F483740

General Info

Members Datasets Scaffolds Average Seq Length
858 414 1716 195

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1837940|Ga0436365_1837940_502_1083
Length 181
Sequence MRIADQLVLRRQRHLKWSALDGLEMVLMIVCGLTLFGFSLTVLLDILTRSIGHPWLWLQEVTSTLFIYGIFAGAAAAARRNDHLCLTAFADALGGTRRLIVELLVYFGYLNFLRGFGSFRLPSNTPIASLYAAIPLSGILIALFTVEQIVNGCRNGFDHPEPELPAAGSLGTSEIAGGIDL

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
115 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
232 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
236 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
237 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
239 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
241 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
242 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
243 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
249 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
287 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
288 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
289 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
290 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
291 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
292 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
293 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
294 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
295 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
301 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
302 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
314 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
325 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
326 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
336 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
365 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
380 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
387 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
388 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
389 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
392 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
393 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
394 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
395 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
396 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
397 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
398 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
399 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
400 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
401 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
402 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
403 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
404 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
405 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
406 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
407 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
408 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
409 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
410 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
411 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
412 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
413 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
414 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.51
Nodule 0
Rhizoplane 6.88
Rhizosphere 81.47
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1837940 3300039437 Bacteria 1543
2 JGI24752J21851_1012432 3300001976 Bacteria 1113
3 JGI24746J21847_1008414 3300001977 Bacteria 1556
4 JGI24739J22299_10003543 3300001989 Bacteria 5963
5 JGI24737J22298_10010414 3300001990 Bacteria 3070
6 JGI24743J22301_10046747 3300001991 Bacteria 876
7 JGI24750J21931_1002536 3300002070 Bacteria 2204
8 JGI24745J21846_1002111 3300002073 Bacteria 1998
9 JGI24749J21850_1001559 3300002076 Bacteria 3243
10 JGI24035J26624_1019813 3300002126 Bacteria 706
11 JGI24033J26618_1000469 3300002155 Bacteria 3970
12 JGI24034J26672_10003383 3300002239 Bacteria 2223
13 JGI24742J22300_10000472 3300002244 Bacteria 5983
14 JGI25406J46586_10000391 3300003203 Bacteria 20143
15 JGI25153J46596_10001262 3300003215 Bacteria 15224
16 Ga0065712_10076149 3300005290 Bacteria 3719
17 Ga0065715_10090114 3300005293 Bacteria 7644
18 Ga0070658_10097347 3300005327 Bacteria 2430
19 Ga0070658_10314697 3300005327 Bacteria 1336
20 Ga0070658_10543715 3300005327 Bacteria 1005
21 Ga0070676_10000985 3300005328 Bacteria 14158
22 Ga0070676_10112805 3300005328 Bacteria 1695
23 Ga0070676_10453834 3300005328 Bacteria 902
24 Ga0070683_100001244 3300005329 Bacteria 19370
25 Ga0070683_100021416 3300005329 Bacteria 5771
26 Ga0070683_100056194 3300005329 Bacteria 3655
27 Ga0070690_100001493 3300005330 Bacteria 12237
28 Ga0070690_100604957 3300005330 Bacteria 832
29 Ga0070670_100012785 3300005331 Bacteria 7182
30 Ga0070670_100274813 3300005331 Bacteria 1471
31 Ga0070677_10001822 3300005333 Bacteria 6727
32 Ga0068869_100027575 3300005334 Bacteria 3961
33 Ga0068869_100068768 3300005334 Bacteria 2617
34 Ga0068869_100449584 3300005334 Bacteria 1068
35 Ga0068869_100740997 3300005334 Bacteria 841
36 Ga0070666_10488357 3300005335 Bacteria 892
37 Ga0070680_100007551 3300005336 Bacteria 8291
38 Ga0070680_100023255 3300005336 Bacteria 4941
39 Ga0070680_100026989 3300005336 Bacteria 4597
40 Ga0070680_100101119 3300005336 Bacteria 2393
41 Ga0070680_100194075 3300005336 Bacteria 1712
42 Ga0070682_100008641 3300005337 Bacteria 5751
43 Ga0070682_100087638 3300005337 Bacteria 2030
44 Ga0070682_100507418 3300005337 Bacteria 936
45 Ga0068868_100004160 3300005338 Bacteria 10113
46 Ga0068868_100040446 3300005338 Bacteria 3629
47 Ga0068868_100195262 3300005338 Bacteria 1685
48 Ga0068868_100271976 3300005338 Bacteria 1431
49 Ga0070660_100000525 3300005339 Bacteria 25536
50 Ga0070660_100171249 3300005339 Bacteria 1754
51 Ga0070660_100344286 3300005339 Bacteria 1227
52 Ga0070660_100472467 3300005339 Bacteria 1042
53 Ga0070660_100799894 3300005339 Bacteria 793
54 Ga0070689_100024340 3300005340 Bacteria 4541
55 Ga0070689_100556697 3300005340 Bacteria 989
56 Ga0070691_10002569 3300005341 Bacteria 8092
57 Ga0070691_10040751 3300005341 Bacteria 2195
58 Ga0070687_100007695 3300005343 Bacteria 4513
59 Ga0070687_100749919 3300005343 Bacteria 687
60 Ga0070661_100004361 3300005344 Bacteria 9758
61 Ga0070661_100028305 3300005344 Bacteria 4041
62 Ga0070661_100232375 3300005344 Bacteria 1418
63 Ga0070661_100692069 3300005344 Bacteria 830
64 Ga0070692_10051642 3300005345 Bacteria 2139
65 Ga0070668_100015096 3300005347 Bacteria 5771
66 Ga0070668_100166307 3300005347 Bacteria 1793
67 Ga0070668_100167999 3300005347 Bacteria 1784
68 Ga0070668_100241795 3300005347 Bacteria 1495
69 Ga0070668_100912841 3300005347 Bacteria 785
70 Ga0070669_100012165 3300005353 Bacteria 6108
71 Ga0070675_100021242 3300005354 Bacteria 5185
72 Ga0070671_100005408 3300005355 Bacteria 10186
73 Ga0070671_100211334 3300005355 Bacteria 1646
74 Ga0070671_100469425 3300005355 Bacteria 1081
75 Ga0070671_100644771 3300005355 Bacteria 917
76 Ga0070674_100001208 3300005356 Bacteria 13557
77 Ga0070674_100306674 3300005356 Bacteria 1267
78 Ga0070673_100006682 3300005364 Bacteria 7519
79 Ga0070673_100161120 3300005364 Bacteria 1908
80 Ga0070673_100331823 3300005364 Bacteria 1346
81 Ga0070673_100372785 3300005364 Bacteria 1271
82 Ga0070688_100001615 3300005365 Bacteria 11287
83 Ga0070659_100015442 3300005366 Bacteria 5720
84 Ga0070659_100136776 3300005366 Bacteria 1992
85 Ga0070659_100232125 3300005366 Bacteria 1525
86 Ga0070667_100018716 3300005367 Bacteria 5744
87 Ga0070667_100486576 3300005367 Bacteria 1130
88 Ga0070703_10014208 3300005406 Bacteria 2266
89 Ga0070714_100240420 3300005435 Bacteria 1671
90 Ga0070713_100202664 3300005436 Bacteria 1793
91 Ga0070713_100756455 3300005436 Bacteria 930
92 Ga0070710_10024408 3300005437 Bacteria 3189
93 Ga0070701_10000532 3300005438 Bacteria 13106
94 Ga0070711_100493274 3300005439 Bacteria 1009
95 Ga0070711_101019257 3300005439 Bacteria 711
96 Ga0070705_100006339 3300005440 Bacteria 5795
97 Ga0070705_100131520 3300005440 Bacteria 1633
98 Ga0070700_100008085 3300005441 Bacteria 5716
99 Ga0070694_100001428 3300005444 Bacteria 13999
100 Ga0070708_100125035 3300005445 Bacteria 2376
101 Ga0070708_100508114 3300005445 Bacteria 1137
102 Ga0070663_100010520 3300005455 Bacteria 5767
103 Ga0070663_100022138 3300005455 Bacteria 4243
104 Ga0070663_100024920 3300005455 Bacteria 4033
105 Ga0070663_100090235 3300005455 Bacteria 2269
106 Ga0070678_100009854 3300005456 Bacteria 5808
107 Ga0070678_100053903 3300005456 Bacteria 2927
108 Ga0070678_100103338 3300005456 Bacteria 2213
109 Ga0070678_100136432 3300005456 Bacteria 1957
110 Ga0070678_100484388 3300005456 Bacteria 1089
111 Ga0070678_100544484 3300005456 Bacteria 1030
112 Ga0070662_100014422 3300005457 Bacteria 5281
113 Ga0070662_100251704 3300005457 Bacteria 1420
114 Ga0070662_100586244 3300005457 Bacteria 937
115 Ga0070662_100719198 3300005457 Bacteria 845
116 Ga0070662_100932416 3300005457 Bacteria 742
117 Ga0070681_10012218 3300005458 Bacteria 8513
118 Ga0070681_10023185 3300005458 Bacteria 6243
119 Ga0070681_10034228 3300005458 Bacteria 5102
120 Ga0070681_10097125 3300005458 Bacteria 2894
121 Ga0068867_100007122 3300005459 Bacteria 7900
122 Ga0068867_100148242 3300005459 Bacteria 1841
123 Ga0068867_100479077 3300005459 Bacteria 1066
124 Ga0068867_100602142 3300005459 Bacteria 958
125 Ga0070685_10006338 3300005466 Bacteria 6029
126 Ga0070706_100978125 3300005467 Bacteria 781
127 Ga0070698_100514856 3300005471 Bacteria 1135
128 Ga0070699_100736214 3300005518 Bacteria 901
129 Ga0070679_100008193 3300005530 Bacteria 9826
130 Ga0070679_100032443 3300005530 Bacteria 5166
131 Ga0070679_100043808 3300005530 Bacteria 4456
132 Ga0070679_100189455 3300005530 Bacteria 2026
133 Ga0070684_100018105 3300005535 Bacteria 5794
134 Ga0070684_100078373 3300005535 Bacteria 2919
135 Ga0070697_100139954 3300005536 Bacteria 2035
136 Ga0068853_100004923 3300005539 Bacteria 10398
137 Ga0068853_100018286 3300005539 Bacteria 5799
138 Ga0068853_100247538 3300005539 Bacteria 1635
139 Ga0068853_100493382 3300005539 Bacteria 1155
140 Ga0070672_100063030 3300005543 Bacteria 2927
141 Ga0070672_100383055 3300005543 Bacteria 1203
142 Ga0070686_100003535 3300005544 Bacteria 8573
143 Ga0070686_100742359 3300005544 Bacteria 787
144 Ga0070695_100014849 3300005545 Bacteria 4699
145 Ga0070695_100193352 3300005545 Bacteria 1449
146 Ga0070696_100013526 3300005546 Bacteria 5475
147 Ga0070696_100027527 3300005546 Bacteria 3874
148 Ga0070693_100021258 3300005547 Bacteria 3435
149 Ga0070693_100458609 3300005547 Bacteria 896
150 Ga0070665_100107501 3300005548 Bacteria 2792
151 Ga0070665_100121909 3300005548 Bacteria 2609
152 Ga0070665_100148930 3300005548 Bacteria 2343
153 Ga0070665_100321928 3300005548 Bacteria 1550
154 Ga0070704_100001579 3300005549 Bacteria 12300
155 Ga0068855_100007753 3300005563 Bacteria 12964
156 Ga0068855_100074417 3300005563 Bacteria 3945
157 Ga0068855_100251844 3300005563 Bacteria 1970
158 Ga0068855_100468359 3300005563 Bacteria 1373
159 Ga0070664_100012792 3300005564 Bacteria 6828
160 Ga0070664_100373339 3300005564 Bacteria 1301
161 Ga0068857_100009322 3300005577 Bacteria 8522
162 Ga0068857_100725333 3300005577 Bacteria 945
163 Ga0068854_100014900 3300005578 Bacteria 5134
164 Ga0068854_100684500 3300005578 Bacteria 884
165 Ga0068856_100022760 3300005614 Bacteria 6093
166 Ga0068856_100549516 3300005614 Bacteria 1176
167 Ga0068856_100816412 3300005614 Bacteria 952
168 Ga0070702_100032491 3300005615 Bacteria 2864
169 Ga0070702_100101992 3300005615 Bacteria 1762
170 Ga0068852_100019352 3300005616 Bacteria 5386
171 Ga0068852_100134682 3300005616 Bacteria 2280
172 Ga0068859_100038422 3300005617 Bacteria 4803
173 Ga0068859_100196181 3300005617 Bacteria 2103
174 Ga0068859_100282244 3300005617 Bacteria 1753
175 Ga0068864_100003045 3300005618 Bacteria 13839
176 Ga0068864_100093839 3300005618 Bacteria 2651
177 Ga0068866_10000410 3300005718 Bacteria 20000
178 Ga0068861_100009022 3300005719 Bacteria 6875
179 Ga0068861_100042346 3300005719 Bacteria 3412
180 Ga0068861_100422001 3300005719 Bacteria 1189
181 Ga0068851_10007160 3300005834 Bacteria 5112
182 Ga0068851_10544251 3300005834 Bacteria 701
183 Ga0068870_10000215 3300005840 Bacteria 20886
184 Ga0068863_100023663 3300005841 Bacteria 5862
185 Ga0068863_100170619 3300005841 Bacteria 2087
186 Ga0068858_100005681 3300005842 Bacteria 12193
187 Ga0068858_100018788 3300005842 Bacteria 6466
188 Ga0068858_100234688 3300005842 Bacteria 1739
189 Ga0068860_100009344 3300005843 Bacteria 9741
190 Ga0068860_100118823 3300005843 Bacteria 2530
191 Ga0068860_100548003 3300005843 Bacteria 1158
192 Ga0068862_100044806 3300005844 Bacteria 3773
193 Ga0068862_100135537 3300005844 Bacteria 2182
194 Ga0068862_100157336 3300005844 Bacteria 2026
195 Ga0068862_100511026 3300005844 Bacteria 1142
196 Ga0068862_100743689 3300005844 Bacteria 953
197 Ga0081455_10010826 3300005937 Bacteria 9211
198 Ga0081455_10097457 3300005937 Bacteria 2369
199 Ga0081540_1004021 3300005983 Bacteria 11387
200 Ga0081540_1008008 3300005983 Bacteria 7437
201 Ga0081539_10000325 3300005985 Bacteria 106431
202 Ga0075365_10016351 3300006038 Bacteria 4511
203 Ga0075365_10022228 3300006038 Bacteria 3971
204 Ga0075365_10570315 3300006038 Bacteria 800
205 Ga0075368_10002357 3300006042 Bacteria 6143
206 Ga0075368_10016619 3300006042 Bacteria 2744
207 Ga0075368_10039243 3300006042 Bacteria 1855
208 Ga0075363_100005779 3300006048 Bacteria 5552
209 Ga0075363_100034596 3300006048 Bacteria 2638
210 Ga0075363_100106643 3300006048 Bacteria 1554
211 Ga0075364_10100797 3300006051 Bacteria 1922
212 Ga0075364_10163313 3300006051 Bacteria 1504
213 Ga0070716_100327453 3300006173 Bacteria 1076
214 Ga0070712_100088122 3300006175 Bacteria 2267
215 Ga0070712_100160288 3300006175 Bacteria 1737
216 Ga0075362_10231207 3300006177 Bacteria 905
217 Ga0075367_10094428 3300006178 Bacteria 1823
218 Ga0075367_10295436 3300006178 Bacteria 1019
219 Ga0075367_10360852 3300006178 Bacteria 917
220 Ga0075369_10053247 3300006186 Bacteria 1756
221 Ga0075369_10217304 3300006186 Bacteria 884
222 Ga0075366_10043175 3300006195 Bacteria 2670
223 Ga0097621_100003185 3300006237 Bacteria 11280
224 Ga0097621_100048888 3300006237 Bacteria 3434
225 Ga0097621_100091755 3300006237 Bacteria 2543
226 Ga0075370_10183682 3300006353 Bacteria 1231
227 Ga0075370_10389324 3300006353 Bacteria 835
228 Ga0068871_100002188 3300006358 Bacteria 13277
229 Ga0068871_100023330 3300006358 Bacteria 4783
230 Ga0075428_100756617 3300006844 Bacteria 1034
231 Ga0075433_10124505 3300006852 Bacteria 2289
232 Ga0075434_100295560 3300006871 Bacteria 1640
233 Ga0068865_100002213 3300006881 Bacteria 11451
234 Ga0068865_100297010 3300006881 Bacteria 1291
235 Ga0068865_100447027 3300006881 Bacteria 1068
236 Ga0097620_100038424 3300006931 Bacteria 4803
237 Ga0097620_100196196 3300006931 Bacteria 2103
238 Ga0097620_100282245 3300006931 Bacteria 1753
239 Ga0075435_100047755 3300007076 Bacteria 3438
240 Ga0099794_10008675 3300007265 Bacteria 4233
241 Ga0099794_10097086 3300007265 Bacteria 1467
242 Ga0099795_10162943 3300007788 Bacteria 921
243 Ga0105250_10048010 3300009092 Bacteria 1712
244 Ga0105250_10192240 3300009092 Bacteria 859
245 Ga0105240_10068685 3300009093 Bacteria 4389
246 Ga0105240_10087444 3300009093 Bacteria 3817
247 Ga0105240_10089365 3300009093 Bacteria 3768
248 Ga0105240_10149321 3300009093 Bacteria 2785
249 Ga0105240_10478141 3300009093 Bacteria 1389
250 Ga0105240_11260796 3300009093 Bacteria 781
251 Ga0111539_10086265 3300009094 Bacteria 3689
252 Ga0111539_10122064 3300009094 Bacteria 3053
253 Ga0105245_10014117 3300009098 Bacteria 6959
254 Ga0105245_10040688 3300009098 Bacteria 4142
255 Ga0105245_10119508 3300009098 Bacteria 2460
256 Ga0105245_10144739 3300009098 Bacteria 2242
257 Ga0105245_11404765 3300009098 Bacteria 748
258 Ga0105247_10010226 3300009101 Bacteria 5677
259 Ga0105247_10532163 3300009101 Bacteria 861
260 Ga0105247_10595430 3300009101 Bacteria 819
261 Ga0114129_10942031 3300009147 Bacteria 1091
262 Ga0105243_10021155 3300009148 Bacteria 4937
263 Ga0105243_10260410 3300009148 Bacteria 1552
264 Ga0105243_10305167 3300009148 Bacteria 1444
265 Ga0105243_10428698 3300009148 Bacteria 1235
266 Ga0105241_10007805 3300009174 Bacteria 7868
267 Ga0105241_10059029 3300009174 Bacteria 2948
268 Ga0105241_10131335 3300009174 Bacteria 2028
269 Ga0105241_11025055 3300009174 Bacteria 773
270 Ga0105242_10011497 3300009176 Bacteria 6805
271 Ga0105242_10022559 3300009176 Bacteria 4953
272 Ga0105242_11461732 3300009176 Bacteria 713
273 Ga0105248_10015952 3300009177 Bacteria 8273
274 Ga0105248_10111703 3300009177 Bacteria 3082
275 Ga0105248_10401333 3300009177 Bacteria 1544
276 Ga0105248_11116896 3300009177 Bacteria 891
277 Ga0105248_11925161 3300009177 Bacteria 671
278 Ga0105237_10020483 3300009545 Bacteria 6814
279 Ga0105237_10020640 3300009545 Bacteria 6787
280 Ga0105237_10064116 3300009545 Bacteria 3671
281 Ga0105237_10069207 3300009545 Bacteria 3525
282 Ga0105238_10155090 3300009551 Bacteria 2265
283 Ga0105238_10155557 3300009551 Bacteria 2262
284 Ga0105238_10435918 3300009551 Bacteria 1306
285 Ga0105238_10721881 3300009551 Bacteria 1009
286 Ga0105249_10019102 3300009553 Bacteria 6113
287 Ga0105249_10218819 3300009553 Bacteria 1873
288 Ga0105249_10334904 3300009553 Bacteria 1528
289 Ga0105249_10397003 3300009553 Bacteria 1409
290 Ga0105249_10842734 3300009553 Bacteria 982
291 Ga0099796_10050846 3300010159 Bacteria 1438
292 Ga0099796_10154186 3300010159 Bacteria 906
293 Ga0105239_10017767 3300010375 Bacteria 7867
294 Ga0105239_10023322 3300010375 Bacteria 6815
295 Ga0105239_10025012 3300010375 Bacteria 6577
296 Ga0105239_10059417 3300010375 Bacteria 4196
297 Ga0105246_10006910 3300011119 Bacteria 6943
298 Ga0105246_10009055 3300011119 Bacteria 6131
299 Ga0105246_10041088 3300011119 Bacteria 3124
300 Ga0157373_10466225 3300013100 Unclassified 910
301 Ga0157373_10651073 3300013100 Bacteria 769
302 Ga0157371_10070050 3300013102 Bacteria 2483
303 Ga0157370_10070983 3300013104 Bacteria 3286
304 Ga0157369_10012203 3300013105 Bacteria 9753
305 Ga0157374_10012622 3300013296 Bacteria 7354
306 Ga0157374_10015792 3300013296 Bacteria 6632
307 Ga0157374_10973356 3300013296 Bacteria 867
308 Ga0157378_10004346 3300013297 Bacteria 12466
309 Ga0157378_10013549 3300013297 Bacteria 7132
310 Ga0157378_10032793 3300013297 Bacteria 4591
311 Ga0157378_10101631 3300013297 Bacteria 2626
312 Ga0163162_10022876 3300013306 Bacteria 6163
313 Ga0163162_10024629 3300013306 Bacteria 5943
314 Ga0163162_10028776 3300013306 Bacteria 5500
315 Ga0163162_10228397 3300013306 Bacteria 1991
316 Ga0157372_10032180 3300013307 Bacteria 5749
317 Ga0157372_10144235 3300013307 Bacteria 2746
318 Ga0157375_10008870 3300013308 Bacteria 8802
319 Ga0157375_10013411 3300013308 Bacteria 7292
320 Ga0157375_10218514 3300013308 Bacteria 2064
321 Ga0163163_10017188 3300014325 Bacteria 6740
322 Ga0163163_10020526 3300014325 Bacteria 6223
323 Ga0163163_10076512 3300014325 Bacteria 3342
324 Ga0163163_10966144 3300014325 Bacteria 915
325 Ga0157380_10004859 3300014326 Bacteria 9362
326 Ga0157380_10796750 3300014326 Bacteria 961
327 Ga0157377_10005046 3300014745 Bacteria 6163
328 Ga0157377_10111113 3300014745 Bacteria 1647
329 Ga0157379_10001743 3300014968 Bacteria 17988
330 Ga0157379_10117567 3300014968 Bacteria 2392
331 Ga0157376_10004024 3300014969 Bacteria 10170
332 Ga0157376_10004369 3300014969 Bacteria 9832
333 Ga0157376_10113020 3300014969 Bacteria 2394
334 Ga0157376_10397294 3300014969 Bacteria 1332
335 Ga0157376_10453429 3300014969 Bacteria 1251
336 Ga0163161_10046268 3300017792 Bacteria 3139
337 Ga0207672_1001816 3300025223 Bacteria 1445
338 Ga0207666_1001509 3300025271 Bacteria 2745
339 Ga0209758_1001760 3300025297 Bacteria 24019
340 Ga0209758_1002930 3300025297 Bacteria 16429
341 Ga0209758_1049442 3300025297 Bacteria 1484
342 Ga0207697_10003328 3300025315 Bacteria 8000
343 Ga0207697_10112021 3300025315 Bacteria 1169
344 Ga0207656_10037326 3300025321 Bacteria 2044
345 Ga0207696_1040479 3300025711 Bacteria 1365
346 Ga0207653_10001584 3300025885 Bacteria 7352
347 Ga0207653_10017401 3300025885 Bacteria 2263
348 Ga0207682_10000840 3300025893 Bacteria 14220
349 Ga0207692_10011060 3300025898 Bacteria 3822
350 Ga0207642_10002908 3300025899 Bacteria 5359
351 Ga0207710_10020577 3300025900 Bacteria 2822
352 Ga0207710_10071426 3300025900 Bacteria 1592
353 Ga0207688_10005487 3300025901 Bacteria 6897
354 Ga0207688_10093865 3300025901 Bacteria 1726
355 Ga0207680_10010064 3300025903 Bacteria 4717
356 Ga0207680_10138560 3300025903 Bacteria 1611
357 Ga0207645_10013928 3300025907 Bacteria 5393
358 Ga0207645_10150100 3300025907 Bacteria 1521
359 Ga0207645_10296789 3300025907 Bacteria 1075
360 Ga0207645_10398399 3300025907 Bacteria 925
361 Ga0207643_10000276 3300025908 Bacteria 35671
362 Ga0207643_10271422 3300025908 Bacteria 1050
363 Ga0207705_10714029 3300025909 Bacteria 779
364 Ga0207684_10225156 3300025910 Bacteria 1618
365 Ga0207684_10485383 3300025910 Bacteria 1060
366 Ga0207654_10004277 3300025911 Bacteria 7204
367 Ga0207654_10061851 3300025911 Bacteria 2192
368 Ga0207654_10233516 3300025911 Bacteria 1226
369 Ga0207707_10012946 3300025912 Bacteria 7262
370 Ga0207707_10018433 3300025912 Bacteria 6085
371 Ga0207707_10024047 3300025912 Bacteria 5327
372 Ga0207695_10086752 3300025913 Bacteria 3155
373 Ga0207695_10088335 3300025913 Bacteria 3120
374 Ga0207695_10126481 3300025913 Bacteria 2517
375 Ga0207671_10047596 3300025914 Bacteria 3174
376 Ga0207671_10054271 3300025914 Bacteria 2970
377 Ga0207671_10504431 3300025914 Bacteria 965
378 Ga0207671_10599459 3300025914 Bacteria 878
379 Ga0207693_10017706 3300025915 Bacteria 5681
380 Ga0207693_10182314 3300025915 Bacteria 1652
381 Ga0207693_10831348 3300025915 Bacteria 711
382 Ga0207663_10850012 3300025916 Bacteria 728
383 Ga0207660_10000087 3300025917 Bacteria 49552
384 Ga0207660_10037668 3300025917 Bacteria 3372
385 Ga0207660_10145492 3300025917 Bacteria 1816
386 Ga0207660_10228539 3300025917 Bacteria 1462
387 Ga0207662_10005762 3300025918 Bacteria 6631
388 Ga0207657_10009053 3300025919 Bacteria 10053
389 Ga0207657_10087064 3300025919 Bacteria 2614
390 Ga0207649_10002302 3300025920 Bacteria 10744
391 Ga0207649_10053840 3300025920 Bacteria 2502
392 Ga0207649_10795306 3300025920 Bacteria 738
393 Ga0207652_10012719 3300025921 Bacteria 6805
394 Ga0207652_10030585 3300025921 Bacteria 4510
395 Ga0207652_10030945 3300025921 Bacteria 4488
396 Ga0207652_10339448 3300025921 Bacteria 1356
397 Ga0207646_10433701 3300025922 Bacteria 1186
398 Ga0207681_10002160 3300025923 Bacteria 12529
399 Ga0207681_10056662 3300025923 Bacteria 2674
400 Ga0207694_10205059 3300025924 Bacteria 1605
401 Ga0207694_10320327 3300025924 Bacteria 1279
402 Ga0207694_10332033 3300025924 Bacteria 1256
403 Ga0207650_10019228 3300025925 Bacteria 4797
404 Ga0207659_10001604 3300025926 Bacteria 13419
405 Ga0207687_10007869 3300025927 Bacteria 6985
406 Ga0207687_10072785 3300025927 Bacteria 2459
407 Ga0207687_10075168 3300025927 Bacteria 2424
408 Ga0207700_10166711 3300025928 Bacteria 1834
409 Ga0207664_10064440 3300025929 Bacteria 2931
410 Ga0207644_10009341 3300025931 Bacteria 6440
411 Ga0207644_10371308 3300025931 Bacteria 1165
412 Ga0207644_10560530 3300025931 Bacteria 946
413 Ga0207690_10007427 3300025932 Bacteria 6506
414 Ga0207690_10158648 3300025932 Bacteria 1684
415 Ga0207690_10363981 3300025932 Bacteria 1146
416 Ga0207706_10022329 3300025933 Bacteria 5678
417 Ga0207706_10251155 3300025933 Bacteria 1545
418 Ga0207706_10318244 3300025933 Bacteria 1354
419 Ga0207686_10002664 3300025934 Bacteria 9686
420 Ga0207686_10110919 3300025934 Bacteria 1850
421 Ga0207709_10004315 3300025935 Bacteria 8237
422 Ga0207670_10008932 3300025936 Bacteria 5685
423 Ga0207670_10231775 3300025936 Bacteria 1418
424 Ga0207669_10001522 3300025937 Bacteria 9877
425 Ga0207704_10001334 3300025938 Bacteria 11006
426 Ga0207704_10097204 3300025938 Bacteria 1952
427 Ga0207704_10399158 3300025938 Bacteria 1084
428 Ga0207691_10007048 3300025940 Bacteria 10845
429 Ga0207711_10019435 3300025941 Bacteria 5656
430 Ga0207711_10488477 3300025941 Bacteria 1147
431 Ga0207689_10008107 3300025942 Bacteria 9162
432 Ga0207689_10023493 3300025942 Bacteria 5174
433 Ga0207689_10082273 3300025942 Bacteria 2647
434 Ga0207689_10398603 3300025942 Bacteria 1147
435 Ga0207689_10399784 3300025942 Bacteria 1145
436 Ga0207661_10008272 3300025944 Bacteria 7432
437 Ga0207661_10010523 3300025944 Bacteria 6663
438 Ga0207661_10068662 3300025944 Bacteria 2887
439 Ga0207679_10000131 3300025945 Bacteria 61363
440 Ga0207679_10072172 3300025945 Bacteria 2607
441 Ga0207679_10073609 3300025945 Bacteria 2585
442 Ga0207679_10086537 3300025945 Bacteria 2411
443 Ga0207667_10033464 3300025949 Bacteria 5525
444 Ga0207667_10221938 3300025949 Bacteria 1936
445 Ga0207667_10520135 3300025949 Bacteria 1205
446 Ga0207651_10001949 3300025960 Bacteria 9701
447 Ga0207651_10217571 3300025960 Bacteria 1542
448 Ga0207651_10646721 3300025960 Bacteria 928
449 Ga0207712_10075713 3300025961 Bacteria 2434
450 Ga0207668_10011269 3300025972 Bacteria 5426
451 Ga0207668_10069259 3300025972 Bacteria 2511
452 Ga0207668_10216152 3300025972 Bacteria 1536
453 Ga0207668_10701594 3300025972 Bacteria 889
454 Ga0207668_11049806 3300025972 Bacteria 729
455 Ga0207640_10014507 3300025981 Bacteria 4539
456 Ga0207640_10212642 3300025981 Bacteria 1474
457 Ga0207640_10618736 3300025981 Bacteria 919
458 Ga0207640_10659085 3300025981 Bacteria 893
459 Ga0207640_11042162 3300025981 Bacteria 721
460 Ga0207658_10018697 3300025986 Bacteria 4790
461 Ga0207658_10118872 3300025986 Bacteria 2103
462 Ga0207658_10832372 3300025986 Bacteria 839
463 Ga0207677_10003214 3300026023 Bacteria 8618
464 Ga0207703_10003628 3300026035 Bacteria 12867
465 Ga0207639_10006126 3300026041 Bacteria 8163
466 Ga0207639_10038326 3300026041 Bacteria 3564
467 Ga0207639_10093296 3300026041 Bacteria 2414
468 Ga0207639_10216978 3300026041 Bacteria 1650
469 Ga0207678_10006117 3300026067 Bacteria 10705
470 Ga0207678_10010709 3300026067 Bacteria 8055
471 Ga0207678_10021344 3300026067 Bacteria 5678
472 Ga0207678_10110906 3300026067 Bacteria 2340
473 Ga0207678_10306205 3300026067 Bacteria 1366
474 Ga0207708_10017163 3300026075 Bacteria 5449
475 Ga0207702_10003322 3300026078 Bacteria 14778
476 Ga0207702_10208529 3300026078 Bacteria 1815
477 Ga0207702_10235583 3300026078 Bacteria 1713
478 Ga0207702_10492244 3300026078 Bacteria 1194
479 Ga0207641_10001577 3300026088 Bacteria 22260
480 Ga0207641_10562944 3300026088 Bacteria 1113
481 Ga0207648_10014558 3300026089 Bacteria 7264
482 Ga0207648_10176922 3300026089 Bacteria 1887
483 Ga0207648_10194313 3300026089 Bacteria 1799
484 Ga0207648_10228151 3300026089 Bacteria 1656
485 Ga0207676_10001374 3300026095 Bacteria 18087
486 Ga0207676_10043343 3300026095 Bacteria 3464
487 Ga0207674_10006594 3300026116 Bacteria 13645
488 Ga0207674_10475635 3300026116 Bacteria 1208
489 Ga0207675_100004272 3300026118 Bacteria 13806
490 Ga0207675_100069846 3300026118 Bacteria 3283
491 Ga0207675_100239634 3300026118 Bacteria 1752
492 Ga0207675_100441294 3300026118 Bacteria 1288
493 Ga0207675_100503890 3300026118 Bacteria 1205
494 Ga0207675_100686621 3300026118 Bacteria 1032
495 Ga0207683_10013418 3300026121 Bacteria 6988
496 Ga0207683_10020456 3300026121 Bacteria 5660
497 Ga0207683_10023166 3300026121 Bacteria 5336
498 Ga0207683_10038513 3300026121 Bacteria 4168
499 Ga0207683_10089951 3300026121 Bacteria 2733
500 Ga0207683_10250296 3300026121 Bacteria 1617
501 Ga0207683_10274940 3300026121 Bacteria 1539
502 Ga0207683_10435608 3300026121 Bacteria 1208
503 Ga0207698_10024406 3300026142 Bacteria 4243
504 Ga0207698_10051510 3300026142 Bacteria 3148
505 Ga0207698_10313403 3300026142 Bacteria 1466
506 Ga0209588_1001117 3300027671 Bacteria 6910
507 Ga0209588_1060325 3300027671 Bacteria 1226
508 Ga0209588_1171656 3300027671 Bacteria 682
509 Ga0209813_10008824 3300027866 Bacteria 2557
510 Ga0209813_10016506 3300027866 Bacteria 2016
511 Ga0209813_10045154 3300027866 Bacteria 1356
512 Ga0209974_10008955 3300027876 Bacteria 3408
513 Ga0207428_10008966 3300027907 Bacteria 9010
514 Ga0268266_10014609 3300028379 Bacteria 6747
515 Ga0268266_10090160 3300028379 Bacteria 2687
516 Ga0268266_10302169 3300028379 Bacteria 1493
517 Ga0268266_10660118 3300028379 Bacteria 1007
518 Ga0268266_10695396 3300028379 Bacteria 980
519 Ga0268266_10892119 3300028379 Bacteria 860
520 Ga0268265_10001553 3300028380 Bacteria 19032
521 Ga0268265_10191385 3300028380 Bacteria 1767
522 Ga0268265_10195687 3300028380 Bacteria 1749
523 Ga0268265_10519973 3300028380 Bacteria 1125
524 Ga0268264_10005647 3300028381 Bacteria 10600
525 Ga0268264_10073992 3300028381 Bacteria 2893
526 Ga0268264_10095175 3300028381 Bacteria 2577
527 Ga0268264_10520178 3300028381 Bacteria 1163
528 Ga0307515_10017392 3300028794 Bacteria 13100
529 Ga0265340_10023271 3300031247 Bacteria 3160
530 Ga0265339_10180268 3300031249 Bacteria 1052
531 Ga0265339_10388476 3300031249 Bacteria 653
532 Ga0265316_10027648 3300031344 Bacteria 4692
533 Ga0265316_10495161 3300031344 Bacteria 873
534 Ga0307513_10300906 3300031456 Bacteria 1371
535 Ga0307513_10359292 3300031456 Bacteria 1202
536 Ga0307509_10235342 3300031507 Bacteria 1630
537 Ga0265314_10017398 3300031711 Bacteria 5645
538 Ga0265314_10119026 3300031711 Bacteria 1666
539 Ga0265314_10298387 3300031711 Bacteria 905
540 Ga0265342_10002383 3300031712 Bacteria 16284
541 Ga0307409_101043820 3300031995 Bacteria 837
542 Ga0307416_101077369 3300032002 Bacteria 908
543 Ga0373958_0122645 3300034819 Bacteria 629
544 Ga0373938_0006124 3300034957 Bacteria 2067
545 Ga0373926_0083218 3300035083 Bacteria 1185
546 Ga0373944_0137601 3300035089 Bacteria 853
547 Ga0373949_0013479 3300035090 Bacteria 1813
548 Ga0373952_0001500 3300035092 Bacteria 4248
549 Ga0373923_0082495 3300035111 Bacteria 1396
550 Ga0373932_0002832 3300035112 Bacteria 4292
551 Ga0373936_0091395 3300035113 Bacteria 1277
552 Ga0373939_0026437 3300035114 Bacteria 1636
553 Ga0373945_0051921 3300035116 Bacteria 1509
554 Ga0373945_0184943 3300035116 Bacteria 859
555 Ga0373953_0054638 3300035117 Bacteria 1620
556 Ga0373954_0007889 3300035118 Bacteria 4663
557 Ga0373954_0086584 3300035118 Bacteria 1501
558 Ga0373957_0056037 3300035120 Bacteria 1517
559 Ga0373960_0020648 3300035121 Bacteria 1743
560 Ga0373943_0023308 3300035170 Bacteria 2878
561 Ga0373943_0087121 3300035170 Bacteria 1611
562 Ga0373943_0176576 3300035170 Bacteria 1172
563 Ga0373942_0002862 3300035207 Bacteria 4100
564 Ga0373961_0005318 3300035241 Bacteria 3095
565 Ga0373962_0004811 3300035242 Bacteria 3261
566 Ga0373931_0000170 3300035691 Bacteria 28307
567 Ga0373931_0031459 3300035691 Bacteria 2740
568 Ga0373931_0213106 3300035691 Bacteria 1159
569 Ga0373931_0271411 3300035691 Bacteria 1038
570 Ga0373935_0001308 3300035692 Bacteria 13756
571 Ga0373935_0034916 3300035692 Bacteria 3136
572 Ga0373927_0008449 3300035695 Bacteria 6925
573 Ga0373927_0051579 3300035695 Bacteria 2660
574 Ga0373927_0341271 3300035695 Bacteria 987
575 Ga0373933_0000525 3300035724 Bacteria 23898
576 Ga0373947_0193041 3300035725 Bacteria 1329
577 Ga0373937_0504509 3300036401 Bacteria 1149
578 Ga0373925_0008961 3300037068 Bacteria 7292
579 Ga0373925_0234416 3300037068 Bacteria 1468
580 Ga0373925_0315230 3300037068 Bacteria 1265
581 Ga0373925_0340171 3300037068 Bacteria 1217
582 Ga0395898_1252906 3300037466 Bacteria 672
583 Ga0436364_0365117 3300037853 Bacteria 34686
584 Ga0436364_0411215 3300037853 Bacteria 1067
585 Ga0395901_0286983 3300038443 Bacteria 1709
586 Ga0436365_1902835 3300039437 Bacteria 3513
587 Ga0436363_0645088 3300039450 Bacteria 1793
588 Ga0451789_0669421 3300041443 Bacteria 716
589 Ga0451853_2415715 3300041512 Bacteria 848
590 Ga0466963_0093221 3300044694 Bacteria 2053
591 Ga0466959_0266788 3300045049 Bacteria 1177
592 Ga0495617_009770 3300046452 Bacteria 3291
593 Ga0495592_0100010 3300046454 Bacteria 2068
594 Ga0495603_0000003 3300046455 Bacteria 83533
595 Ga0495603_0057804 3300046455 Bacteria 2294
596 Ga0495603_0081759 3300046455 Bacteria 1893
597 Ga0495603_0149680 3300046455 Bacteria 1356
598 Ga0495590_0088353 3300046457 Bacteria 1095
599 Ga0495629_0000133 3300046459 Bacteria 64806
600 Ga0495629_0084498 3300046459 Bacteria 2215
601 Ga0495629_0232119 3300046459 Bacteria 1272
602 Ga0495638_0019901 3300046460 Bacteria 4437
603 Ga0495638_0092452 3300046460 Bacteria 1821
604 Ga0495641_0003044 3300046461 Bacteria 12816
605 Ga0495653_0046321 3300046463 Bacteria 3368
606 Ga0495653_0245983 3300046463 Bacteria 1189
607 Ga0495580_0001841 3300046472 Bacteria 18648
608 Ga0495580_0129867 3300046472 Bacteria 1748
609 Ga0495582_0000016 3300046473 Bacteria 100714
610 Ga0495582_0527195 3300046473 Bacteria 683
611 Ga0495605_0135249 3300046474 Bacteria 1109
612 Ga0495639_0000014 3300046475 Bacteria 82866
613 Ga0495639_0120186 3300046475 Bacteria 1253
614 Ga0495639_0170337 3300046475 Bacteria 1057
615 Ga0495662_0000086 3300046476 Bacteria 33465
616 Ga0495664_0261713 3300046477 Bacteria 1046
617 Ga0495585_0083526 3300046492 Bacteria 1728
618 Ga0495585_0177006 3300046492 Bacteria 1098
619 Ga0495594_0000051 3300046499 Bacteria 52030
620 Ga0495594_0026093 3300046499 Bacteria 3142
621 Ga0495594_0103049 3300046499 Bacteria 1606
622 Ga0495596_0200357 3300046500 Bacteria 776
623 Ga0495606_0150102 3300046507 Bacteria 1368
624 Ga0495606_0152538 3300046507 Bacteria 1355
625 Ga0495606_0320043 3300046507 Bacteria 834
626 Ga0495610_0085281 3300046512 Bacteria 1442
627 Ga0495616_0229089 3300046513 Bacteria 806
628 Ga0495618_0094405 3300046514 Bacteria 1913
629 Ga0495620_0176175 3300046515 Bacteria 828
630 Ga0495628_0044977 3300046516 Bacteria 3511
631 Ga0495630_0004094 3300046517 Bacteria 10204
632 Ga0495630_0774143 3300046517 Bacteria 733
633 Ga0495632_0049902 3300046519 Bacteria 2066
634 Ga0495632_0060860 3300046519 Bacteria 1833
635 Ga0495632_0160334 3300046519 Bacteria 1036
636 Ga0495643_0076409 3300046522 Bacteria 1751
637 Ga0495643_0234515 3300046522 Bacteria 864
638 Ga0495644_0072811 3300046523 Bacteria 1292
639 Ga0495648_0132423 3300046524 Bacteria 1324
640 Ga0495663_0021930 3300046525 Bacteria 1843
641 Ga0495666_0012669 3300046526 Bacteria 4202
642 Ga0495642_0103278 3300046528 Bacteria 1215
643 Ga0495652_0124425 3300046529 Bacteria 2051
644 Ga0495652_0130656 3300046529 Bacteria 1989
645 Ga0495665_0000477 3300046531 Bacteria 20160
646 Ga0495640_0001817 3300046533 Bacteria 16924
647 Ga0495640_0044697 3300046533 Bacteria 3078
648 Ga0495586_0043758 3300046535 Bacteria 2412
649 Ga0495598_0098887 3300046537 Bacteria 962
650 Ga0495609_0208745 3300046538 Bacteria 814
651 Ga0495621_0012570 3300046539 Bacteria 2642
652 Ga0495645_0140152 3300046543 Bacteria 1688
653 Ga0495622_0033686 3300046557 Bacteria 2390
654 Ga0495633_0066248 3300046558 Bacteria 1687
655 Ga0495633_0239010 3300046558 Bacteria 830
656 Ga0495656_0002167 3300046615 Bacteria 6489
657 Ga0495656_0022875 3300046615 Bacteria 2453
658 Ga0495668_0052365 3300046616 Bacteria 2259
659 Ga0495668_0096586 3300046616 Bacteria 1617
660 Ga0495668_0168318 3300046616 Bacteria 1200
661 Ga0495634_0003306 3300046642 Bacteria 12988
662 Ga0495611_0124399 3300046648 Bacteria 1202
663 Ga0495625_0101739 3300046660 Bacteria 1973
664 Ga0495625_0233652 3300046660 Bacteria 1200
665 Ga0495635_0000792 3300046663 Bacteria 20615
666 Ga0495635_0165964 3300046663 Bacteria 1502
667 Ga0495659_0014121 3300046664 Bacteria 2610
668 Ga0495661_0365416 3300046665 Bacteria 708
669 Ga0495588_0060927 3300046674 Bacteria 1953
670 Ga0495599_0005980 3300046678 Bacteria 7321
671 Ga0495623_0084067 3300046679 Bacteria 1965
672 Ga0495646_0025546 3300046680 Bacteria 3715
673 Ga0495647_0016722 3300046681 Bacteria 2587
674 Ga0495647_0046025 3300046681 Bacteria 1679
675 Ga0495658_0001354 3300046683 Bacteria 12855
676 Ga0495658_0011688 3300046683 Bacteria 4424
677 Ga0495658_0173659 3300046683 Bacteria 1335
678 Ga0495669_0046708 3300046684 Bacteria 1933
679 Ga0495613_0036724 3300046689 Bacteria 3633
680 Ga0495624_0000138 3300046690 Bacteria 52220
681 Ga0495624_0107090 3300046690 Bacteria 1720
682 Ga0495624_0282407 3300046690 Bacteria 1002
683 Ga0495670_0021129 3300046691 Bacteria 3210
684 Ga0495670_0035621 3300046691 Bacteria 2480
685 Ga0495670_0192105 3300046691 Bacteria 1080
686 Ga0495671_0156801 3300046692 Bacteria 1108
687 Ga0495671_0178674 3300046692 Bacteria 1031
688 Ga0495671_0358249 3300046692 Bacteria 699
689 Ga0495649_0214070 3300046694 Bacteria 998
690 Ga0495589_0033165 3300046794 Bacteria 2595
691 Ga0495600_0151073 3300046809 Bacteria 1504
692 Ga0495600_0202788 3300046809 Bacteria 1273
693 Ga0495581_0000001 3300047315 Bacteria 104278
694 Ga0495581_0047945 3300047315 Bacteria 2468
695 Ga0495581_0386957 3300047315 Unclassified 816
696 Ga0495604_0197924 3300047317 Bacteria 1396
697 Ga0495636_0054657 3300047318 Bacteria 1678
698 Ga0495674_0051240 3300047319 Bacteria 3639
699 Ga0495674_0416768 3300047319 Bacteria 1082
700 Ga0495672_0038704 3300047320 Bacteria 2907
701 Ga0495676_0003317 3300047321 Bacteria 14549
702 Ga0495676_0065794 3300047321 Bacteria 2812
703 Ga0495676_0356022 3300047321 Bacteria 978
704 Ga0495676_0477438 3300047321 Bacteria 820
705 Ga0495680_0041250 3300047322 Bacteria 3672
706 Ga0495680_0054212 3300047322 Bacteria 3115
707 Ga0495683_0054179 3300047323 Bacteria 2000
708 Ga0495683_0180576 3300047323 Bacteria 964
709 Ga0495677_0081266 3300047445 Bacteria 1215
710 Ga0495677_0155504 3300047445 Bacteria 881
711 Ga0495673_0155380 3300047469 Bacteria 882
712 Ga0495681_0160132 3300047470 Bacteria 938
713 Ga0495684_0075848 3300047471 Bacteria 2554
714 Ga0495684_0132280 3300047471 Bacteria 1873
715 Ga0495593_0000003 3300047673 Bacteria 120744
716 Ga0495593_0085462 3300047673 Bacteria 1628
717 Ga0496100_0012706 3300048903 Bacteria 4837
718 Ga0496100_0013461 3300048903 Bacteria 4718
719 Ga0496100_0099259 3300048903 Bacteria 2003
720 Ga0496100_0279605 3300048903 Bacteria 1244
721 Ga0496101_0000546 3300048904 Bacteria 23085
722 Ga0496101_0000799 3300048904 Bacteria 18620
723 Ga0496101_0093272 3300048904 Bacteria 2243
724 Ga0496101_0413652 3300048904 Bacteria 1063
725 Ga0496102_0007744 3300048905 Bacteria 9178
726 Ga0496102_0014921 3300048905 Bacteria 6759
727 Ga0496102_0024274 3300048905 Bacteria 5389
728 Ga0496102_0380771 3300048905 Bacteria 1328
729 Ga0496103_0009534 3300048906 Bacteria 5747
730 Ga0496103_0221597 3300048906 Bacteria 1216
731 Ga0496104_0013181 3300048907 Bacteria 7452
732 Ga0496104_0022184 3300048907 Bacteria 5832
733 Ga0496104_0103227 3300048907 Bacteria 2731
734 Ga0496105_0004365 3300048908 Bacteria 10648
735 Ga0496105_0005694 3300048908 Bacteria 9482
736 Ga0496105_0093713 3300048908 Bacteria 2480
737 Ga0496105_0237818 3300048908 Bacteria 1479
738 Ga0496106_0000596 3300048909 Bacteria 25827
739 Ga0496106_0010191 3300048909 Bacteria 6944
740 Ga0496106_0058167 3300048909 Bacteria 2926
741 Ga0496106_0068299 3300048909 Bacteria 2711
742 Ga0496106_0069159 3300048909 Bacteria 2694
743 Ga0496107_0001473 3300048910 Bacteria 14562
744 Ga0496107_0004946 3300048910 Bacteria 9068
745 Ga0496107_0118089 3300048910 Bacteria 1953
746 Ga0496107_0412877 3300048910 Bacteria 1004
747 Ga0496107_1085605 3300048910 Bacteria 579
748 Ga0496108_0009760 3300048911 Bacteria 7775
749 Ga0496108_0037376 3300048911 Bacteria 4044
750 Ga0496108_0163862 3300048911 Bacteria 1922
751 Ga0496108_0428886 3300048911 Bacteria 1155
752 Ga0496108_0779436 3300048911 Bacteria 826
753 Ga0496109_0002259 3300048912 Bacteria 16010
754 Ga0496109_0029638 3300048912 Bacteria 4902
755 Ga0496109_0303005 3300048912 Bacteria 1507
756 Ga0496110_0042675 3300048913 Bacteria 3960
757 Ga0496110_0048228 3300048913 Bacteria 3733
758 Ga0496110_0129676 3300048913 Bacteria 2276
759 Ga0496110_0748577 3300048913 Bacteria 880
760 Ga0496111_0009810 3300048914 Bacteria 6401
761 Ga0496111_0117219 3300048914 Bacteria 1964
762 Ga0496111_0176501 3300048914 Bacteria 1588
763 Ga0496112_0028254 3300048915 Bacteria 5413
764 Ga0496112_0080606 3300048915 Bacteria 3219
765 Ga0496112_0144096 3300048915 Bacteria 2351
766 Ga0496112_0247200 3300048915 Bacteria 1735
767 Ga0496113_0004930 3300048916 Bacteria 8268
768 Ga0496113_0066128 3300048916 Bacteria 2737
769 Ga0496113_0642830 3300048916 Bacteria 848
770 Ga0496114_0030992 3300048917 Bacteria 4399
771 Ga0496115_0006165 3300048918 Bacteria 8769
772 Ga0496115_0017081 3300048918 Bacteria 5535
773 Ga0496115_0026085 3300048918 Bacteria 4557
774 Ga0496115_0043993 3300048918 Bacteria 3561
775 Ga0496117_0074195 3300048920 Bacteria 2266
776 Ga0496117_0274680 3300048920 Bacteria 906
777 Ga0496118_0135478 3300048921 Bacteria 1572
778 Ga0496119_0116463 3300048922 Bacteria 1475
779 Ga0496119_0157522 3300048922 Bacteria 1211
780 Ga0496121_0018644 3300048924 Bacteria 6985
781 Ga0496121_0236062 3300048924 Bacteria 1277
782 Ga0496121_0304358 3300048924 Bacteria 1080
783 Ga0496121_0462684 3300048924 Bacteria 814
784 Ga0496121_0608395 3300048924 Bacteria 673
785 Ga0496124_0391808 3300048927 Bacteria 967
786 Ga0496125_0052627 3300048928 Bacteria 3347
787 Ga0496125_0134035 3300048928 Bacteria 1737
788 Ga0496126_0002321 3300048929 Bacteria 26096
789 Ga0496126_0122640 3300048929 Bacteria 2252
790 Ga0496126_0262515 3300048929 Bacteria 1435
791 Ga0496126_0437692 3300048929 Bacteria 1054
792 Ga0495682_0116751 3300049460 Bacteria 956
793 Ga0501033_0639633 3300049570 Bacteria 727
794 Ga0501047_0159430 3300049581 Bacteria 2128
795 Ga0501048_0233638 3300049582 Bacteria 1305
796 Ga0501067_0076907 3300049583 Bacteria 1849
797 Ga0501070_0081815 3300049586 Bacteria 2672
798 Ga0501073_0326985 3300049589 Bacteria 1058
799 Ga0501080_0144062 3300049742 Bacteria 2202
800 Ga0501044_0540624 3300049823 Bacteria 1063
801 nmdc:mga03683_356761_c1 3300050489 Bacteria 693
802 nmdc:mga03n38_109633_c1 3300050490 Bacteria 1342
803 nmdc:mga03n38_14680_c1 3300050490 Bacteria 3009
804 nmdc:mga03n38_305606_c1 3300050490 Bacteria 855
805 nmdc:mga00v17_246424_c1 3300050491 Bacteria 1159
806 nmdc:mga00v17_31742_c1 3300050491 Bacteria 3117
807 nmdc:mga0yw44_186827_c1 3300050492 Bacteria 1366
808 nmdc:mga0yw44_29123_c1 3300050492 Bacteria 3185
809 nmdc:mga0k408_133587_c1 3300050493 Bacteria 1474
810 nmdc:mga06z11_267253_c1 3300050494 Bacteria 1011
811 nmdc:mga04h51_10221_c1 3300050495 Bacteria 2572
812 nmdc:mga04h51_19399_c1 3300050495 Bacteria 2016
813 nmdc:mga04h51_295062_c1 3300050495 Bacteria 659
814 nmdc:mga04h51_55514_c1 3300050495 Bacteria 1342
815 nmdc:mga07m45_25174_c1 3300050496 Bacteria 3262
816 nmdc:mga08y16_10222_c1 3300050511 Bacteria 9850
817 nmdc:mga0n895_20840_c1 3300050512 Bacteria 6123
818 nmdc:mga0n895_53449_c1 3300050512 Bacteria 3968
819 nmdc:mga0rr50_95082_c1 3300050513 Bacteria 2328
820 nmdc:mga08x19_219694_c1 3300050514 Bacteria 1305
821 nmdc:mga0a205_38265_c1 3300050515 Bacteria 4614
822 nmdc:mga0sz30_87013_c1 3300050516 Bacteria 1357
823 Ga0495601_0002167 3300053077 Bacteria 11051
824 Ga0495601_0667936 3300053077 Bacteria 664
825 Ga0495612_0014732 3300053078 Bacteria 3139
826 Ga0495655_0044133 3300053083 Bacteria 1152
827 Ga0495619_0001730 3300053085 Bacteria 14479
828 Ga0495619_0013347 3300053085 Bacteria 5176
829 Ga0500578_0555246 3300053086 Bacteria 638
830 Ga0500644_0092889 3300053088 Bacteria 1133
831 Ga0500581_261376 3300053089 Bacteria 718
832 Ga0500583_0345049 3300053092 Bacteria 722
833 Ga0500651_0256441 3300053093 Bacteria 1015
834 Ga0500566_0002624 3300053094 Bacteria 10704
835 Ga0500641_0090281 3300053096 Bacteria 1307
836 Ga0500554_159227 3300053102 Bacteria 762
837 Ga0500555_084011 3300053103 Bacteria 825
838 Ga0500556_0112037 3300053104 Bacteria 1059
839 Ga0500595_003609 3300053119 Bacteria 7173
840 Ga0500595_006946 3300053119 Bacteria 4749
841 Ga0500595_014185 3300053119 Bacteria 3030
842 Ga0500658_0066087 3300053134 Bacteria 1516
843 Ga0500559_0175105 3300053136 Bacteria 1010
844 Ga0500568_0114269 3300053139 Bacteria 1008
845 Ga0500577_0086631 3300053142 Bacteria 1259
846 Ga0500577_0223860 3300053142 Bacteria 815
847 Ga0500589_094813 3300053147 Bacteria 1307
848 Ga0500604_0028855 3300053151 Bacteria 1614
849 Ga0500604_0151225 3300053151 Bacteria 788
850 Ga0500620_006644 3300053155 Bacteria 2792
851 Ga0500622_0018905 3300053156 Bacteria 3662
852 Ga0500627_0057066 3300053158 Bacteria 1712
853 Ga0500634_0177152 3300053161 Bacteria 964
854 Ga0500638_165560 3300053162 Bacteria 968
855 Ga0500637_0000098 3300053178 Bacteria 31362
856 Ga0500637_0207140 3300053178 Bacteria 1114
857 Ga0500637_0220888 3300053178 Bacteria 1071
858 Ga0500661_001914 3300055283 Bacteria 3927
859 Ga0436365_1837940
860 JGI24752J21851_1012432
861 JGI24746J21847_1008414
862 JGI24739J22299_10003543
863 JGI24737J22298_10010414
864 JGI24743J22301_10046747
865 JGI24750J21931_1002536
866 JGI24745J21846_1002111
867 JGI24749J21850_1001559
868 JGI24035J26624_1019813
869 JGI24033J26618_1000469
870 JGI24034J26672_10003383
871 JGI24742J22300_10000472
872 JGI25406J46586_10000391
873 JGI25153J46596_10001262
874 Ga0065712_10076149
875 Ga0065715_10090114
876 Ga0070658_10097347
877 Ga0070658_10314697
878 Ga0070658_10543715
879 Ga0070676_10000985
880 Ga0070676_10112805
881 Ga0070676_10453834
882 Ga0070683_100001244
883 Ga0070683_100021416
884 Ga0070683_100056194
885 Ga0070690_100001493
886 Ga0070690_100604957
887 Ga0070670_100012785
888 Ga0070670_100274813
889 Ga0070677_10001822
890 Ga0068869_100027575
891 Ga0068869_100068768
892 Ga0068869_100449584
893 Ga0068869_100740997
894 Ga0070666_10488357
895 Ga0070680_100007551
896 Ga0070680_100023255
897 Ga0070680_100026989
898 Ga0070680_100101119
899 Ga0070680_100194075
900 Ga0070682_100008641
901 Ga0070682_100087638
902 Ga0070682_100507418
903 Ga0068868_100004160
904 Ga0068868_100040446
905 Ga0068868_100195262
906 Ga0068868_100271976
907 Ga0070660_100000525
908 Ga0070660_100171249
909 Ga0070660_100344286
910 Ga0070660_100472467
911 Ga0070660_100799894
912 Ga0070689_100024340
913 Ga0070689_100556697
914 Ga0070691_10002569
915 Ga0070691_10040751
916 Ga0070687_100007695
917 Ga0070687_100749919
918 Ga0070661_100004361
919 Ga0070661_100028305
920 Ga0070661_100232375
921 Ga0070661_100692069
922 Ga0070692_10051642
923 Ga0070668_100015096
924 Ga0070668_100166307
925 Ga0070668_100167999
926 Ga0070668_100241795
927 Ga0070668_100912841
928 Ga0070669_100012165
929 Ga0070675_100021242
930 Ga0070671_100005408
931 Ga0070671_100211334
932 Ga0070671_100469425
933 Ga0070671_100644771
934 Ga0070674_100001208
935 Ga0070674_100306674
936 Ga0070673_100006682
937 Ga0070673_100161120
938 Ga0070673_100331823
939 Ga0070673_100372785
940 Ga0070688_100001615
941 Ga0070659_100015442
942 Ga0070659_100136776
943 Ga0070659_100232125
944 Ga0070667_100018716
945 Ga0070667_100486576
946 Ga0070703_10014208
947 Ga0070714_100240420
948 Ga0070713_100202664
949 Ga0070713_100756455
950 Ga0070710_10024408
951 Ga0070701_10000532
952 Ga0070711_100493274
953 Ga0070711_101019257
954 Ga0070705_100006339
955 Ga0070705_100131520
956 Ga0070700_100008085
957 Ga0070694_100001428
958 Ga0070708_100125035
959 Ga0070708_100508114
960 Ga0070663_100010520
961 Ga0070663_100022138
962 Ga0070663_100024920
963 Ga0070663_100090235
964 Ga0070678_100009854
965 Ga0070678_100053903
966 Ga0070678_100103338
967 Ga0070678_100136432
968 Ga0070678_100484388
969 Ga0070678_100544484
970 Ga0070662_100014422
971 Ga0070662_100251704
972 Ga0070662_100586244
973 Ga0070662_100719198
974 Ga0070662_100932416
975 Ga0070681_10012218
976 Ga0070681_10023185
977 Ga0070681_10034228
978 Ga0070681_10097125
979 Ga0068867_100007122
980 Ga0068867_100148242
981 Ga0068867_100479077
982 Ga0068867_100602142
983 Ga0070685_10006338
984 Ga0070706_100978125
985 Ga0070698_100514856
986 Ga0070699_100736214
987 Ga0070679_100008193
988 Ga0070679_100032443
989 Ga0070679_100043808
990 Ga0070679_100189455
991 Ga0070684_100018105
992 Ga0070684_100078373
993 Ga0070697_100139954
994 Ga0068853_100004923
995 Ga0068853_100018286
996 Ga0068853_100247538
997 Ga0068853_100493382
998 Ga0070672_100063030
999 Ga0070672_100383055
1000 Ga0070686_100003535
1001 Ga0070686_100742359
1002 Ga0070695_100014849
1003 Ga0070695_100193352
1004 Ga0070696_100013526
1005 Ga0070696_100027527
1006 Ga0070693_100021258
1007 Ga0070693_100458609
1008 Ga0070665_100107501
1009 Ga0070665_100121909
1010 Ga0070665_100148930
1011 Ga0070665_100321928
1012 Ga0070704_100001579
1013 Ga0068855_100007753
1014 Ga0068855_100074417
1015 Ga0068855_100251844
1016 Ga0068855_100468359
1017 Ga0070664_100012792
1018 Ga0070664_100373339
1019 Ga0068857_100009322
1020 Ga0068857_100725333
1021 Ga0068854_100014900
1022 Ga0068854_100684500
1023 Ga0068856_100022760
1024 Ga0068856_100549516
1025 Ga0068856_100816412
1026 Ga0070702_100032491
1027 Ga0070702_100101992
1028 Ga0068852_100019352
1029 Ga0068852_100134682
1030 Ga0068859_100038422
1031 Ga0068859_100196181
1032 Ga0068859_100282244
1033 Ga0068864_100003045
1034 Ga0068864_100093839
1035 Ga0068866_10000410
1036 Ga0068861_100009022
1037 Ga0068861_100042346
1038 Ga0068861_100422001
1039 Ga0068851_10007160
1040 Ga0068851_10544251
1041 Ga0068870_10000215
1042 Ga0068863_100023663
1043 Ga0068863_100170619
1044 Ga0068858_100005681
1045 Ga0068858_100018788
1046 Ga0068858_100234688
1047 Ga0068860_100009344
1048 Ga0068860_100118823
1049 Ga0068860_100548003
1050 Ga0068862_100044806
1051 Ga0068862_100135537
1052 Ga0068862_100157336
1053 Ga0068862_100511026
1054 Ga0068862_100743689
1055 Ga0081455_10010826
1056 Ga0081455_10097457
1057 Ga0081540_1004021
1058 Ga0081540_1008008
1059 Ga0081539_10000325
1060 Ga0075365_10016351
1061 Ga0075365_10022228
1062 Ga0075365_10570315
1063 Ga0075368_10002357
1064 Ga0075368_10016619
1065 Ga0075368_10039243
1066 Ga0075363_100005779
1067 Ga0075363_100034596
1068 Ga0075363_100106643
1069 Ga0075364_10100797
1070 Ga0075364_10163313
1071 Ga0070716_100327453
1072 Ga0070712_100088122
1073 Ga0070712_100160288
1074 Ga0075362_10231207
1075 Ga0075367_10094428
1076 Ga0075367_10295436
1077 Ga0075367_10360852
1078 Ga0075369_10053247
1079 Ga0075369_10217304
1080 Ga0075366_10043175
1081 Ga0097621_100003185
1082 Ga0097621_100048888
1083 Ga0097621_100091755
1084 Ga0075370_10183682
1085 Ga0075370_10389324
1086 Ga0068871_100002188
1087 Ga0068871_100023330
1088 Ga0075428_100756617
1089 Ga0075433_10124505
1090 Ga0075434_100295560
1091 Ga0068865_100002213
1092 Ga0068865_100297010
1093 Ga0068865_100447027
1094 Ga0097620_100038424
1095 Ga0097620_100196196
1096 Ga0097620_100282245
1097 Ga0075435_100047755
1098 Ga0099794_10008675
1099 Ga0099794_10097086
1100 Ga0099795_10162943
1101 Ga0105250_10048010
1102 Ga0105250_10192240
1103 Ga0105240_10068685
1104 Ga0105240_10087444
1105 Ga0105240_10089365
1106 Ga0105240_10149321
1107 Ga0105240_10478141
1108 Ga0105240_11260796
1109 Ga0111539_10086265
1110 Ga0111539_10122064
1111 Ga0105245_10014117
1112 Ga0105245_10040688
1113 Ga0105245_10119508
1114 Ga0105245_10144739
1115 Ga0105245_11404765
1116 Ga0105247_10010226
1117 Ga0105247_10532163
1118 Ga0105247_10595430
1119 Ga0114129_10942031
1120 Ga0105243_10021155
1121 Ga0105243_10260410
1122 Ga0105243_10305167
1123 Ga0105243_10428698
1124 Ga0105241_10007805
1125 Ga0105241_10059029
1126 Ga0105241_10131335
1127 Ga0105241_11025055
1128 Ga0105242_10011497
1129 Ga0105242_10022559
1130 Ga0105242_11461732
1131 Ga0105248_10015952
1132 Ga0105248_10111703
1133 Ga0105248_10401333
1134 Ga0105248_11116896
1135 Ga0105248_11925161
1136 Ga0105237_10020483
1137 Ga0105237_10020640
1138 Ga0105237_10064116
1139 Ga0105237_10069207
1140 Ga0105238_10155090
1141 Ga0105238_10155557
1142 Ga0105238_10435918
1143 Ga0105238_10721881
1144 Ga0105249_10019102
1145 Ga0105249_10218819
1146 Ga0105249_10334904
1147 Ga0105249_10397003
1148 Ga0105249_10842734
1149 Ga0099796_10050846
1150 Ga0099796_10154186
1151 Ga0105239_10017767
1152 Ga0105239_10023322
1153 Ga0105239_10025012
1154 Ga0105239_10059417
1155 Ga0105246_10006910
1156 Ga0105246_10009055
1157 Ga0105246_10041088
1158 Ga0157373_10466225
1159 Ga0157373_10651073
1160 Ga0157371_10070050
1161 Ga0157370_10070983
1162 Ga0157369_10012203
1163 Ga0157374_10012622
1164 Ga0157374_10015792
1165 Ga0157374_10973356
1166 Ga0157378_10004346
1167 Ga0157378_10013549
1168 Ga0157378_10032793
1169 Ga0157378_10101631
1170 Ga0163162_10022876
1171 Ga0163162_10024629
1172 Ga0163162_10028776
1173 Ga0163162_10228397
1174 Ga0157372_10032180
1175 Ga0157372_10144235
1176 Ga0157375_10008870
1177 Ga0157375_10013411
1178 Ga0157375_10218514
1179 Ga0163163_10017188
1180 Ga0163163_10020526
1181 Ga0163163_10076512
1182 Ga0163163_10966144
1183 Ga0157380_10004859
1184 Ga0157380_10796750
1185 Ga0157377_10005046
1186 Ga0157377_10111113
1187 Ga0157379_10001743
1188 Ga0157379_10117567
1189 Ga0157376_10004024
1190 Ga0157376_10004369
1191 Ga0157376_10113020
1192 Ga0157376_10397294
1193 Ga0157376_10453429
1194 Ga0163161_10046268
1195 Ga0207672_1001816
1196 Ga0207666_1001509
1197 Ga0209758_1001760
1198 Ga0209758_1002930
1199 Ga0209758_1049442
1200 Ga0207697_10003328
1201 Ga0207697_10112021
1202 Ga0207656_10037326
1203 Ga0207696_1040479
1204 Ga0207653_10001584
1205 Ga0207653_10017401
1206 Ga0207682_10000840
1207 Ga0207692_10011060
1208 Ga0207642_10002908
1209 Ga0207710_10020577
1210 Ga0207710_10071426
1211 Ga0207688_10005487
1212 Ga0207688_10093865
1213 Ga0207680_10010064
1214 Ga0207680_10138560
1215 Ga0207645_10013928
1216 Ga0207645_10150100
1217 Ga0207645_10296789
1218 Ga0207645_10398399
1219 Ga0207643_10000276
1220 Ga0207643_10271422
1221 Ga0207705_10714029
1222 Ga0207684_10225156
1223 Ga0207684_10485383
1224 Ga0207654_10004277
1225 Ga0207654_10061851
1226 Ga0207654_10233516
1227 Ga0207707_10012946
1228 Ga0207707_10018433
1229 Ga0207707_10024047
1230 Ga0207695_10086752
1231 Ga0207695_10088335
1232 Ga0207695_10126481
1233 Ga0207671_10047596
1234 Ga0207671_10054271
1235 Ga0207671_10504431
1236 Ga0207671_10599459
1237 Ga0207693_10017706
1238 Ga0207693_10182314
1239 Ga0207693_10831348
1240 Ga0207663_10850012
1241 Ga0207660_10000087
1242 Ga0207660_10037668
1243 Ga0207660_10145492
1244 Ga0207660_10228539
1245 Ga0207662_10005762
1246 Ga0207657_10009053
1247 Ga0207657_10087064
1248 Ga0207649_10002302
1249 Ga0207649_10053840
1250 Ga0207649_10795306
1251 Ga0207652_10012719
1252 Ga0207652_10030585
1253 Ga0207652_10030945
1254 Ga0207652_10339448
1255 Ga0207646_10433701
1256 Ga0207681_10002160
1257 Ga0207681_10056662
1258 Ga0207694_10205059
1259 Ga0207694_10320327
1260 Ga0207694_10332033
1261 Ga0207650_10019228
1262 Ga0207659_10001604
1263 Ga0207687_10007869
1264 Ga0207687_10072785
1265 Ga0207687_10075168
1266 Ga0207700_10166711
1267 Ga0207664_10064440
1268 Ga0207644_10009341
1269 Ga0207644_10371308
1270 Ga0207644_10560530
1271 Ga0207690_10007427
1272 Ga0207690_10158648
1273 Ga0207690_10363981
1274 Ga0207706_10022329
1275 Ga0207706_10251155
1276 Ga0207706_10318244
1277 Ga0207686_10002664
1278 Ga0207686_10110919
1279 Ga0207709_10004315
1280 Ga0207670_10008932
1281 Ga0207670_10231775
1282 Ga0207669_10001522
1283 Ga0207704_10001334
1284 Ga0207704_10097204
1285 Ga0207704_10399158
1286 Ga0207691_10007048
1287 Ga0207711_10019435
1288 Ga0207711_10488477
1289 Ga0207689_10008107
1290 Ga0207689_10023493
1291 Ga0207689_10082273
1292 Ga0207689_10398603
1293 Ga0207689_10399784
1294 Ga0207661_10008272
1295 Ga0207661_10010523
1296 Ga0207661_10068662
1297 Ga0207679_10000131
1298 Ga0207679_10072172
1299 Ga0207679_10073609
1300 Ga0207679_10086537
1301 Ga0207667_10033464
1302 Ga0207667_10221938
1303 Ga0207667_10520135
1304 Ga0207651_10001949
1305 Ga0207651_10217571
1306 Ga0207651_10646721
1307 Ga0207712_10075713
1308 Ga0207668_10011269
1309 Ga0207668_10069259
1310 Ga0207668_10216152
1311 Ga0207668_10701594
1312 Ga0207668_11049806
1313 Ga0207640_10014507
1314 Ga0207640_10212642
1315 Ga0207640_10618736
1316 Ga0207640_10659085
1317 Ga0207640_11042162
1318 Ga0207658_10018697
1319 Ga0207658_10118872
1320 Ga0207658_10832372
1321 Ga0207677_10003214
1322 Ga0207703_10003628
1323 Ga0207639_10006126
1324 Ga0207639_10038326
1325 Ga0207639_10093296
1326 Ga0207639_10216978
1327 Ga0207678_10006117
1328 Ga0207678_10010709
1329 Ga0207678_10021344
1330 Ga0207678_10110906
1331 Ga0207678_10306205
1332 Ga0207708_10017163
1333 Ga0207702_10003322
1334 Ga0207702_10208529
1335 Ga0207702_10235583
1336 Ga0207702_10492244
1337 Ga0207641_10001577
1338 Ga0207641_10562944
1339 Ga0207648_10014558
1340 Ga0207648_10176922
1341 Ga0207648_10194313
1342 Ga0207648_10228151
1343 Ga0207676_10001374
1344 Ga0207676_10043343
1345 Ga0207674_10006594
1346 Ga0207674_10475635
1347 Ga0207675_100004272
1348 Ga0207675_100069846
1349 Ga0207675_100239634
1350 Ga0207675_100441294
1351 Ga0207675_100503890
1352 Ga0207675_100686621
1353 Ga0207683_10013418
1354 Ga0207683_10020456
1355 Ga0207683_10023166
1356 Ga0207683_10038513
1357 Ga0207683_10089951
1358 Ga0207683_10250296
1359 Ga0207683_10274940
1360 Ga0207683_10435608
1361 Ga0207698_10024406
1362 Ga0207698_10051510
1363 Ga0207698_10313403
1364 Ga0209588_1001117
1365 Ga0209588_1060325
1366 Ga0209588_1171656
1367 Ga0209813_10008824
1368 Ga0209813_10016506
1369 Ga0209813_10045154
1370 Ga0209974_10008955
1371 Ga0207428_10008966
1372 Ga0268266_10014609
1373 Ga0268266_10090160
1374 Ga0268266_10302169
1375 Ga0268266_10660118
1376 Ga0268266_10695396
1377 Ga0268266_10892119
1378 Ga0268265_10001553
1379 Ga0268265_10191385
1380 Ga0268265_10195687
1381 Ga0268265_10519973
1382 Ga0268264_10005647
1383 Ga0268264_10073992
1384 Ga0268264_10095175
1385 Ga0268264_10520178
1386 Ga0307515_10017392
1387 Ga0265340_10023271
1388 Ga0265339_10180268
1389 Ga0265339_10388476
1390 Ga0265316_10027648
1391 Ga0265316_10495161
1392 Ga0307513_10300906
1393 Ga0307513_10359292
1394 Ga0307509_10235342
1395 Ga0265314_10017398
1396 Ga0265314_10119026
1397 Ga0265314_10298387
1398 Ga0265342_10002383
1399 Ga0307409_101043820
1400 Ga0307416_101077369
1401 Ga0373958_0122645
1402 Ga0373938_0006124
1403 Ga0373926_0083218
1404 Ga0373944_0137601
1405 Ga0373949_0013479
1406 Ga0373952_0001500
1407 Ga0373923_0082495
1408 Ga0373932_0002832
1409 Ga0373936_0091395
1410 Ga0373939_0026437
1411 Ga0373945_0051921
1412 Ga0373945_0184943
1413 Ga0373953_0054638
1414 Ga0373954_0007889
1415 Ga0373954_0086584
1416 Ga0373957_0056037
1417 Ga0373960_0020648
1418 Ga0373943_0023308
1419 Ga0373943_0087121
1420 Ga0373943_0176576
1421 Ga0373942_0002862
1422 Ga0373961_0005318
1423 Ga0373962_0004811
1424 Ga0373931_0000170
1425 Ga0373931_0031459
1426 Ga0373931_0213106
1427 Ga0373931_0271411
1428 Ga0373935_0001308
1429 Ga0373935_0034916
1430 Ga0373927_0008449
1431 Ga0373927_0051579
1432 Ga0373927_0341271
1433 Ga0373933_0000525
1434 Ga0373947_0193041
1435 Ga0373937_0504509
1436 Ga0373925_0008961
1437 Ga0373925_0234416
1438 Ga0373925_0315230
1439 Ga0373925_0340171
1440 Ga0395898_1252906
1441 Ga0436364_0365117
1442 Ga0436364_0411215
1443 Ga0395901_0286983
1444 Ga0436365_1902835
1445 Ga0436363_0645088
1446 Ga0451789_0669421
1447 Ga0451853_2415715
1448 Ga0466963_0093221
1449 Ga0466959_0266788
1450 Ga0495617_009770
1451 Ga0495592_0100010
1452 Ga0495603_0000003
1453 Ga0495603_0057804
1454 Ga0495603_0081759
1455 Ga0495603_0149680
1456 Ga0495590_0088353
1457 Ga0495629_0000133
1458 Ga0495629_0084498
1459 Ga0495629_0232119
1460 Ga0495638_0019901
1461 Ga0495638_0092452
1462 Ga0495641_0003044
1463 Ga0495653_0046321
1464 Ga0495653_0245983
1465 Ga0495580_0001841
1466 Ga0495580_0129867
1467 Ga0495582_0000016
1468 Ga0495582_0527195
1469 Ga0495605_0135249
1470 Ga0495639_0000014
1471 Ga0495639_0120186
1472 Ga0495639_0170337
1473 Ga0495662_0000086
1474 Ga0495664_0261713
1475 Ga0495585_0083526
1476 Ga0495585_0177006
1477 Ga0495594_0000051
1478 Ga0495594_0026093
1479 Ga0495594_0103049
1480 Ga0495596_0200357
1481 Ga0495606_0150102
1482 Ga0495606_0152538
1483 Ga0495606_0320043
1484 Ga0495610_0085281
1485 Ga0495616_0229089
1486 Ga0495618_0094405
1487 Ga0495620_0176175
1488 Ga0495628_0044977
1489 Ga0495630_0004094
1490 Ga0495630_0774143
1491 Ga0495632_0049902
1492 Ga0495632_0060860
1493 Ga0495632_0160334
1494 Ga0495643_0076409
1495 Ga0495643_0234515
1496 Ga0495644_0072811
1497 Ga0495648_0132423
1498 Ga0495663_0021930
1499 Ga0495666_0012669
1500 Ga0495642_0103278
1501 Ga0495652_0124425
1502 Ga0495652_0130656
1503 Ga0495665_0000477
1504 Ga0495640_0001817
1505 Ga0495640_0044697
1506 Ga0495586_0043758
1507 Ga0495598_0098887
1508 Ga0495609_0208745
1509 Ga0495621_0012570
1510 Ga0495645_0140152
1511 Ga0495622_0033686
1512 Ga0495633_0066248
1513 Ga0495633_0239010
1514 Ga0495656_0002167
1515 Ga0495656_0022875
1516 Ga0495668_0052365
1517 Ga0495668_0096586
1518 Ga0495668_0168318
1519 Ga0495634_0003306
1520 Ga0495611_0124399
1521 Ga0495625_0101739
1522 Ga0495625_0233652
1523 Ga0495635_0000792
1524 Ga0495635_0165964
1525 Ga0495659_0014121
1526 Ga0495661_0365416
1527 Ga0495588_0060927
1528 Ga0495599_0005980
1529 Ga0495623_0084067
1530 Ga0495646_0025546
1531 Ga0495647_0016722
1532 Ga0495647_0046025
1533 Ga0495658_0001354
1534 Ga0495658_0011688
1535 Ga0495658_0173659
1536 Ga0495669_0046708
1537 Ga0495613_0036724
1538 Ga0495624_0000138
1539 Ga0495624_0107090
1540 Ga0495624_0282407
1541 Ga0495670_0021129
1542 Ga0495670_0035621
1543 Ga0495670_0192105
1544 Ga0495671_0156801
1545 Ga0495671_0178674
1546 Ga0495671_0358249
1547 Ga0495649_0214070
1548 Ga0495589_0033165
1549 Ga0495600_0151073
1550 Ga0495600_0202788
1551 Ga0495581_0000001
1552 Ga0495581_0047945
1553 Ga0495581_0386957
1554 Ga0495604_0197924
1555 Ga0495636_0054657
1556 Ga0495674_0051240
1557 Ga0495674_0416768
1558 Ga0495672_0038704
1559 Ga0495676_0003317
1560 Ga0495676_0065794
1561 Ga0495676_0356022
1562 Ga0495676_0477438
1563 Ga0495680_0041250
1564 Ga0495680_0054212
1565 Ga0495683_0054179
1566 Ga0495683_0180576
1567 Ga0495677_0081266
1568 Ga0495677_0155504
1569 Ga0495673_0155380
1570 Ga0495681_0160132
1571 Ga0495684_0075848
1572 Ga0495684_0132280
1573 Ga0495593_0000003
1574 Ga0495593_0085462
1575 Ga0496100_0012706
1576 Ga0496100_0013461
1577 Ga0496100_0099259
1578 Ga0496100_0279605
1579 Ga0496101_0000546
1580 Ga0496101_0000799
1581 Ga0496101_0093272
1582 Ga0496101_0413652
1583 Ga0496102_0007744
1584 Ga0496102_0014921
1585 Ga0496102_0024274
1586 Ga0496102_0380771
1587 Ga0496103_0009534
1588 Ga0496103_0221597
1589 Ga0496104_0013181
1590 Ga0496104_0022184
1591 Ga0496104_0103227
1592 Ga0496105_0004365
1593 Ga0496105_0005694
1594 Ga0496105_0093713
1595 Ga0496105_0237818
1596 Ga0496106_0000596
1597 Ga0496106_0010191
1598 Ga0496106_0058167
1599 Ga0496106_0068299
1600 Ga0496106_0069159
1601 Ga0496107_0001473
1602 Ga0496107_0004946
1603 Ga0496107_0118089
1604 Ga0496107_0412877
1605 Ga0496107_1085605
1606 Ga0496108_0009760
1607 Ga0496108_0037376
1608 Ga0496108_0163862
1609 Ga0496108_0428886
1610 Ga0496108_0779436
1611 Ga0496109_0002259
1612 Ga0496109_0029638
1613 Ga0496109_0303005
1614 Ga0496110_0042675
1615 Ga0496110_0048228
1616 Ga0496110_0129676
1617 Ga0496110_0748577
1618 Ga0496111_0009810
1619 Ga0496111_0117219
1620 Ga0496111_0176501
1621 Ga0496112_0028254
1622 Ga0496112_0080606
1623 Ga0496112_0144096
1624 Ga0496112_0247200
1625 Ga0496113_0004930
1626 Ga0496113_0066128
1627 Ga0496113_0642830
1628 Ga0496114_0030992
1629 Ga0496115_0006165
1630 Ga0496115_0017081
1631 Ga0496115_0026085
1632 Ga0496115_0043993
1633 Ga0496117_0074195
1634 Ga0496117_0274680
1635 Ga0496118_0135478
1636 Ga0496119_0116463
1637 Ga0496119_0157522
1638 Ga0496121_0018644
1639 Ga0496121_0236062
1640 Ga0496121_0304358
1641 Ga0496121_0462684
1642 Ga0496121_0608395
1643 Ga0496124_0391808
1644 Ga0496125_0052627
1645 Ga0496125_0134035
1646 Ga0496126_0002321
1647 Ga0496126_0122640
1648 Ga0496126_0262515
1649 Ga0496126_0437692
1650 Ga0495682_0116751
1651 Ga0501033_0639633
1652 Ga0501047_0159430
1653 Ga0501048_0233638
1654 Ga0501067_0076907
1655 Ga0501070_0081815
1656 Ga0501073_0326985
1657 Ga0501080_0144062
1658 Ga0501044_0540624
1659 nmdc:mga03683_356761_c1
1660 nmdc:mga03n38_109633_c1
1661 nmdc:mga03n38_14680_c1
1662 nmdc:mga03n38_305606_c1
1663 nmdc:mga00v17_246424_c1
1664 nmdc:mga00v17_31742_c1
1665 nmdc:mga0yw44_186827_c1
1666 nmdc:mga0yw44_29123_c1
1667 nmdc:mga0k408_133587_c1
1668 nmdc:mga06z11_267253_c1
1669 nmdc:mga04h51_10221_c1
1670 nmdc:mga04h51_19399_c1
1671 nmdc:mga04h51_295062_c1
1672 nmdc:mga04h51_55514_c1
1673 nmdc:mga07m45_25174_c1
1674 nmdc:mga08y16_10222_c1
1675 nmdc:mga0n895_20840_c1
1676 nmdc:mga0n895_53449_c1
1677 nmdc:mga0rr50_95082_c1
1678 nmdc:mga08x19_219694_c1
1679 nmdc:mga0a205_38265_c1
1680 nmdc:mga0sz30_87013_c1
1681 Ga0495601_0002167
1682 Ga0495601_0667936
1683 Ga0495612_0014732
1684 Ga0495655_0044133
1685 Ga0495619_0001730
1686 Ga0495619_0013347
1687 Ga0500578_0555246
1688 Ga0500644_0092889
1689 Ga0500581_261376
1690 Ga0500583_0345049
1691 Ga0500651_0256441
1692 Ga0500566_0002624
1693 Ga0500641_0090281
1694 Ga0500554_159227
1695 Ga0500555_084011
1696 Ga0500556_0112037
1697 Ga0500595_003609
1698 Ga0500595_006946
1699 Ga0500595_014185
1700 Ga0500658_0066087
1701 Ga0500559_0175105
1702 Ga0500568_0114269
1703 Ga0500577_0086631
1704 Ga0500577_0223860
1705 Ga0500589_094813
1706 Ga0500604_0028855
1707 Ga0500604_0151225
1708 Ga0500620_006644
1709 Ga0500622_0018905
1710 Ga0500627_0057066
1711 Ga0500634_0177152
1712 Ga0500638_165560
1713 Ga0500637_0000098
1714 Ga0500637_0207140
1715 Ga0500637_0220888
1716 Ga0500661_001914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

38

155

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8186 16 166
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.8096 17 168
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8044 16 166
6he3-assembly1.cif.gz_A pseudomonas aeruginosa seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)cytidine 0.6819 1 84
6he1-assembly1.cif.gz_A pseudomonas aeruginosa seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)n3-methyluridine 0.6667 1 84
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8751 39 166 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8511 39 166 1.20.120.550
1rq0B01 Special;Helix non-globular;Helix Hairpins; 0.6633 3 72 6.10.140.160
1rq0B01 Special;Helix non-globular;Helix Hairpins; 0.5666 3 72 6.10.140.160
af_Q9W068_21_197_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5371 64 163 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2V7ADU2-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.9716 4 172 GO:0005886
GO:0015740
GO:0022857
AF-A0A536V873-F1-model_v4 TRAP transporter small permease protein 0.9646 1 173 GO:0005886
GO:0015740
GO:0022857
AF-A0A4R7YZG8-F1-model_v4 TRAP-type C4-dicarboxylate transport system permease small subunit 0.9586 18 166 GO:0005886
GO:0015740
GO:0022857
AF-A0A7T7YH71-F1-model_v4 deleted 0.9575 29 172
AF-A0A401K823-F1-model_v4 TRAP transporter small permease protein 0.9562 18 166 GO:0005886
GO:0015740
GO:0022857

Map