | Ga0207655_1003813 | Ga0207655_10038138 | 290 |
| 779 | 3300027666 | Ga0209282_1000021 | Ga0209282_1000021138 | 290 |
| 780 | 3300037471 | Ga0395905_0009894 | Ga0395905_0009894_6302_7204 | 290 |
| 781 | 3300041452 | Ga0451793_0439505 | Ga0451793_0439505_840_1778 | 290 |
| 782 | 3300041496 | Ga0451839_0364642 | Ga0451839_0364642_910_1848 | 290 |
| 783 | 3300041498 | Ga0451841_0330586 | Ga0451841_0330586_46_984 | 290 |
| 784 | 3300042013 | Ga0439456_008369 | Ga0439456_008369_1070_1945 | 290 |
| 785 | 3300046458 | Ga0495591_053093 | Ga0495591_053093_87_965 | 290 |
| 786 | 3300046471 | Ga0495650_0000018 | Ga0495650_0000018_229421_230296 | 290 |
| 787 | 3300046474 | Ga0495605_0001518 | Ga0495605_0001518_9636_10514 | 290 |
| 788 | 3300046491 | Ga0495584_0218813 | Ga0495584_0218813_28_906 | 290 |
| 789 | 3300046500 | Ga0495596_0000385 | Ga0495596_0000385_25380_26258 | 290 |
| 790 | 3300046501 | Ga0495607_0012388 | Ga0495607_0012388_3576_4454 | 290 |
| 791 | 3300046512 | Ga0495610_0002584 | Ga0495610_0002584_4601_5479 | 290 |
| 792 | 3300046513 | Ga0495616_0004346 | Ga0495616_0004346_4606_5484 | 290 |
| 793 | 3300046524 | Ga0495648_0011326 | Ga0495648_0011326_3755_4633 | 290 |
| 794 | 3300046528 | Ga0495642_0052170 | Ga0495642_0052170_570_1448 | 290 |
| 795 | 3300046538 | Ga0495609_0001540 | Ga0495609_0001540_9715_10593 | 290 |
| 796 | 3300046542 | Ga0495597_0025233 | Ga0495597_0025233_1190_2068 | 290 |
| 797 | 3300046665 | Ga0495661_0010296 | Ga0495661_0010296_1921_2799 | 290 |
| 798 | 3300046692 | Ga0495671_0029342 | Ga0495671_0029342_73_951 | 290 |
| 799 | 3300046694 | Ga0495649_0012142 | Ga0495649_0012142_1115_1993 | 290 |
| 800 | 3300046810 | Ga0495660_0000004 | Ga0495660_0000004_465271_466146 | 290 |
| 801 | 3300047320 | Ga0495672_0018945 | Ga0495672_0018945_1942_2820 | 290 |
| 802 | 3300048907 | Ga0496104_0001712 | Ga0496104_0001712_7037_7912 | 290 |
| 803 | 3300048907 | Ga0496104_0488667 | Ga0496104_0488667_25_936 | 290 |
| 804 | 3300048919 | Ga0496116_0000083 | Ga0496116_0000083_61343_62218 | 290 |
| 805 | 3300048919 | Ga0496116_0007579 | Ga0496116_0007579_1630_2508 | 290 |
| 806 | 3300048920 | Ga0496117_0014278 | Ga0496117_0014278_3696_4571 | 290 |
| 807 | 3300048922 | Ga0496119_0009151 | Ga0496119_0009151_7505_8380 | 290 |
| 808 | 3300048924 | Ga0496121_0010014 | Ga0496121_0010014_3411_4289 | 290 |
| 809 | 3300048925 | Ga0496122_0000135 | Ga0496122_0000135_96803_97678 | 290 |
| 810 | 3300048925 | Ga0496122_0007158 | Ga0496122_0007158_4603_5481 | 290 |
| 811 | 3300048926 | Ga0496123_0000004 | Ga0496123_0000004_96711_97586 | 290 |
| 812 | 3300048926 | Ga0496123_0005659 | Ga0496123_0005659_9798_10676 | 290 |
| 813 | 3300048927 | Ga0496124_0000140 | Ga0496124_0000140_115882_116757 | 290 |
| 814 | 3300048928 | Ga0496125_0000131 | Ga0496125_0000131_100389_101264 | 290 |
| 815 | 3300048929 | Ga0496126_0000300 | Ga0496126_0000300_16366_17241 | 290 |
| 816 | 3300013104 | Ga0157370_10001398 | Ga0157370_1000139813 | 291 |
| 817 | 3300025728 | Ga0207655_1000283 | Ga0207655_100028364 | 291 |
| 818 | 3300002704 | JGI25155J39150_1000456 | JGI25155J39150_10004563 | 292 |
| 819 | 3300002705 | JGI25156J39149_1004331 | JGI25156J39149_10043313 | 292 |
| 820 | 3300002738 | JGI25154J39366_1000291 | JGI25154J39366_100029123 | 292 |
| 821 | 3300005843 | Ga0068860_100139990 | Ga0068860_1001399902 | 292 |
| 822 | 3300006237 | Ga0097621_100006028 | Ga0097621_10000602810 | 292 |
| 823 | 3300009011 | Ga0105251_10088032 | Ga0105251_100880321 | 292 |
| 824 | 3300009093 | Ga0105240_10000250 | Ga0105240_1000025077 | 292 |
| 825 | 3300009177 | Ga0105248_10082872 | Ga0105248_100828724 | 292 |
| 826 | 3300009545 | Ga0105237_10787463 | Ga0105237_107874631 | 292 |
| 827 | 3300009551 | Ga0105238_10410435 | Ga0105238_104104352 | 292 |
| 828 | 3300010375 | Ga0105239_10133659 | Ga0105239_101336594 | 292 |
| 829 | 3300013105 | Ga0157369_10222437 | Ga0157369_102224372 | 292 |
| 830 | 3300013306 | Ga0163162_10028461 | Ga0163162_100284612 | 292 |
| 831 | 3300013308 | Ga0157375_10246777 | Ga0157375_102467772 | 292 |
| 832 | 3300014325 | Ga0163163_10024518 | Ga0163163_100245184 | 292 |
| 833 | 3300015261 | Ga0182006_1024149 | Ga0182006_10241494 | 292 |
| 834 | 3300025206 | Ga0209435_100067 | Ga0209435_1000679 | 292 |
| 835 | 3300025233 | Ga0209437_100272 | Ga0209437_10027232 | 292 |
| 836 | 3300025246 | Ga0209646_1000061 | Ga0209646_100006143 | 292 |
| 837 | 3300025250 | Ga0209026_1003054 | Ga0209026_10030544 | 292 |
| 838 | 3300025256 | Ga0209759_1000209 | Ga0209759_100020942 | 292 |
| 839 | 3300025735 | Ga0207713_1075603 | Ga0207713_10756032 | 292 |
| 840 | 3300025903 | Ga0207680_10011842 | Ga0207680_100118425 | 292 |
| 841 | 3300025913 | Ga0207695_10000615 | Ga0207695_1000061514 | 292 |
| 842 | 3300025913 | Ga0207695_10038879 | Ga0207695_100388793 | 292 |
| 843 | 3300025949 | Ga0207667_10043443 | Ga0207667_100434434 | 292 |
| 844 | 3300026078 | Ga0207702_10180179 | Ga0207702_101801792 | 292 |
| 845 | 3300026142 | Ga0207698_10001442 | Ga0207698_100014428 | 292 |
| 846 | 3300031344 | Ga0265316_10121215 | Ga0265316_101212152 | 292 |
| 847 | 3300031711 | Ga0265314_10002266 | Ga0265314_100022663 | 292 |
| 848 | 3300046558 | Ga0495633_0152762 | Ga0495633_0152762_80_958 | 292 |
| 849 | 3300046660 | Ga0495625_0000337 | Ga0495625_0000337_53890_54774 | 292 |
| 850 | 3300048919 | Ga0496116_0021443 | Ga0496116_0021443_3125_4009 | 292 |
| 851 | 3300048924 | Ga0496121_0009533 | Ga0496121_0009533_7797_8738 | 292 |
| 852 | 3300048924 | Ga0496121_0055027 | Ga0496121_0055027_1173_2057 | 292 |
| 853 | 3300048925 | Ga0496122_0000408 | Ga0496122_0000408_52423_53307 | 292 |
| 854 | 3300048926 | Ga0496123_0000188 | Ga0496123_0000188_38017_38901 | 292 |
| 855 | 3300048928 | Ga0496125_0007948 | Ga0496125_0007948_7741_8619 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qyj-assembly1.cif.gz_A | crystal structure of alr0039, a putative alpha/beta hydrolase from nostoc sp pcc 7120. | 0.9868 | 1 | 290 |
| 3r41-assembly1.cif.gz_B | crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/apo | 0.9825 | 2 | 292 |
| 5t4t-assembly1.cif.gz_B | crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn - apo no halide | 0.9823 | 2 | 290 |
| 6qkw-assembly1.cif.gz_A | crystal structure of the fluoroacetate dehalogenase rpa1163 - tyr219phe - fluoroacetate soaked 2hr | 0.9806 | 2 | 292 |
| 3r3z-assembly1.cif.gz_A | crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/glycolate | 0.9801 | 2 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5k3cA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9673 | 2 | 290 | 3.40.50.1820 |
| 3b12A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9662 | 1 | 291 | 3.40.50.1820 |
| 4nvrD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9659 | 2 | 291 | 3.40.50.1820 |
| 3b12A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9564 | 1 | 291 | 3.40.50.1820 |
| 5k3cA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9473 | 2 | 290 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A246JNT3-F1-model_v4 | Alpha/beta hydrolase | 0.9926 | 2 | 290 |
GO:0016787
|
| AF-A0A538N151-F1-model_v4 | Alpha/beta hydrolase | 0.9926 | 1 | 128 |
GO:0016020
GO:0046464 GO:0047372 |
| AF-A0A2N2UBE0-F1-model_v4 | deleted | 0.9904 | 1 | 292 |
|
| AF-A0A552F0S2-F1-model_v4 | Alpha/beta hydrolase | 0.9897 | 1 | 290 |
GO:0016787
|
| AF-A0A7W0ZFJ5-F1-model_v4 | Alpha/beta fold hydrolase | 0.9891 | 1 | 131 |
GO:0016020
GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar