F483744
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 858 | 584 | 1716 | 594 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0000275|Ga0496104_0000275_26186_28183 |
| Length | 665 |
| Sequence | MADAKNPAKRGAAADAAPTGGALHRYRSHTCGALRKTDVGKPARLSGWVHRVRDHGGLLFIDLRDHYGLTQVVADPDSPAFKTAEAVRSEWVIRVDGAVRDRPVIDGKSTVNPELPTGEIEVVASXXXXLSAAKELPVPVFGEPDYPEDLRLQYRFLDLRRETLHANIMKRLEIIKSIRRRMHEAGFNEFATPILTASSPEGARDFLVPSRIHEGKFYALPQAPQQYKQLLMVSGFDRYFQIAPCFRDEDPRADRLPGEFYQLDVEMSFVEQADVFAAMEPVVTGVLEEFAGPAEGGQGKTKPVTKGWPRIPYDEAIRKYGSDKPDLRNPIEMADVTEHFRGSGFKVFAGMIEKDPKVRVWAIPAPGGGSRAFCDRMNGWAQTEGQPGLAYIFWRASTPAVSSDASGAKKGPKAPTQYSPMLAMLEGAGPVAKNLGPERTEALRAKLALGDNDAVFFAAGNPDKFYRFAGEARSKIGAELKLIKEDQFALAWIVDFPFYEWNEEEKKLDFSHNPFSMPQGGLEALEAAEASARASGTTEDYLKIKAYQYDIVCNGFEIASGGIRNHKPDTMVKAFGIVGLGPEVVEQRFGGMYRAFQYGAPPHGGMAAGIDRMVMLLVGAKNLREVALFPMNQQANDLLMGAPSEVAMKQLRELHIRVAAPERRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 59 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 60 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 61 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 80 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 81 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 82 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 83 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 86 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 129 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 130 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 131 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 132 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 145 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 146 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 148 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 149 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 151 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 152 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 158 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 159 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 165 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 173 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 174 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 181 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 193 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 251 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 252 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 255 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 280 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 281 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 294 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 295 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 297 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 298 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 299 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 300 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 301 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 302 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 304 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 310 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 311 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 312 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 313 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 315 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 316 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 317 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 318 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 320 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 321 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 322 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 323 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 324 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 325 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 326 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 327 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 328 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 329 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 330 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 331 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 332 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 333 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 334 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 335 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 336 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 337 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 338 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 339 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 340 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 341 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 342 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 343 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 344 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 345 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 346 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 347 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 348 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 349 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 350 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 351 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 352 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 353 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 354 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 355 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 356 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 357 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 358 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 359 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 360 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 361 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 362 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 363 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 364 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 365 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 366 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 367 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 368 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 369 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 370 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 371 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 372 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 373 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 374 | 2791355199 | |||
| 375 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 376 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 377 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 378 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 379 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 380 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 381 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 382 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 383 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 384 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 385 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 386 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 387 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 388 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 389 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 390 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 391 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 392 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 393 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 394 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 395 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 396 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 397 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 398 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 399 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 400 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 401 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 402 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 403 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 404 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 405 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 406 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 407 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 408 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 409 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 410 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 411 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 412 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 413 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 414 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 415 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 416 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 417 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 418 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 419 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 420 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 421 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 422 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 423 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 424 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 425 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 426 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 427 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 428 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 429 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 430 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 431 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 432 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 433 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 434 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 435 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 436 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 437 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 438 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 439 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 440 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 441 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 442 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 443 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 444 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 445 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 446 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 447 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 448 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 449 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 450 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 451 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 452 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 453 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 454 | 2904699407 | |||
| 455 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 456 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 457 | 2906610324 | |||
| 458 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 459 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 460 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 461 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 462 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 463 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 464 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 465 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 466 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 467 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 468 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 469 | 2922368715 | |||
| 470 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 471 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 472 | 2922425934 | |||
| 473 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 474 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 475 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 476 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 477 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 478 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 479 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 480 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 481 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 482 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 483 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 484 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 485 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 486 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 487 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 488 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 489 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 490 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 491 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 492 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 493 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 494 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 495 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 496 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 497 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 498 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 499 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 500 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 501 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 502 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 503 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 504 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 505 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 506 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 507 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 508 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 509 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 510 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 511 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 512 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 513 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 514 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 515 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 516 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 517 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 518 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 519 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 520 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 521 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 522 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 523 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 524 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 525 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 526 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 527 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 528 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 529 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 530 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 531 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 532 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 533 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 534 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 535 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 536 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 537 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 538 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 539 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 540 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 541 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 542 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 543 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 544 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 545 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 546 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 547 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 548 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 549 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 550 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 551 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 552 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 553 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 554 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 555 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 556 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 557 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 558 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 559 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 560 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 561 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 562 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 563 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 564 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 565 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 566 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 567 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 568 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 569 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 570 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 571 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 572 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 573 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 574 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 575 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 576 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 577 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 578 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 579 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 580 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 581 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 582 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 583 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 584 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.37 |
| Metatranscriptomes | 0.12 |
| Isolates | 30.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.84 |
| Nodule | 22.61 |
| Rhizoplane | 4.43 |
| Rhizosphere | 47.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496104_0000275 | 3300048907 | Bacteria | 45789 |
| 2 | JGI24737J22298_10004391 | 3300001990 | Bacteria | 4919 |
| 3 | JGI25151J46595_10000114 | 3300003187 | Bacteria | 107534 |
| 4 | JGI25151J46595_10000345 | 3300003187 | Bacteria | 49779 |
| 5 | JGI25406J46586_10000104 | 3300003203 | Bacteria | 37774 |
| 6 | JGI25406J46586_10001599 | 3300003203 | Bacteria | 10686 |
| 7 | JGI25165J46597_1002951 | 3300003214 | Bacteria | 4752 |
| 8 | JGI25153J46596_10001106 | 3300003215 | Bacteria | 16363 |
| 9 | JGI25160J50197_1009619 | 3300003354 | Bacteria | 3567 |
| 10 | Ga0055526_1000395 | 3300003771 | Bacteria | 35228 |
| 11 | Ga0055526_1001058 | 3300003771 | Bacteria | 20113 |
| 12 | Ga0055524_1000020 | 3300003775 | Bacteria | 227971 |
| 13 | Ga0065165_1000240 | 3300005262 | Bacteria | 93895 |
| 14 | Ga0065165_1001349 | 3300005262 | Bacteria | 27140 |
| 15 | Ga0065165_1001593 | 3300005262 | Bacteria | 23304 |
| 16 | Ga0070676_10005386 | 3300005328 | Bacteria | 6816 |
| 17 | Ga0070666_10012047 | 3300005335 | Bacteria | 5444 |
| 18 | Ga0070680_100081740 | 3300005336 | Bacteria | 2666 |
| 19 | Ga0070682_100007542 | 3300005337 | Bacteria | 6131 |
| 20 | Ga0068868_100007248 | 3300005338 | Bacteria | 7885 |
| 21 | Ga0070691_10008708 | 3300005341 | Bacteria | 4645 |
| 22 | Ga0070668_100014987 | 3300005347 | Bacteria | 5791 |
| 23 | Ga0070669_100003763 | 3300005353 | Bacteria | 10957 |
| 24 | Ga0070671_100076617 | 3300005355 | Bacteria | 2794 |
| 25 | Ga0070659_100022039 | 3300005366 | Bacteria | 4861 |
| 26 | Ga0070659_100088124 | 3300005366 | Bacteria | 2485 |
| 27 | Ga0070709_10002085 | 3300005434 | Bacteria | 10828 |
| 28 | Ga0070710_10000842 | 3300005437 | Bacteria | 14763 |
| 29 | Ga0070711_100046378 | 3300005439 | Bacteria | 2961 |
| 30 | Ga0070705_100001270 | 3300005440 | Bacteria | 13596 |
| 31 | Ga0070694_100002981 | 3300005444 | Bacteria | 10062 |
| 32 | Ga0070694_100052535 | 3300005444 | Bacteria | 2755 |
| 33 | Ga0070678_100033408 | 3300005456 | Bacteria | 3571 |
| 34 | Ga0070699_100000313 | 3300005518 | Bacteria | 46877 |
| 35 | Ga0070679_100036158 | 3300005530 | Bacteria | 4900 |
| 36 | Ga0068853_100003443 | 3300005539 | Bacteria | 12106 |
| 37 | Ga0070695_100001796 | 3300005545 | Bacteria | 12091 |
| 38 | Ga0070696_100000471 | 3300005546 | Bacteria | 25273 |
| 39 | Ga0070704_100012520 | 3300005549 | Bacteria | 5239 |
| 40 | Ga0068855_100025861 | 3300005563 | Bacteria | 7019 |
| 41 | Ga0068857_100005529 | 3300005577 | Bacteria | 10781 |
| 42 | Ga0068857_100005939 | 3300005577 | Bacteria | 10426 |
| 43 | Ga0068857_100034904 | 3300005577 | Bacteria | 4450 |
| 44 | Ga0068856_100000082 | 3300005614 | Bacteria | 88302 |
| 45 | Ga0068856_100041732 | 3300005614 | Bacteria | 4510 |
| 46 | Ga0068852_100034172 | 3300005616 | Bacteria | 4228 |
| 47 | Ga0068852_100048627 | 3300005616 | Bacteria | 3624 |
| 48 | Ga0068859_100096721 | 3300005617 | Bacteria | 3005 |
| 49 | Ga0068864_100125527 | 3300005618 | Bacteria | 2299 |
| 50 | Ga0068861_100032708 | 3300005719 | Bacteria | 3832 |
| 51 | Ga0068851_10001427 | 3300005834 | Bacteria | 10459 |
| 52 | Ga0068851_10002938 | 3300005834 | Bacteria | 7531 |
| 53 | Ga0068851_10003776 | 3300005834 | Bacteria | 6774 |
| 54 | Ga0068858_100027234 | 3300005842 | Bacteria | 5311 |
| 55 | Ga0068860_100000316 | 3300005843 | Bacteria | 65709 |
| 56 | Ga0068860_100013358 | 3300005843 | Bacteria | 8050 |
| 57 | Ga0081455_10000194 | 3300005937 | Bacteria | 77128 |
| 58 | Ga0081455_10002419 | 3300005937 | Bacteria | 22263 |
| 59 | Ga0081455_10002827 | 3300005937 | Bacteria | 20442 |
| 60 | Ga0081455_10003658 | 3300005937 | Bacteria | 17616 |
| 61 | Ga0081455_10081964 | 3300005937 | Bacteria | 2640 |
| 62 | Ga0081538_10012272 | 3300005981 | Bacteria | 6878 |
| 63 | Ga0081540_1000032 | 3300005983 | Bacteria | 144522 |
| 64 | Ga0081540_1002092 | 3300005983 | Bacteria | 16629 |
| 65 | Ga0081540_1006870 | 3300005983 | Bacteria | 8212 |
| 66 | Ga0081540_1016557 | 3300005983 | Bacteria | 4606 |
| 67 | Ga0081540_1028208 | 3300005983 | Bacteria | 3159 |
| 68 | Ga0081539_10000273 | 3300005985 | Bacteria | 117936 |
| 69 | Ga0081539_10000735 | 3300005985 | Bacteria | 65597 |
| 70 | Ga0081539_10018005 | 3300005985 | Bacteria | 4927 |
| 71 | Ga0081539_10036063 | 3300005985 | Bacteria | 2964 |
| 72 | Ga0081539_10039885 | 3300005985 | Bacteria | 2765 |
| 73 | Ga0070717_10000729 | 3300006028 | Bacteria | 21406 |
| 74 | Ga0070717_10004095 | 3300006028 | Bacteria | 10520 |
| 75 | Ga0075365_10024876 | 3300006038 | Bacteria | 3784 |
| 76 | Ga0075365_10027613 | 3300006038 | Bacteria | 3613 |
| 77 | Ga0075363_100001173 | 3300006048 | Bacteria | 9629 |
| 78 | Ga0070716_100009239 | 3300006173 | Bacteria | 4913 |
| 79 | Ga0075367_10010285 | 3300006178 | Bacteria | 4911 |
| 80 | Ga0075367_10010355 | 3300006178 | Bacteria | 4897 |
| 81 | Ga0075367_10030943 | 3300006178 | Bacteria | 3072 |
| 82 | Ga0075370_10033054 | 3300006353 | Bacteria | 2894 |
| 83 | Ga0075430_100004577 | 3300006846 | Bacteria | 11640 |
| 84 | Ga0075430_100071354 | 3300006846 | Bacteria | 2913 |
| 85 | Ga0075431_100001890 | 3300006847 | Bacteria | 19851 |
| 86 | Ga0075431_100038293 | 3300006847 | Bacteria | 4937 |
| 87 | Ga0075431_100136956 | 3300006847 | Bacteria | 2524 |
| 88 | Ga0075433_10126425 | 3300006852 | Bacteria | 2270 |
| 89 | Ga0075434_100034833 | 3300006871 | Bacteria | 4974 |
| 90 | Ga0075434_100039736 | 3300006871 | Bacteria | 4660 |
| 91 | Ga0075434_100043875 | 3300006871 | Bacteria | 4435 |
| 92 | Ga0097620_100096717 | 3300006931 | Bacteria | 3005 |
| 93 | Ga0099825_1028727 | 3300006941 | Bacteria | 2669 |
| 94 | Ga0099824_1022420 | 3300006942 | Bacteria | 4169 |
| 95 | Ga0099822_1017281 | 3300006943 | Bacteria | 7741 |
| 96 | Ga0099823_1008783 | 3300006944 | Bacteria | 10273 |
| 97 | Ga0075435_100003830 | 3300007076 | Bacteria | 10261 |
| 98 | Ga0105240_10007507 | 3300009093 | Bacteria | 15822 |
| 99 | Ga0105240_10010434 | 3300009093 | Bacteria | 13050 |
| 100 | Ga0105240_10012340 | 3300009093 | Bacteria | 11801 |
| 101 | Ga0111539_10104371 | 3300009094 | Bacteria | 3325 |
| 102 | Ga0105245_10018726 | 3300009098 | Bacteria | 6057 |
| 103 | Ga0105247_10027479 | 3300009101 | Bacteria | 3440 |
| 104 | Ga0114129_10047185 | 3300009147 | Bacteria | 6054 |
| 105 | Ga0114129_10136930 | 3300009147 | Bacteria | 3359 |
| 106 | Ga0114129_10239133 | 3300009147 | Bacteria | 2441 |
| 107 | Ga0105243_10088601 | 3300009148 | Bacteria | 2543 |
| 108 | Ga0105237_10040828 | 3300009545 | Bacteria | 4679 |
| 109 | Ga0105237_10132437 | 3300009545 | Bacteria | 2487 |
| 110 | Ga0105238_10001837 | 3300009551 | Bacteria | 21282 |
| 111 | Ga0105238_10047470 | 3300009551 | Bacteria | 4329 |
| 112 | Ga0105238_10048472 | 3300009551 | Bacteria | 4281 |
| 113 | Ga0105238_10077428 | 3300009551 | Bacteria | 3317 |
| 114 | Ga0105249_10096671 | 3300009553 | Bacteria | 2772 |
| 115 | Ga0105239_10115636 | 3300010375 | Bacteria | 2976 |
| 116 | Ga0105239_10143534 | 3300010375 | Bacteria | 2661 |
| 117 | Ga0105239_10156886 | 3300010375 | Bacteria | 2542 |
| 118 | Ga0157369_10019813 | 3300013105 | Bacteria | 7528 |
| 119 | Ga0157369_10078362 | 3300013105 | Bacteria | 3540 |
| 120 | Ga0171462_1022 | 3300013250 | Bacteria | 141292 |
| 121 | Ga0157374_10021003 | 3300013296 | Bacteria | 5802 |
| 122 | Ga0157374_10088980 | 3300013296 | Bacteria | 2941 |
| 123 | Ga0163162_10037819 | 3300013306 | Bacteria | 4816 |
| 124 | Ga0163162_10157383 | 3300013306 | Bacteria | 2392 |
| 125 | Ga0157372_10024593 | 3300013307 | Bacteria | 6545 |
| 126 | Ga0157375_10012645 | 3300013308 | Bacteria | 7490 |
| 127 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 128 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 129 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 130 | Ga0214545_1029110 | 3300021324 | Bacteria | 2536 |
| 131 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 132 | Ga0213874_10002243 | 3300021377 | Bacteria | 4118 |
| 133 | Ga0213876_10001406 | 3300021384 | Bacteria | 14999 |
| 134 | Ga0213876_10057034 | 3300021384 | Bacteria | 2062 |
| 135 | Ga0213871_10004850 | 3300021441 | Bacteria | 2727 |
| 136 | Ga0207427_101831 | 3300025231 | Bacteria | 6780 |
| 137 | Ga0209677_100507 | 3300025253 | Bacteria | 21817 |
| 138 | Ga0209148_1000289 | 3300025254 | Bacteria | 75390 |
| 139 | Ga0209233_1002026 | 3300025261 | Bacteria | 7675 |
| 140 | Ga0209455_1003622 | 3300025272 | Bacteria | 5375 |
| 141 | Ga0209673_1021481 | 3300025273 | Bacteria | 2256 |
| 142 | Ga0209130_1000061 | 3300025284 | Bacteria | 200990 |
| 143 | Ga0209675_1001320 | 3300025291 | Bacteria | 14713 |
| 144 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 145 | Ga0209025_1001935 | 3300025294 | Bacteria | 23940 |
| 146 | Ga0209025_1015731 | 3300025294 | Bacteria | 4532 |
| 147 | Ga0209564_1000049 | 3300025295 | Bacteria | 362075 |
| 148 | Ga0209564_1000054 | 3300025295 | Bacteria | 350653 |
| 149 | Ga0209758_1000160 | 3300025297 | Bacteria | 154304 |
| 150 | Ga0209758_1000219 | 3300025297 | Bacteria | 124186 |
| 151 | Ga0209758_1007950 | 3300025297 | Bacteria | 7030 |
| 152 | Ga0209758_1016520 | 3300025297 | Bacteria | 3743 |
| 153 | Ga0209758_1027905 | 3300025297 | Bacteria | 2402 |
| 154 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 155 | Ga0209256_1003910 | 3300025299 | Bacteria | 9850 |
| 156 | Ga0207426_1000705 | 3300025302 | Bacteria | 39483 |
| 157 | Ga0207426_1000986 | 3300025302 | Bacteria | 27952 |
| 158 | Ga0207426_1004854 | 3300025302 | Bacteria | 6370 |
| 159 | Ga0207656_10001566 | 3300025321 | Bacteria | 7600 |
| 160 | Ga0207656_10003271 | 3300025321 | Bacteria | 5548 |
| 161 | Ga0207653_10002045 | 3300025885 | Bacteria | 6427 |
| 162 | Ga0207692_10000244 | 3300025898 | Bacteria | 18518 |
| 163 | Ga0207692_10000420 | 3300025898 | Bacteria | 14869 |
| 164 | Ga0207647_10015806 | 3300025904 | Bacteria | 5165 |
| 165 | Ga0207699_10002274 | 3300025906 | Bacteria | 9062 |
| 166 | Ga0207699_10007307 | 3300025906 | Bacteria | 5397 |
| 167 | Ga0207699_10009196 | 3300025906 | Bacteria | 4909 |
| 168 | Ga0207643_10039285 | 3300025908 | Bacteria | 2662 |
| 169 | Ga0207654_10004487 | 3300025911 | Bacteria | 7047 |
| 170 | Ga0207707_10002881 | 3300025912 | Bacteria | 15359 |
| 171 | Ga0207707_10090385 | 3300025912 | Bacteria | 2676 |
| 172 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 173 | Ga0207695_10004042 | 3300025913 | Bacteria | 20184 |
| 174 | Ga0207695_10021791 | 3300025913 | Bacteria | 7299 |
| 175 | Ga0207695_10191664 | 3300025913 | Bacteria | 1962 |
| 176 | Ga0207671_10011502 | 3300025914 | Bacteria | 7192 |
| 177 | Ga0207693_10000095 | 3300025915 | Bacteria | 78764 |
| 178 | Ga0207693_10024287 | 3300025915 | Bacteria | 4812 |
| 179 | Ga0207663_10057945 | 3300025916 | Bacteria | 2443 |
| 180 | Ga0207660_10026805 | 3300025917 | Bacteria | 3927 |
| 181 | Ga0207657_10007732 | 3300025919 | Bacteria | 10976 |
| 182 | Ga0207649_10001722 | 3300025920 | Bacteria | 12581 |
| 183 | Ga0207652_10133466 | 3300025921 | Bacteria | 2216 |
| 184 | Ga0207694_10000082 | 3300025924 | Bacteria | 109787 |
| 185 | Ga0207694_10012755 | 3300025924 | Bacteria | 6332 |
| 186 | Ga0207664_10008276 | 3300025929 | Bacteria | 7245 |
| 187 | Ga0207664_10063181 | 3300025929 | Bacteria | 2959 |
| 188 | Ga0207706_10157034 | 3300025933 | Bacteria | 2000 |
| 189 | Ga0207665_10000133 | 3300025939 | Bacteria | 49199 |
| 190 | Ga0207665_10018020 | 3300025939 | Bacteria | 4639 |
| 191 | Ga0207661_10001725 | 3300025944 | Bacteria | 14953 |
| 192 | Ga0207667_10006555 | 3300025949 | Bacteria | 14082 |
| 193 | Ga0207667_10023099 | 3300025949 | Bacteria | 6851 |
| 194 | Ga0207667_10051742 | 3300025949 | Bacteria | 4328 |
| 195 | Ga0207640_10003022 | 3300025981 | Bacteria | 9049 |
| 196 | Ga0207678_10060660 | 3300026067 | Bacteria | 3253 |
| 197 | Ga0207678_10133251 | 3300026067 | Bacteria | 2120 |
| 198 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 199 | Ga0207702_10000048 | 3300026078 | Bacteria | 143125 |
| 200 | Ga0207676_10115078 | 3300026095 | Bacteria | 2257 |
| 201 | Ga0207674_10001889 | 3300026116 | Bacteria | 26658 |
| 202 | Ga0207674_10002361 | 3300026116 | Bacteria | 23864 |
| 203 | Ga0207674_10042826 | 3300026116 | Bacteria | 4672 |
| 204 | Ga0207683_10140204 | 3300026121 | Bacteria | 2178 |
| 205 | Ga0207698_10052853 | 3300026142 | Bacteria | 3114 |
| 206 | Ga0209389_1000008 | 3300027296 | Bacteria | 227385 |
| 207 | Ga0209389_1000081 | 3300027296 | Bacteria | 89601 |
| 208 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 209 | Ga0209589_1000091 | 3300027357 | Bacteria | 89601 |
| 210 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 211 | Ga0209489_100096 | 3300027361 | Bacteria | 122075 |
| 212 | Ga0209489_100333 | 3300027361 | Bacteria | 82975 |
| 213 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 214 | Ga0209700_100062 | 3300027363 | Bacteria | 145471 |
| 215 | Ga0209588_1004092 | 3300027671 | Bacteria | 4087 |
| 216 | Ga0209813_10000356 | 3300027866 | Bacteria | 11659 |
| 217 | Ga0209813_10003767 | 3300027866 | Bacteria | 3576 |
| 218 | Ga0207428_10062905 | 3300027907 | Bacteria | 2933 |
| 219 | Ga0268266_10003536 | 3300028379 | Bacteria | 15508 |
| 220 | Ga0268266_10008761 | 3300028379 | Bacteria | 8966 |
| 221 | Ga0268266_10019220 | 3300028379 | Bacteria | 5818 |
| 222 | Ga0268265_10000550 | 3300028380 | Bacteria | 38199 |
| 223 | Ga0268264_10000430 | 3300028381 | Bacteria | 58144 |
| 224 | Ga0268264_10005052 | 3300028381 | Bacteria | 11170 |
| 225 | Ga0265319_1002587 | 3300028563 | Bacteria | 9756 |
| 226 | Ga0265336_10000474 | 3300028666 | Bacteria | 23860 |
| 227 | Ga0307517_10001000 | 3300028786 | Bacteria | 47916 |
| 228 | Ga0307515_10000070 | 3300028794 | Bacteria | 239322 |
| 229 | Ga0307515_10029530 | 3300028794 | Bacteria | 9260 |
| 230 | Ga0307515_10068290 | 3300028794 | Bacteria | 4885 |
| 231 | Ga0265338_10000086 | 3300028800 | Bacteria | 175026 |
| 232 | Ga0265330_10032435 | 3300031235 | Bacteria | 2340 |
| 233 | Ga0265325_10009592 | 3300031241 | Bacteria | 5651 |
| 234 | Ga0265340_10001336 | 3300031247 | Bacteria | 14132 |
| 235 | Ga0265339_10000418 | 3300031249 | Bacteria | 33621 |
| 236 | Ga0307513_10015483 | 3300031456 | Bacteria | 9245 |
| 237 | Ga0307513_10062401 | 3300031456 | Bacteria | 3939 |
| 238 | Ga0307509_10133747 | 3300031507 | Bacteria | 2430 |
| 239 | Ga0265313_10000154 | 3300031595 | Bacteria | 71077 |
| 240 | Ga0307508_10000009 | 3300031616 | Bacteria | 256966 |
| 241 | Ga0316575_10004011 | 3300031665 | Bacteria | 5156 |
| 242 | Ga0265314_10017894 | 3300031711 | Bacteria | 5548 |
| 243 | Ga0316576_10015722 | 3300031727 | Bacteria | 5086 |
| 244 | Ga0316576_10033406 | 3300031727 | Bacteria | 3662 |
| 245 | Ga0307516_10006964 | 3300031730 | Bacteria | 13112 |
| 246 | Ga0307516_10030994 | 3300031730 | Bacteria | 5393 |
| 247 | Ga0307409_100107547 | 3300031995 | Bacteria | 2330 |
| 248 | Ga0307414_10026840 | 3300032004 | Bacteria | 3711 |
| 249 | Ga0316583_10011778 | 3300032133 | Bacteria | 3155 |
| 250 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 251 | Ga0373934_0003946 | 3300035086 | Bacteria | 5455 |
| 252 | Ga0373923_0011642 | 3300035111 | Bacteria | 3234 |
| 253 | Ga0373923_0023401 | 3300035111 | Bacteria | 2430 |
| 254 | Ga0373953_0000473 | 3300035117 | Bacteria | 11091 |
| 255 | Ga0373953_0001627 | 3300035117 | Bacteria | 6576 |
| 256 | Ga0373954_0000442 | 3300035118 | Bacteria | 15520 |
| 257 | Ga0373956_0006981 | 3300035119 | Bacteria | 4540 |
| 258 | Ga0373956_0014148 | 3300035119 | Bacteria | 3328 |
| 259 | Ga0373957_0012131 | 3300035120 | Bacteria | 2893 |
| 260 | Ga0373943_0003057 | 3300035170 | Bacteria | 7600 |
| 261 | Ga0373955_0000840 | 3300035172 | Bacteria | 13157 |
| 262 | Ga0373955_0006897 | 3300035172 | Bacteria | 5193 |
| 263 | Ga0373962_0002428 | 3300035242 | Bacteria | 4433 |
| 264 | Ga0373931_0004195 | 3300035691 | Bacteria | 6562 |
| 265 | Ga0373931_0019032 | 3300035691 | Bacteria | 3423 |
| 266 | Ga0373935_0001167 | 3300035692 | Bacteria | 14418 |
| 267 | Ga0373935_0035945 | 3300035692 | Bacteria | 3094 |
| 268 | Ga0373933_0000041 | 3300035724 | Bacteria | 79805 |
| 269 | Ga0373933_0000563 | 3300035724 | Bacteria | 23152 |
| 270 | Ga0373933_0002868 | 3300035724 | Bacteria | 9630 |
| 271 | Ga0373937_0002003 | 3300036401 | Bacteria | 17035 |
| 272 | Ga0373937_0014572 | 3300036401 | Bacteria | 6943 |
| 273 | Ga0373937_0018505 | 3300036401 | Bacteria | 6222 |
| 274 | Ga0373937_0046509 | 3300036401 | Bacteria | 3969 |
| 275 | Ga0372808_004186 | 3300036459 | Bacteria | 1824 |
| 276 | Ga0316582_0014990 | 3300036647 | Bacteria | 4417 |
| 277 | Ga0316584_0003478 | 3300036712 | Bacteria | 10245 |
| 278 | Ga0373925_0004654 | 3300037068 | Bacteria | 10358 |
| 279 | Ga0373925_0028798 | 3300037068 | Bacteria | 4072 |
| 280 | Ga0373925_0050715 | 3300037068 | Bacteria | 3096 |
| 281 | Ga0395899_0108442 | 3300037312 | Bacteria | 1998 |
| 282 | Ga0395900_0001685 | 3300037418 | Bacteria | 25715 |
| 283 | Ga0395900_0033546 | 3300037418 | Bacteria | 5282 |
| 284 | Ga0395900_0037966 | 3300037418 | Bacteria | 4966 |
| 285 | Ga0395898_0010109 | 3300037466 | Bacteria | 9876 |
| 286 | Ga0395905_0007972 | 3300037471 | Bacteria | 10471 |
| 287 | Ga0395905_0012612 | 3300037471 | Bacteria | 8130 |
| 288 | Ga0395905_0024541 | 3300037471 | Bacteria | 5689 |
| 289 | Ga0316581_0002606 | 3300037588 | Bacteria | 4347 |
| 290 | Ga0436364_0138611 | 3300037853 | Bacteria | 21368 |
| 291 | Ga0436364_0485287 | 3300037853 | Bacteria | 2011 |
| 292 | Ga0395901_0004712 | 3300038443 | Bacteria | 13766 |
| 293 | Ga0395901_0030320 | 3300038443 | Bacteria | 5572 |
| 294 | Ga0436365_0286964 | 3300039437 | Bacteria | 64806 |
| 295 | Ga0436365_1628681 | 3300039437 | Bacteria | 6564 |
| 296 | Ga0436365_1651055 | 3300039437 | Bacteria | 2075 |
| 297 | Ga0436361_0915560 | 3300039447 | Bacteria | 1891 |
| 298 | Ga0436363_1213338 | 3300039450 | Bacteria | 3256 |
| 299 | Ga0436363_1572654 | 3300039450 | Bacteria | 24478 |
| 300 | Ga0436362_0566207 | 3300039453 | Bacteria | 11383 |
| 301 | Ga0466972_0000216 | 3300044658 | Bacteria | 40702 |
| 302 | Ga0466966_0000495 | 3300044684 | Bacteria | 25298 |
| 303 | Ga0466961_0000937 | 3300044693 | Bacteria | 18072 |
| 304 | Ga0466963_0020140 | 3300044694 | Bacteria | 4193 |
| 305 | Ga0466957_0041929 | 3300044842 | Bacteria | 2768 |
| 306 | Ga0466960_0007789 | 3300044901 | Bacteria | 4367 |
| 307 | Ga0466959_0018432 | 3300045049 | Bacteria | 5124 |
| 308 | Ga0466967_0017095 | 3300045976 | Bacteria | 5745 |
| 309 | Ga0495592_0005090 | 3300046454 | Bacteria | 9683 |
| 310 | Ga0495592_0018842 | 3300046454 | Bacteria | 5256 |
| 311 | Ga0495592_0022433 | 3300046454 | Bacteria | 4804 |
| 312 | Ga0495603_0000329 | 3300046455 | Bacteria | 25682 |
| 313 | Ga0495603_0005330 | 3300046455 | Bacteria | 7670 |
| 314 | Ga0495629_0000355 | 3300046459 | Bacteria | 39013 |
| 315 | Ga0495629_0008864 | 3300046459 | Bacteria | 7396 |
| 316 | Ga0495629_0011318 | 3300046459 | Bacteria | 6481 |
| 317 | Ga0495629_0034923 | 3300046459 | Bacteria | 3554 |
| 318 | Ga0495629_0036301 | 3300046459 | Bacteria | 3480 |
| 319 | Ga0495651_0000265 | 3300046462 | Bacteria | 40572 |
| 320 | Ga0495651_0002687 | 3300046462 | Bacteria | 13795 |
| 321 | Ga0495651_0015524 | 3300046462 | Bacteria | 5892 |
| 322 | Ga0495651_0029989 | 3300046462 | Bacteria | 4241 |
| 323 | Ga0495651_0043715 | 3300046462 | Bacteria | 3474 |
| 324 | Ga0495653_0037314 | 3300046463 | Bacteria | 3819 |
| 325 | Ga0495653_0039788 | 3300046463 | Bacteria | 3680 |
| 326 | Ga0495582_0005216 | 3300046473 | Bacteria | 7270 |
| 327 | Ga0495582_0013187 | 3300046473 | Bacteria | 4548 |
| 328 | Ga0495639_0000061 | 3300046475 | Bacteria | 48670 |
| 329 | Ga0495662_0000437 | 3300046476 | Bacteria | 18723 |
| 330 | Ga0495664_0008477 | 3300046477 | Bacteria | 5736 |
| 331 | Ga0495664_0011752 | 3300046477 | Bacteria | 4943 |
| 332 | Ga0495664_0020019 | 3300046477 | Bacteria | 3855 |
| 333 | Ga0495594_0002652 | 3300046499 | Bacteria | 9308 |
| 334 | Ga0495606_0005142 | 3300046507 | Bacteria | 12689 |
| 335 | Ga0495608_0000435 | 3300046511 | Bacteria | 29113 |
| 336 | Ga0495608_0005163 | 3300046511 | Bacteria | 9327 |
| 337 | Ga0495608_0009473 | 3300046511 | Bacteria | 6804 |
| 338 | Ga0495608_0045193 | 3300046511 | Bacteria | 2937 |
| 339 | Ga0495616_0022794 | 3300046513 | Bacteria | 3377 |
| 340 | Ga0495628_0018503 | 3300046516 | Bacteria | 5768 |
| 341 | Ga0495628_0021620 | 3300046516 | Bacteria | 5290 |
| 342 | Ga0495628_0048492 | 3300046516 | Bacteria | 3366 |
| 343 | Ga0495648_0002320 | 3300046524 | Bacteria | 17720 |
| 344 | Ga0495648_0014791 | 3300046524 | Bacteria | 5686 |
| 345 | Ga0495652_0001766 | 3300046529 | Bacteria | 23183 |
| 346 | Ga0495652_0002339 | 3300046529 | Bacteria | 19668 |
| 347 | Ga0495652_0024014 | 3300046529 | Bacteria | 5400 |
| 348 | Ga0495652_0038161 | 3300046529 | Bacteria | 4163 |
| 349 | Ga0495654_0008815 | 3300046530 | Bacteria | 5550 |
| 350 | Ga0495665_0000414 | 3300046531 | Bacteria | 21734 |
| 351 | Ga0495640_0000826 | 3300046533 | Bacteria | 23573 |
| 352 | Ga0495640_0007059 | 3300046533 | Bacteria | 8841 |
| 353 | Ga0495640_0009783 | 3300046533 | Bacteria | 7449 |
| 354 | Ga0495640_0020350 | 3300046533 | Bacteria | 4886 |
| 355 | Ga0495640_0027153 | 3300046533 | Bacteria | 4132 |
| 356 | Ga0495586_0038836 | 3300046535 | Bacteria | 2559 |
| 357 | Ga0495587_0002595 | 3300046536 | Bacteria | 12066 |
| 358 | Ga0495587_0007158 | 3300046536 | Bacteria | 7239 |
| 359 | Ga0495587_0010142 | 3300046536 | Bacteria | 6009 |
| 360 | Ga0495587_0073069 | 3300046536 | Bacteria | 1993 |
| 361 | Ga0495645_0007922 | 3300046543 | Bacteria | 7393 |
| 362 | Ga0495645_0011015 | 3300046543 | Bacteria | 6354 |
| 363 | Ga0495645_0047289 | 3300046543 | Bacteria | 3135 |
| 364 | Ga0495667_0000817 | 3300046559 | Bacteria | 20052 |
| 365 | Ga0495667_0001528 | 3300046559 | Bacteria | 15306 |
| 366 | Ga0495667_0013389 | 3300046559 | Bacteria | 5552 |
| 367 | Ga0495668_0025684 | 3300046616 | Bacteria | 3345 |
| 368 | Ga0495634_0000762 | 3300046642 | Bacteria | 31177 |
| 369 | Ga0495634_0002573 | 3300046642 | Bacteria | 14976 |
| 370 | Ga0495634_0008744 | 3300046642 | Bacteria | 7506 |
| 371 | Ga0495625_0039677 | 3300046660 | Bacteria | 3437 |
| 372 | Ga0495635_0000187 | 3300046663 | Bacteria | 39002 |
| 373 | Ga0495635_0001091 | 3300046663 | Bacteria | 18022 |
| 374 | Ga0495657_0020860 | 3300046675 | Bacteria | 4709 |
| 375 | Ga0495599_0015434 | 3300046678 | Bacteria | 4740 |
| 376 | Ga0495599_0020518 | 3300046678 | Bacteria | 4115 |
| 377 | Ga0495623_0005149 | 3300046679 | Bacteria | 8581 |
| 378 | Ga0495623_0025428 | 3300046679 | Bacteria | 3814 |
| 379 | Ga0495623_0028344 | 3300046679 | Bacteria | 3602 |
| 380 | Ga0495646_0005680 | 3300046680 | Bacteria | 7901 |
| 381 | Ga0495646_0013741 | 3300046680 | Bacteria | 5147 |
| 382 | Ga0495646_0018205 | 3300046680 | Bacteria | 4448 |
| 383 | Ga0495646_0022600 | 3300046680 | Bacteria | 3966 |
| 384 | Ga0495658_0000047 | 3300046683 | Bacteria | 59626 |
| 385 | Ga0495658_0016600 | 3300046683 | Bacteria | 3790 |
| 386 | Ga0495613_0002415 | 3300046689 | Bacteria | 14130 |
| 387 | Ga0495624_0000188 | 3300046690 | Bacteria | 46706 |
| 388 | Ga0495670_0034645 | 3300046691 | Bacteria | 2515 |
| 389 | Ga0495600_0005291 | 3300046809 | Bacteria | 7775 |
| 390 | Ga0495600_0013208 | 3300046809 | Bacteria | 5184 |
| 391 | Ga0495600_0059430 | 3300046809 | Bacteria | 2497 |
| 392 | Ga0495581_0000705 | 3300047315 | Bacteria | 17570 |
| 393 | Ga0495604_0000118 | 3300047317 | Bacteria | 66698 |
| 394 | Ga0495604_0008523 | 3300047317 | Bacteria | 8095 |
| 395 | Ga0495604_0031356 | 3300047317 | Bacteria | 4215 |
| 396 | Ga0495674_0001402 | 3300047319 | Bacteria | 23571 |
| 397 | Ga0495674_0002109 | 3300047319 | Bacteria | 19517 |
| 398 | Ga0495674_0011338 | 3300047319 | Bacteria | 8415 |
| 399 | Ga0495674_0039692 | 3300047319 | Bacteria | 4217 |
| 400 | Ga0495674_0127720 | 3300047319 | Bacteria | 2144 |
| 401 | Ga0495680_0005405 | 3300047322 | Bacteria | 12029 |
| 402 | Ga0495680_0006280 | 3300047322 | Bacteria | 11069 |
| 403 | Ga0495680_0006879 | 3300047322 | Bacteria | 10499 |
| 404 | Ga0495675_0001383 | 3300047444 | Bacteria | 14711 |
| 405 | Ga0495675_0023118 | 3300047444 | Bacteria | 3961 |
| 406 | Ga0495684_0001482 | 3300047471 | Bacteria | 18783 |
| 407 | Ga0495684_0036877 | 3300047471 | Bacteria | 3748 |
| 408 | Ga0495684_0042883 | 3300047471 | Bacteria | 3464 |
| 409 | Ga0495684_0043497 | 3300047471 | Bacteria | 3439 |
| 410 | Ga0495684_0100156 | 3300047471 | Bacteria | 2191 |
| 411 | Ga0495593_0000616 | 3300047673 | Bacteria | 20328 |
| 412 | Ga0495593_0005166 | 3300047673 | Bacteria | 7717 |
| 413 | Ga0495602_0006478 | 3300048088 | Bacteria | 12283 |
| 414 | Ga0495602_0021287 | 3300048088 | Bacteria | 6388 |
| 415 | Ga0495602_0052016 | 3300048088 | Bacteria | 3642 |
| 416 | Ga0496102_0005226 | 3300048905 | Bacteria | 11023 |
| 417 | Ga0496102_0015089 | 3300048905 | Bacteria | 6726 |
| 418 | Ga0496102_0098128 | 3300048905 | Bacteria | 2718 |
| 419 | Ga0496104_0016718 | 3300048907 | Bacteria | 6669 |
| 420 | Ga0496104_0053795 | 3300048907 | Bacteria | 3805 |
| 421 | Ga0496104_0133984 | 3300048907 | Bacteria | 2380 |
| 422 | Ga0496105_0004479 | 3300048908 | Bacteria | 10516 |
| 423 | Ga0496105_0035771 | 3300048908 | Bacteria | 4089 |
| 424 | Ga0496105_0039509 | 3300048908 | Bacteria | 3889 |
| 425 | Ga0496106_0000477 | 3300048909 | Bacteria | 28442 |
| 426 | Ga0496106_0001639 | 3300048909 | Bacteria | 16799 |
| 427 | Ga0496106_0005089 | 3300048909 | Bacteria | 9734 |
| 428 | Ga0496106_0023152 | 3300048909 | Bacteria | 4614 |
| 429 | Ga0496106_0024067 | 3300048909 | Bacteria | 4527 |
| 430 | Ga0496107_0002282 | 3300048910 | Bacteria | 12380 |
| 431 | Ga0496107_0003815 | 3300048910 | Bacteria | 10124 |
| 432 | Ga0496107_0005766 | 3300048910 | Bacteria | 8472 |
| 433 | Ga0496107_0010725 | 3300048910 | Bacteria | 6374 |
| 434 | Ga0496108_0004243 | 3300048911 | Bacteria | 11544 |
| 435 | Ga0496108_0004668 | 3300048911 | Bacteria | 11040 |
| 436 | Ga0496108_0051101 | 3300048911 | Bacteria | 3463 |
| 437 | Ga0496109_0001422 | 3300048912 | Bacteria | 19864 |
| 438 | Ga0496109_0075249 | 3300048912 | Bacteria | 3104 |
| 439 | Ga0496109_0124066 | 3300048912 | Bacteria | 2407 |
| 440 | Ga0496109_0139182 | 3300048912 | Bacteria | 2269 |
| 441 | Ga0496110_0007801 | 3300048913 | Bacteria | 8576 |
| 442 | Ga0496110_0066341 | 3300048913 | Bacteria | 3192 |
| 443 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 444 | Ga0496112_0016788 | 3300048915 | Bacteria | 6866 |
| 445 | Ga0496112_0083151 | 3300048915 | Bacteria | 3166 |
| 446 | Ga0496113_0035351 | 3300048916 | Bacteria | 3653 |
| 447 | Ga0496114_0031480 | 3300048917 | Bacteria | 4365 |
| 448 | Ga0496114_0052030 | 3300048917 | Bacteria | 3411 |
| 449 | Ga0496115_0024802 | 3300048918 | Bacteria | 4664 |
| 450 | Ga0496115_0118727 | 3300048918 | Bacteria | 2175 |
| 451 | Ga0496116_0001763 | 3300048919 | Bacteria | 23588 |
| 452 | Ga0496117_0014868 | 3300048920 | Bacteria | 6678 |
| 453 | Ga0496117_0097950 | 3300048920 | Bacteria | 1866 |
| 454 | Ga0496119_0103888 | 3300048922 | Bacteria | 1590 |
| 455 | Ga0496121_0000456 | 3300048924 | Bacteria | 80536 |
| 456 | Ga0496121_0002176 | 3300048924 | Bacteria | 30692 |
| 457 | Ga0496121_0011588 | 3300048924 | Bacteria | 9761 |
| 458 | Ga0496121_0012754 | 3300048924 | Bacteria | 9105 |
| 459 | Ga0496121_0020849 | 3300048924 | Bacteria | 6457 |
| 460 | Ga0496121_0029820 | 3300048924 | Bacteria | 5028 |
| 461 | Ga0496121_0037637 | 3300048924 | Bacteria | 4294 |
| 462 | Ga0496121_0079745 | 3300048924 | Bacteria | 2598 |
| 463 | Ga0496121_0112356 | 3300048924 | Bacteria | 2075 |
| 464 | Ga0496123_0017337 | 3300048926 | Bacteria | 5799 |
| 465 | Ga0496124_0000685 | 3300048927 | Bacteria | 55748 |
| 466 | Ga0496125_0000272 | 3300048928 | Bacteria | 105490 |
| 467 | Ga0496125_0000989 | 3300048928 | Bacteria | 44313 |
| 468 | Ga0496125_0001801 | 3300048928 | Bacteria | 29601 |
| 469 | Ga0496125_0009907 | 3300048928 | Bacteria | 9690 |
| 470 | Ga0496125_0030914 | 3300048928 | Bacteria | 4780 |
| 471 | Ga0496126_0002820 | 3300048929 | Bacteria | 22789 |
| 472 | Ga0496126_0005738 | 3300048929 | Bacteria | 14053 |
| 473 | Ga0496126_0008219 | 3300048929 | Bacteria | 11286 |
| 474 | Ga0496126_0126537 | 3300048929 | Bacteria | 2211 |
| 475 | Ga0501032_0038878 | 3300049569 | Bacteria | 3239 |
| 476 | Ga0501033_0051209 | 3300049570 | Bacteria | 3060 |
| 477 | Ga0501034_0000014 | 3300049571 | Bacteria | 297798 |
| 478 | Ga0501034_0001979 | 3300049571 | Bacteria | 25958 |
| 479 | Ga0501034_0020852 | 3300049571 | Bacteria | 6688 |
| 480 | Ga0501034_0060557 | 3300049571 | Bacteria | 3802 |
| 481 | Ga0501034_0124040 | 3300049571 | Bacteria | 2568 |
| 482 | Ga0501036_0017923 | 3300049572 | Bacteria | 5928 |
| 483 | Ga0501036_0141968 | 3300049572 | Bacteria | 2026 |
| 484 | Ga0501036_0170879 | 3300049572 | Bacteria | 1831 |
| 485 | Ga0501038_0006438 | 3300049574 | Bacteria | 10869 |
| 486 | Ga0501038_0014198 | 3300049574 | Bacteria | 7256 |
| 487 | Ga0501038_0020066 | 3300049574 | Bacteria | 6014 |
| 488 | Ga0501038_0023427 | 3300049574 | Bacteria | 5519 |
| 489 | Ga0501038_0071047 | 3300049574 | Bacteria | 2953 |
| 490 | Ga0501039_0016255 | 3300049575 | Bacteria | 5699 |
| 491 | Ga0501039_0023199 | 3300049575 | Bacteria | 4762 |
| 492 | Ga0501040_0021130 | 3300049576 | Bacteria | 4341 |
| 493 | Ga0501040_0095830 | 3300049576 | Bacteria | 2065 |
| 494 | Ga0501041_0009549 | 3300049577 | Bacteria | 5720 |
| 495 | Ga0501043_0011238 | 3300049579 | Bacteria | 7014 |
| 496 | Ga0501043_0030206 | 3300049579 | Bacteria | 4257 |
| 497 | Ga0501043_0045652 | 3300049579 | Bacteria | 3445 |
| 498 | Ga0501043_0066790 | 3300049579 | Bacteria | 2824 |
| 499 | Ga0501046_0000010 | 3300049580 | Bacteria | 331082 |
| 500 | Ga0501046_0092355 | 3300049580 | Bacteria | 2327 |
| 501 | Ga0501047_0086487 | 3300049581 | Bacteria | 3012 |
| 502 | Ga0501048_0016008 | 3300049582 | Bacteria | 5530 |
| 503 | Ga0501048_0038810 | 3300049582 | Bacteria | 3417 |
| 504 | Ga0501067_0013183 | 3300049583 | Bacteria | 4577 |
| 505 | Ga0501070_0021175 | 3300049586 | Bacteria | 5457 |
| 506 | Ga0501070_0042255 | 3300049586 | Bacteria | 3797 |
| 507 | Ga0501071_0015019 | 3300049587 | Bacteria | 5308 |
| 508 | Ga0501077_0001622 | 3300049593 | Bacteria | 13526 |
| 509 | Ga0501079_0057703 | 3300049741 | Bacteria | 2995 |
| 510 | Ga0501081_0013419 | 3300049743 | Bacteria | 5388 |
| 511 | Ga0501035_0026188 | 3300049822 | Bacteria | 5337 |
| 512 | Ga0501035_0169119 | 3300049822 | Bacteria | 1889 |
| 513 | Ga0501044_0008963 | 3300049823 | Bacteria | 10938 |
| 514 | Ga0501044_0020639 | 3300049823 | Bacteria | 7034 |
| 515 | Ga0501044_0021545 | 3300049823 | Bacteria | 6873 |
| 516 | nmdc:mga03n38_504_c1 | 3300050490 | Bacteria | 9828 |
| 517 | nmdc:mga0yw44_2983_c1 | 3300050492 | Bacteria | 7380 |
| 518 | nmdc:mga06z11_13585_c1 | 3300050494 | Bacteria | 3581 |
| 519 | nmdc:mga06z11_408_c1 | 3300050494 | Bacteria | 16144 |
| 520 | nmdc:mga06z11_4197_c1 | 3300050494 | Bacteria | 5643 |
| 521 | nmdc:mga04h51_2437_c1 | 3300050495 | Bacteria | 4416 |
| 522 | nmdc:mga05p37_62746_c1 | 3300050507 | Bacteria | 4573 |
| 523 | nmdc:mga09592_13262_c1 | 3300050508 | Bacteria | 6729 |
| 524 | nmdc:mga0qj67_12305_c1 | 3300050509 | Bacteria | 6443 |
| 525 | nmdc:mga0qj67_18367_c1 | 3300050509 | Bacteria | 5329 |
| 526 | nmdc:mga0qj67_28059_c1 | 3300050509 | Bacteria | 4367 |
| 527 | nmdc:mga06r32_2254_c1 | 3300050510 | Bacteria | 17256 |
| 528 | nmdc:mga06r32_25498_c1 | 3300050510 | Bacteria | 5501 |
| 529 | nmdc:mga06r32_28292_c1 | 3300050510 | Bacteria | 5243 |
| 530 | nmdc:mga06r32_5374_c1 | 3300050510 | Bacteria | 11525 |
| 531 | nmdc:mga08y16_156190_c1 | 3300050511 | Bacteria | 2371 |
| 532 | nmdc:mga0n895_11235_c1 | 3300050512 | Bacteria | 7976 |
| 533 | nmdc:mga0n895_39869_c1 | 3300050512 | Bacteria | 4561 |
| 534 | nmdc:mga0n895_97089_c1 | 3300050512 | Bacteria | 2952 |
| 535 | nmdc:mga0n895_99705_c1 | 3300050512 | Bacteria | 2913 |
| 536 | nmdc:mga0rr50_3247_c1 | 3300050513 | Bacteria | 9316 |
| 537 | Ga0495601_0020791 | 3300053077 | Bacteria | 4011 |
| 538 | Ga0495612_0001804 | 3300053078 | Bacteria | 8767 |
| 539 | Ga0495612_0006069 | 3300053078 | Bacteria | 4976 |
| 540 | Ga0495595_0007295 | 3300053084 | Bacteria | 4523 |
| 541 | Ga0495595_0020128 | 3300053084 | Bacteria | 2901 |
| 542 | Ga0495619_0001276 | 3300053085 | Bacteria | 16527 |
| 543 | Ga0495619_0002636 | 3300053085 | Bacteria | 11719 |
| 544 | Ga0495619_0017934 | 3300053085 | Bacteria | 4488 |
| 545 | Ga0500643_000032 | 3300053087 | Bacteria | 200350 |
| 546 | Ga0500566_0000026 | 3300053094 | Bacteria | 77138 |
| 547 | Ga0500566_0004175 | 3300053094 | Bacteria | 8613 |
| 548 | Ga0500566_0004667 | 3300053094 | Bacteria | 8146 |
| 549 | Ga0500556_0000004 | 3300053104 | Bacteria | 666287 |
| 550 | Ga0500556_0000572 | 3300053104 | Bacteria | 24483 |
| 551 | Ga0500556_0004181 | 3300053104 | Bacteria | 4128 |
| 552 | Ga0500557_000015 | 3300053105 | Bacteria | 106282 |
| 553 | Ga0500572_000172 | 3300053111 | Bacteria | 22845 |
| 554 | Ga0500592_002666 | 3300053116 | Bacteria | 2870 |
| 555 | Ga0500593_000023 | 3300053117 | Bacteria | 52110 |
| 556 | Ga0500595_000324 | 3300053119 | Bacteria | 31413 |
| 557 | Ga0500595_000438 | 3300053119 | Bacteria | 25956 |
| 558 | Ga0500595_001427 | 3300053119 | Bacteria | 12824 |
| 559 | Ga0500608_000894 | 3300053122 | Bacteria | 10741 |
| 560 | Ga0500642_0000037 | 3300053130 | Bacteria | 98684 |
| 561 | Ga0500642_0000102 | 3300053130 | Bacteria | 40878 |
| 562 | Ga0500652_000276 | 3300053131 | Bacteria | 19061 |
| 563 | Ga0500559_0000165 | 3300053136 | Bacteria | 52143 |
| 564 | Ga0500559_0000633 | 3300053136 | Bacteria | 23806 |
| 565 | Ga0500559_0000893 | 3300053136 | Bacteria | 19031 |
| 566 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 567 | Ga0500568_0001069 | 3300053139 | Bacteria | 18534 |
| 568 | Ga0500603_000047 | 3300053150 | Bacteria | 29770 |
| 569 | Ga0500603_000212 | 3300053150 | Bacteria | 15404 |
| 570 | Ga0500604_0000351 | 3300053151 | Bacteria | 12747 |
| 571 | Ga0500604_0007533 | 3300053151 | Bacteria | 2882 |
| 572 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 573 | Ga0500616_0002048 | 3300053153 | Bacteria | 17733 |
| 574 | Ga0500616_0013482 | 3300053153 | Bacteria | 4743 |
| 575 | Ga0500622_0000794 | 3300053156 | Bacteria | 27285 |
| 576 | Ga0500622_0003193 | 3300053156 | Bacteria | 11172 |
| 577 | Ga0500634_0000006 | 3300053161 | Bacteria | 171639 |
| 578 | Ga0500638_045575 | 3300053162 | Bacteria | 2128 |
| 579 | Ga0500639_000269 | 3300053163 | Bacteria | 25662 |
| 580 | Ga0500636_0000538 | 3300053177 | Bacteria | 20632 |
| 581 | Ga0500636_0001759 | 3300053177 | Bacteria | 11856 |
| 582 | Ga0500637_0000088 | 3300053178 | Bacteria | 33146 |
| 583 | Ga0500637_0000545 | 3300053178 | Bacteria | 14737 |
| 584 | Ga0500637_0076115 | 3300053178 | Bacteria | 1935 |
| 585 | Ga0500596_000058 | 3300053735 | Bacteria | 15240 |
| 586 | Ga0500596_001468 | 3300053735 | Bacteria | 4764 |
| 587 | Ga0500601_000048 | 3300053737 | Bacteria | 25132 |
| 588 | Ga0500661_000025 | 3300055283 | Bacteria | 22926 |
| 589 | Ga0501082_0016959 | 3300060353 | Bacteria | 6271 |
| 590 | Ga0501082_0046261 | 3300060353 | Bacteria | 3751 |
| 591 | Ga0530510_0053146 | 3300061734 | Bacteria | 2927 |
| 592 | Ga0530510_0101991 | 3300061734 | Bacteria | 2098 |
| 593 | 2507508522 | 2507262055 | Bacteria | 8048963 |
| 594 | 2508542587 | 2508501009 | Bacteria | 7784016 |
| 595 | 2508691641 | 2508501042 | Bacteria | 8719808 |
| 596 | 2508728424 | 2508501050 | Bacteria | 9633614 |
| 597 | 2509078432 | 2508501114 | Bacteria | 7082538 |
| 598 | 2509144370 | 2508501127 | Bacteria | 7037543 |
| 599 | 2509150944 | 2508501128 | Bacteria | 8613869 |
| 600 | 2511393499 | 2511231028 | Bacteria | 8046582 |
| 601 | 2513592413 | 2513237087 | Bacteria | 5817514 |
| 602 | 2513628006 | 2513237092 | Bacteria | 8341956 |
| 603 | 2513638900 | 2513237094 | Bacteria | 8789602 |
| 604 | 2513645773 | 2513237095 | Bacteria | 8976980 |
| 605 | 2513654789 | 2513237096 | Bacteria | 8722461 |
| 606 | 2513675892 | 2513237098 | Bacteria | 9902361 |
| 607 | 2513692593 | 2513237101 | Bacteria | 7952346 |
| 608 | 2513704834 | 2513237102 | Bacteria | 7703324 |
| 609 | 2513718627 | 2513237104 | Bacteria | 10034502 |
| 610 | 2513855790 | 2513237137 | Bacteria | 9558895 |
| 611 | 2513872830 | 2513237139 | Bacteria | 8737671 |
| 612 | 2513889179 | 2513237141 | Bacteria | 8496279 |
| 613 | 2513915031 | 2513237145 | Bacteria | 8979722 |
| 614 | 2514013591 | 2513237161 | Bacteria | 8871253 |
| 615 | 2515629829 | 2515154112 | Bacteria | 8294334 |
| 616 | 2517107499 | 2517093001 | Bacteria | 9002274 |
| 617 | 2517892328 | 2517572143 | Bacteria | 9484767 |
| 618 | 2524437423 | 2524023205 | Bacteria | 8918781 |
| 619 | 2524468941 | 2524023210 | Bacteria | 9029266 |
| 620 | 2524538585 | 2524023228 | Bacteria | 10118060 |
| 621 | 2528850013 | 2528768022 | Bacteria | 10457665 |
| 622 | 2585165630 | 2582581283 | Bacteria | 6030556 |
| 623 | 2603859517 | 2602042107 | Bacteria | 6226103 |
| 624 | 2617347452 | 2617270735 | Bacteria | 9163226 |
| 625 | 2617375705 | 2617270741 | Bacteria | 8201522 |
| 626 | 2643910693 | 2643221580 | Bacteria | 3816678 |
| 627 | 2643963371 | 2643221591 | Bacteria | 4397626 |
| 628 | 2644046494 | 2643221607 | Bacteria | 6314006 |
| 629 | 2644166038 | 2643221629 | Bacteria | 5850260 |
| 630 | 2644200847 | 2643221636 | Bacteria | 6583769 |
| 631 | 2644288744 | 2643221651 | Bacteria | 4798932 |
| 632 | 2644346956 | 2643221662 | Bacteria | 5851492 |
| 633 | 2644410525 | 2643221674 | Bacteria | 3919126 |
| 634 | 2644479284 | 2643221686 | Bacteria | 6310811 |
| 635 | 2644493337 | 2643221688 | Bacteria | 5260751 |
| 636 | 2644502332 | 2643221689 | Bacteria | 6042950 |
| 637 | 2644729254 | 2643221733 | Bacteria | 5690728 |
| 638 | 2644735108 | 2643221734 | Bacteria | 5365412 |
| 639 | 2644746947 | 2643221736 | Bacteria | 6608466 |
| 640 | 2671120424 | 2667528175 | Bacteria | 7532676 |
| 641 | 2723845021 | 2721755755 | Bacteria | 8322773 |
| 642 | 2728751127 | 2728368998 | Bacteria | 8720350 |
| 643 | 2745076586 | 2744054633 | Bacteria | 8678936 |
| 644 | 2776259647 | 2775506901 | Bacteria | 9631051 |
| 645 | 2793062343 | 2791355196 | Bacteria | 7323613 |
| 646 | 2793072329 | 2791355197 | Bacteria | 8420563 |
| 647 | 2793082111 | |||
| 648 | 2805915272 | 2802429603 | Bacteria | 8777136 |
| 649 | 2818238823 | 2816332527 | Bacteria | 8933356 |
| 650 | 2819719687 | 2818991467 | Bacteria | 5893227 |
| 651 | 2824608035 | 2824600985 | Bacteria | 8488197 |
| 652 | 2824616594 | 2824609381 | Bacteria | 8672835 |
| 653 | 2824624160 | 2824617872 | Bacteria | 8814715 |
| 654 | 2824632750 | 2824626560 | Bacteria | 8813858 |
| 655 | 2824639758 | 2824635225 | Bacteria | 8785348 |
| 656 | 2824648136 | 2824644064 | Bacteria | 8743947 |
| 657 | 2824658699 | 2824653114 | Bacteria | 8493680 |
| 658 | 2824665748 | 2824661429 | Bacteria | 9877870 |
| 659 | 2824674803 | 2824671348 | Bacteria | 8369588 |
| 660 | 2824685998 | 2824679649 | Bacteria | 8248951 |
| 661 | 2824691221 | 2824687955 | Bacteria | 8360029 |
| 662 | 2824701359 | 2824696289 | Bacteria | 8335049 |
| 663 | 2824712362 | 2824704595 | Bacteria | 9667483 |
| 664 | 2824721149 | 2824714736 | Bacteria | 8717648 |
| 665 | 2824727897 | 2824723954 | Bacteria | 8758240 |
| 666 | 2824736682 | 2824732956 | Bacteria | 7810675 |
| 667 | 2824750169 | 2824746037 | Bacteria | 7911610 |
| 668 | 2824759505 | 2824753945 | Bacteria | 9787441 |
| 669 | 2824769887 | 2824763712 | Bacteria | 9792355 |
| 670 | 2824779442 | 2824773399 | Bacteria | 8360218 |
| 671 | 2828306610 | 2828305725 | Bacteria | 4916900 |
| 672 | 2835317902 | 2835312727 | Bacteria | 7413381 |
| 673 | 2838123677 | 2838122688 | Bacteria | 8803140 |
| 674 | 2841762313 | 2841760612 | Bacteria | 6454112 |
| 675 | 2841946679 | 2841941048 | Bacteria | 8688029 |
| 676 | 2841949777 | 2841949485 | Bacteria | 8680857 |
| 677 | 2841958730 | 2841957949 | Bacteria | 8652217 |
| 678 | 2841971718 | 2841966195 | Bacteria | 8673214 |
| 679 | 2841974932 | 2841974524 | Bacteria | 8931498 |
| 680 | 2841983499 | 2841983080 | Bacteria | 8395090 |
| 681 | 2842039002 | 2842038055 | Bacteria | 8002051 |
| 682 | 2842048051 | 2842045827 | Bacteria | 8006841 |
| 683 | 2842696240 | 2842694124 | Bacteria | 4063419 |
| 684 | 2844109851 | 2844104063 | Bacteria | 6440972 |
| 685 | 2844319147 | 2844315083 | Bacteria | 8138177 |
| 686 | 2847936278 | 2847930680 | Bacteria | 9342022 |
| 687 | 2847946627 | 2847939898 | Bacteria | 8606328 |
| 688 | 2849079251 | 2849076700 | Bacteria | 7039503 |
| 689 | 2851186880 | 2851182111 | Bacteria | 6047226 |
| 690 | 2851248326 | 2851246043 | Bacteria | 6439203 |
| 691 | 2857514247 | 2857509624 | Bacteria | 7472071 |
| 692 | 2857529080 | 2857524615 | Bacteria | 6615449 |
| 693 | 2874598121 | 2874590934 | Bacteria | 8299676 |
| 694 | 2874605263 | 2874604998 | Bacteria | 7834745 |
| 695 | 2874615474 | 2874612657 | Bacteria | 8252029 |
| 696 | 2874627766 | 2874620515 | Bacteria | 8290088 |
| 697 | 2874631924 | 2874628541 | Bacteria | 8630250 |
| 698 | 2874645834 | 2874645413 | Bacteria | 8214782 |
| 699 | 2876764099 | 2876761206 | Bacteria | 10111113 |
| 700 | 2876778401 | 2876771140 | Bacteria | 8287509 |
| 701 | 2876815220 | 2876808645 | Bacteria | 8824342 |
| 702 | 2876825730 | 2876818435 | Bacteria | 8274608 |
| 703 | 2879082195 | 2879074833 | Bacteria | 8279565 |
| 704 | 2879090645 | 2879083081 | Bacteria | 8587928 |
| 705 | 2879105852 | 2879099564 | Bacteria | 10442239 |
| 706 | 2879111256 | 2879110137 | Bacteria | 8907982 |
| 707 | 2879135342 | 2879127579 | Bacteria | 8294491 |
| 708 | 2879150551 | 2879142872 | Bacteria | 8267021 |
| 709 | 2881368775 | 2881364244 | Bacteria | 7710352 |
| 710 | 2881671223 | 2881665667 | Bacteria | 8175609 |
| 711 | 2884299842 | 2884298095 | Bacteria | 3823049 |
| 712 | 2885373218 | 2885366525 | Bacteria | 8326213 |
| 713 | 2885379483 | 2885374607 | Bacteria | 8927485 |
| 714 | 2885386546 | 2885383462 | Bacteria | 9473874 |
| 715 | 2885411427 | 2885409591 | Bacteria | 9235467 |
| 716 | 2888384132 | 2888378607 | Bacteria | 9652610 |
| 717 | 2888393736 | 2888388044 | Bacteria | 7304136 |
| 718 | 2888424597 | 2888419890 | Bacteria | 7857137 |
| 719 | 2889039774 | 2889033259 | Bacteria | 9099371 |
| 720 | 2893070521 | 2893066018 | Bacteria | 6158120 |
| 721 | 2894239688 | 2894232714 | Bacteria | 8834183 |
| 722 | 2903730989 | 2903727486 | Bacteria | 8281579 |
| 723 | 2903749362 | 2903748898 | Bacteria | 9972761 |
| 724 | 2903774125 | 2903768456 | Bacteria | 9749579 |
| 725 | 2904672914 | 2904666416 | Bacteria | 8226587 |
| 726 | 2904695893 | 2904690495 | Bacteria | 9412302 |
| 727 | 2904703526 | |||
| 728 | 2904703963 | |||
| 729 | 2904714717 | 2904711408 | Bacteria | 9771557 |
| 730 | 2906608230 | 2906602504 | Bacteria | 8295279 |
| 731 | 2906618698 | |||
| 732 | 2906633337 | 2906626472 | Bacteria | 8826946 |
| 733 | 2906638862 | 2906635258 | Bacteria | 8601019 |
| 734 | 2906648225 | 2906643746 | Bacteria | 8722424 |
| 735 | 2906666305 | 2906660503 | Bacteria | 8595048 |
| 736 | 2908742622 | 2908739725 | Bacteria | 8628932 |
| 737 | 2908761195 | 2908756301 | Bacteria | 8864324 |
| 738 | 2908780246 | 2908775508 | Bacteria | 8092255 |
| 739 | 2909048215 | 2909042592 | Bacteria | 6499737 |
| 740 | 2917705064 | 2917699015 | Bacteria | 7043791 |
| 741 | 2919076480 | 2919073203 | Bacteria | 6531949 |
| 742 | 2922365422 | 2922361189 | Bacteria | 7436256 |
| 743 | 2922374467 | |||
| 744 | 2922391030 | 2922386360 | Bacteria | 7017218 |
| 745 | 2922396161 | 2922393267 | Bacteria | 8285685 |
| 746 | 2922430358 | |||
| 747 | 2929618131 | 2929615660 | Bacteria | 9193770 |
| 748 | 2929632319 | 2929624759 | Bacteria | 9339455 |
| 749 | 2932403361 | 2932401849 | Bacteria | 4262978 |
| 750 | 2932790424 | 2932784394 | Bacteria | 9704911 |
| 751 | 2932802718 | 2932801729 | Bacteria | 7987968 |
| 752 | 2932810844 | 2932809354 | Bacteria | 9135765 |
| 753 | 2932823824 | 2932818245 | Bacteria | 9955613 |
| 754 | 2932830054 | 2932828146 | Bacteria | 9745859 |
| 755 | 2933580059 | 2933577622 | Bacteria | 9116884 |
| 756 | 2935608946 | 2935608549 | Bacteria | 8203142 |
| 757 | 2935622719 | 2935616580 | Bacteria | 9032984 |
| 758 | 2935631602 | 2935630451 | Bacteria | 8169952 |
| 759 | 2935642481 | 2935638405 | Bacteria | 10015038 |
| 760 | 2935653351 | 2935648319 | Bacteria | 8801166 |
| 761 | 2935660178 | 2935656913 | Bacteria | 8965014 |
| 762 | 2935668215 | 2935665750 | Bacteria | 9571747 |
| 763 | 2935676246 | 2935675223 | Bacteria | 9928132 |
| 764 | 2935686323 | 2935684952 | Bacteria | 9590419 |
| 765 | 2935701141 | 2935694250 | Bacteria | 9291695 |
| 766 | 2935706076 | 2935703347 | Bacteria | 10242284 |
| 767 | 2935722342 | 2935713505 | Bacteria | 9608509 |
| 768 | 2935731629 | 2935722832 | Bacteria | 9608746 |
| 769 | 2935732237 | 2935732158 | Bacteria | 9706831 |
| 770 | 2935741616 | 2935741537 | Bacteria | 9707219 |
| 771 | 2935752288 | 2935750917 | Bacteria | 9590372 |
| 772 | 2935766570 | 2935760218 | Bacteria | 9817913 |
| 773 | 2935776942 | 2935769743 | Bacteria | 7878163 |
| 774 | 2935778593 | 2935777560 | Bacteria | 8077691 |
| 775 | 2935792258 | 2935785616 | Bacteria | 7962367 |
| 776 | 2935800421 | 2935793552 | Bacteria | 8012592 |
| 777 | 2935803074 | 2935801545 | Bacteria | 9301974 |
| 778 | 2935814391 | 2935810662 | Bacteria | 9401221 |
| 779 | 2935822106 | 2935819856 | Bacteria | 8261050 |
| 780 | 2935831528 | 2935827899 | Bacteria | 10038562 |
| 781 | 2935838388 | 2935837841 | Bacteria | 9454360 |
| 782 | 2935847688 | 2935847175 | Bacteria | 8228321 |
| 783 | 2935860968 | 2935855204 | Bacteria | 9035059 |
| 784 | 2935869695 | 2935864058 | Bacteria | 9784707 |
| 785 | 2935878886 | 2935873716 | Bacteria | 9632195 |
| 786 | 2935889810 | 2935883170 | Bacteria | 7964738 |
| 787 | 2935909040 | 2935908558 | Bacteria | 8568796 |
| 788 | 2935919760 | 2935916978 | Bacteria | 9113783 |
| 789 | 2935926386 | 2935926038 | Bacteria | 8601059 |
| 790 | 2935934836 | 2935934488 | Bacteria | 8602579 |
| 791 | 2935943286 | 2935942939 | Bacteria | 8599779 |
| 792 | 2935951724 | 2935951376 | Bacteria | 8602333 |
| 793 | 2935965779 | 2935959822 | Bacteria | 7869783 |
| 794 | 2935967849 | 2935967501 | Bacteria | 8603075 |
| 795 | 2935983812 | 2935975950 | Bacteria | 8347125 |
| 796 | 2935991653 | 2935984226 | Bacteria | 8302647 |
| 797 | 2935994717 | 2935992306 | Bacteria | 9802711 |
| 798 | 2936003359 | 2936002035 | Bacteria | 9362176 |
| 799 | 2936016221 | 2936011229 | Bacteria | 8801034 |
| 800 | 2936024854 | 2936019824 | Bacteria | 8804134 |
| 801 | 2936032102 | 2936028420 | Bacteria | 8965941 |
| 802 | 2936039947 | 2936037263 | Bacteria | 9446081 |
| 803 | 2936049963 | 2936046547 | Bacteria | 8903709 |
| 804 | 2936060915 | 2936055302 | Bacteria | 8785755 |
| 805 | 2937836998 | 2937836603 | Bacteria | 6811263 |
| 806 | 2940556910 | 2940556831 | Bacteria | 9590747 |
| 807 | 2941511396 | 2941507105 | Bacteria | 8166816 |
| 808 | 2941519097 | 2941515067 | Bacteria | 8166720 |
| 809 | 2941526323 | 2941523033 | Bacteria | 8169134 |
| 810 | 2941532884 | 2941531003 | Bacteria | 7653939 |
| 811 | 2941538944 | 2941538514 | Bacteria | 9402094 |
| 812 | 3005480279 | 3005474847 | Bacteria | 9259049 |
| 813 | 3005484385 | 3005483717 | Bacteria | 7877331 |
| 814 | 3005510386 | 3005506211 | Bacteria | 6943378 |
| 815 | 3005587982 | 3005587118 | Bacteria | 7794411 |
| 816 | 3005599298 | 3005594810 | Bacteria | 8716512 |
| 817 | 3005714976 | 3005710791 | Bacteria | 7622528 |
| 818 | 3005722381 | 3005718088 | Bacteria | 8283608 |
| 819 | 8001849792 | 8001845381 | Bacteria | 5804942 |
| 820 | 8006927083 | 8006926726 | Bacteria | 6749210 |
| 821 | 8006940605 | 8006933436 | Bacteria | 10410654 |
| 822 | 8006965808 | 8006964411 | Bacteria | 8966052 |
| 823 | 8006980294 | 8006973647 | Bacteria | 10679141 |
| 824 | 8006986460 | 8006984368 | Bacteria | 9651211 |
| 825 | 8006995971 | 8006994254 | Bacteria | 8309700 |
| 826 | 8016522263 | 8016511872 | Bacteria | 9921665 |
| 827 | 8016529550 | 8016522445 | Bacteria | 8156687 |
| 828 | 8016534762 | 8016530956 | Bacteria | 8155261 |
| 829 | 8016547981 | 8016539877 | Bacteria | 8155419 |
| 830 | 8016562528 | 8016557553 | Bacteria | 8154380 |
| 831 | 8016573112 | 8016566248 | Bacteria | 8158151 |
| 832 | 8016577256 | 8016575299 | Bacteria | 8154085 |
| 833 | 8016591673 | 8016583857 | Bacteria | 10421953 |
| 834 | 8016600317 | 8016595262 | Bacteria | 8149947 |
| 835 | 8016614504 | 8016613128 | Bacteria | 8794220 |
| 836 | 8016626495 | 8016622563 | Bacteria | 7999408 |
| 837 | 8016640260 | 8016630954 | Bacteria | 9217207 |
| 838 | 8017063294 | 8017057580 | Bacteria | 10023680 |
| 839 | 8019544942 | 8019538911 | Bacteria | 7872763 |
| 840 | 8019553590 | 8019547302 | Bacteria | 7996444 |
| 841 | 8019556673 | 8019555841 | Bacteria | 9642137 |
| 842 | 8019568636 | 8019565922 | Bacteria | 9639779 |
| 843 | 8019582728 | 8019576017 | Bacteria | 10049540 |
| 844 | 8019600836 | 8019597564 | Bacteria | 10041141 |
| 845 | 8019617718 | 8019608314 | Bacteria | 10042931 |
| 846 | 8019628246 | 8019619141 | Bacteria | 9218857 |
| 847 | 8019634380 | 8019629233 | Bacteria | 8687553 |
| 848 | 8019645352 | 8019638758 | Bacteria | 9062356 |
| 849 | 8019658479 | 8019648815 | Bacteria | 10014479 |
| 850 | 8019662259 | 8019659431 | Bacteria | 8577854 |
| 851 | 8019684327 | 8019678201 | Bacteria | 8863603 |
| 852 | 8019690143 | 8019687851 | Bacteria | 8712826 |
| 853 | 8055746280 | 8055742211 | Bacteria | 9226248 |
| 854 | 8056673804 | 8056673599 | Bacteria | 7871253 |
| 855 | 8056686714 | 8056681323 | Bacteria | 8472857 |
| 856 | 8056695268 | 8056689827 | Bacteria | 6712655 |
| 857 | 8056968098 | 8056967851 | Bacteria | 9038162 |
| 858 | 8057535531 | 8057529695 | Bacteria | 6306553 |
| 859 | Ga0496104_0000275 | |||
| 860 | JGI24737J22298_10004391 | |||
| 861 | JGI25151J46595_10000114 | |||
| 862 | JGI25151J46595_10000345 | |||
| 863 | JGI25406J46586_10000104 | |||
| 864 | JGI25406J46586_10001599 | |||
| 865 | JGI25165J46597_1002951 | |||
| 866 | JGI25153J46596_10001106 | |||
| 867 | JGI25160J50197_1009619 | |||
| 868 | Ga0055526_1000395 | |||
| 869 | Ga0055526_1001058 | |||
| 870 | Ga0055524_1000020 | |||
| 871 | Ga0065165_1000240 | |||
| 872 | Ga0065165_1001349 | |||
| 873 | Ga0065165_1001593 | |||
| 874 | Ga0070676_10005386 | |||
| 875 | Ga0070666_10012047 | |||
| 876 | Ga0070680_100081740 | |||
| 877 | Ga0070682_100007542 | |||
| 878 | Ga0068868_100007248 | |||
| 879 | Ga0070691_10008708 | |||
| 880 | Ga0070668_100014987 | |||
| 881 | Ga0070669_100003763 | |||
| 882 | Ga0070671_100076617 | |||
| 883 | Ga0070659_100022039 | |||
| 884 | Ga0070659_100088124 | |||
| 885 | Ga0070709_10002085 | |||
| 886 | Ga0070710_10000842 | |||
| 887 | Ga0070711_100046378 | |||
| 888 | Ga0070705_100001270 | |||
| 889 | Ga0070694_100002981 | |||
| 890 | Ga0070694_100052535 | |||
| 891 | Ga0070678_100033408 | |||
| 892 | Ga0070699_100000313 | |||
| 893 | Ga0070679_100036158 | |||
| 894 | Ga0068853_100003443 | |||
| 895 | Ga0070695_100001796 | |||
| 896 | Ga0070696_100000471 | |||
| 897 | Ga0070704_100012520 | |||
| 898 | Ga0068855_100025861 | |||
| 899 | Ga0068857_100005529 | |||
| 900 | Ga0068857_100005939 | |||
| 901 | Ga0068857_100034904 | |||
| 902 | Ga0068856_100000082 | |||
| 903 | Ga0068856_100041732 | |||
| 904 | Ga0068852_100034172 | |||
| 905 | Ga0068852_100048627 | |||
| 906 | Ga0068859_100096721 | |||
| 907 | Ga0068864_100125527 | |||
| 908 | Ga0068861_100032708 | |||
| 909 | Ga0068851_10001427 | |||
| 910 | Ga0068851_10002938 | |||
| 911 | Ga0068851_10003776 | |||
| 912 | Ga0068858_100027234 | |||
| 913 | Ga0068860_100000316 | |||
| 914 | Ga0068860_100013358 | |||
| 915 | Ga0081455_10000194 | |||
| 916 | Ga0081455_10002419 | |||
| 917 | Ga0081455_10002827 | |||
| 918 | Ga0081455_10003658 | |||
| 919 | Ga0081455_10081964 | |||
| 920 | Ga0081538_10012272 | |||
| 921 | Ga0081540_1000032 | |||
| 922 | Ga0081540_1002092 | |||
| 923 | Ga0081540_1006870 | |||
| 924 | Ga0081540_1016557 | |||
| 925 | Ga0081540_1028208 | |||
| 926 | Ga0081539_10000273 | |||
| 927 | Ga0081539_10000735 | |||
| 928 | Ga0081539_10018005 | |||
| 929 | Ga0081539_10036063 | |||
| 930 | Ga0081539_10039885 | |||
| 931 | Ga0070717_10000729 | |||
| 932 | Ga0070717_10004095 | |||
| 933 | Ga0075365_10024876 | |||
| 934 | Ga0075365_10027613 | |||
| 935 | Ga0075363_100001173 | |||
| 936 | Ga0070716_100009239 | |||
| 937 | Ga0075367_10010285 | |||
| 938 | Ga0075367_10010355 | |||
| 939 | Ga0075367_10030943 | |||
| 940 | Ga0075370_10033054 | |||
| 941 | Ga0075430_100004577 | |||
| 942 | Ga0075430_100071354 | |||
| 943 | Ga0075431_100001890 | |||
| 944 | Ga0075431_100038293 | |||
| 945 | Ga0075431_100136956 | |||
| 946 | Ga0075433_10126425 | |||
| 947 | Ga0075434_100034833 | |||
| 948 | Ga0075434_100039736 | |||
| 949 | Ga0075434_100043875 | |||
| 950 | Ga0097620_100096717 | |||
| 951 | Ga0099825_1028727 | |||
| 952 | Ga0099824_1022420 | |||
| 953 | Ga0099822_1017281 | |||
| 954 | Ga0099823_1008783 | |||
| 955 | Ga0075435_100003830 | |||
| 956 | Ga0105240_10007507 | |||
| 957 | Ga0105240_10010434 | |||
| 958 | Ga0105240_10012340 | |||
| 959 | Ga0111539_10104371 | |||
| 960 | Ga0105245_10018726 | |||
| 961 | Ga0105247_10027479 | |||
| 962 | Ga0114129_10047185 | |||
| 963 | Ga0114129_10136930 | |||
| 964 | Ga0114129_10239133 | |||
| 965 | Ga0105243_10088601 | |||
| 966 | Ga0105237_10040828 | |||
| 967 | Ga0105237_10132437 | |||
| 968 | Ga0105238_10001837 | |||
| 969 | Ga0105238_10047470 | |||
| 970 | Ga0105238_10048472 | |||
| 971 | Ga0105238_10077428 | |||
| 972 | Ga0105249_10096671 | |||
| 973 | Ga0105239_10115636 | |||
| 974 | Ga0105239_10143534 | |||
| 975 | Ga0105239_10156886 | |||
| 976 | Ga0157369_10019813 | |||
| 977 | Ga0157369_10078362 | |||
| 978 | Ga0171462_1022 | |||
| 979 | Ga0157374_10021003 | |||
| 980 | Ga0157374_10088980 | |||
| 981 | Ga0163162_10037819 | |||
| 982 | Ga0163162_10157383 | |||
| 983 | Ga0157372_10024593 | |||
| 984 | Ga0157375_10012645 | |||
| 985 | Ga0214544_1000002 | |||
| 986 | Ga0214542_1000001 | |||
| 987 | Ga0214545_1000001 | |||
| 988 | Ga0214545_1029110 | |||
| 989 | Ga0214543_1000001 | |||
| 990 | Ga0213874_10002243 | |||
| 991 | Ga0213876_10001406 | |||
| 992 | Ga0213876_10057034 | |||
| 993 | Ga0213871_10004850 | |||
| 994 | Ga0207427_101831 | |||
| 995 | Ga0209677_100507 | |||
| 996 | Ga0209148_1000289 | |||
| 997 | Ga0209233_1002026 | |||
| 998 | Ga0209455_1003622 | |||
| 999 | Ga0209673_1021481 | |||
| 1000 | Ga0209130_1000061 | |||
| 1001 | Ga0209675_1001320 | |||
| 1002 | Ga0209025_1000008 | |||
| 1003 | Ga0209025_1001935 | |||
| 1004 | Ga0209025_1015731 | |||
| 1005 | Ga0209564_1000049 | |||
| 1006 | Ga0209564_1000054 | |||
| 1007 | Ga0209758_1000160 | |||
| 1008 | Ga0209758_1000219 | |||
| 1009 | Ga0209758_1007950 | |||
| 1010 | Ga0209758_1016520 | |||
| 1011 | Ga0209758_1027905 | |||
| 1012 | Ga0209256_1000014 | |||
| 1013 | Ga0209256_1003910 | |||
| 1014 | Ga0207426_1000705 | |||
| 1015 | Ga0207426_1000986 | |||
| 1016 | Ga0207426_1004854 | |||
| 1017 | Ga0207656_10001566 | |||
| 1018 | Ga0207656_10003271 | |||
| 1019 | Ga0207653_10002045 | |||
| 1020 | Ga0207692_10000244 | |||
| 1021 | Ga0207692_10000420 | |||
| 1022 | Ga0207647_10015806 | |||
| 1023 | Ga0207699_10002274 | |||
| 1024 | Ga0207699_10007307 | |||
| 1025 | Ga0207699_10009196 | |||
| 1026 | Ga0207643_10039285 | |||
| 1027 | Ga0207654_10004487 | |||
| 1028 | Ga0207707_10002881 | |||
| 1029 | Ga0207707_10090385 | |||
| 1030 | Ga0207695_10000015 | |||
| 1031 | Ga0207695_10004042 | |||
| 1032 | Ga0207695_10021791 | |||
| 1033 | Ga0207695_10191664 | |||
| 1034 | Ga0207671_10011502 | |||
| 1035 | Ga0207693_10000095 | |||
| 1036 | Ga0207693_10024287 | |||
| 1037 | Ga0207663_10057945 | |||
| 1038 | Ga0207660_10026805 | |||
| 1039 | Ga0207657_10007732 | |||
| 1040 | Ga0207649_10001722 | |||
| 1041 | Ga0207652_10133466 | |||
| 1042 | Ga0207694_10000082 | |||
| 1043 | Ga0207694_10012755 | |||
| 1044 | Ga0207664_10008276 | |||
| 1045 | Ga0207664_10063181 | |||
| 1046 | Ga0207706_10157034 | |||
| 1047 | Ga0207665_10000133 | |||
| 1048 | Ga0207665_10018020 | |||
| 1049 | Ga0207661_10001725 | |||
| 1050 | Ga0207667_10006555 | |||
| 1051 | Ga0207667_10023099 | |||
| 1052 | Ga0207667_10051742 | |||
| 1053 | Ga0207640_10003022 | |||
| 1054 | Ga0207678_10060660 | |||
| 1055 | Ga0207678_10133251 | |||
| 1056 | Ga0207702_10000002 | |||
| 1057 | Ga0207702_10000048 | |||
| 1058 | Ga0207676_10115078 | |||
| 1059 | Ga0207674_10001889 | |||
| 1060 | Ga0207674_10002361 | |||
| 1061 | Ga0207674_10042826 | |||
| 1062 | Ga0207683_10140204 | |||
| 1063 | Ga0207698_10052853 | |||
| 1064 | Ga0209389_1000008 | |||
| 1065 | Ga0209389_1000081 | |||
| 1066 | Ga0209589_1000001 | |||
| 1067 | Ga0209589_1000091 | |||
| 1068 | Ga0209489_100001 | |||
| 1069 | Ga0209489_100096 | |||
| 1070 | Ga0209489_100333 | |||
| 1071 | Ga0209700_100001 | |||
| 1072 | Ga0209700_100062 | |||
| 1073 | Ga0209588_1004092 | |||
| 1074 | Ga0209813_10000356 | |||
| 1075 | Ga0209813_10003767 | |||
| 1076 | Ga0207428_10062905 | |||
| 1077 | Ga0268266_10003536 | |||
| 1078 | Ga0268266_10008761 | |||
| 1079 | Ga0268266_10019220 | |||
| 1080 | Ga0268265_10000550 | |||
| 1081 | Ga0268264_10000430 | |||
| 1082 | Ga0268264_10005052 | |||
| 1083 | Ga0265319_1002587 | |||
| 1084 | Ga0265336_10000474 | |||
| 1085 | Ga0307517_10001000 | |||
| 1086 | Ga0307515_10000070 | |||
| 1087 | Ga0307515_10029530 | |||
| 1088 | Ga0307515_10068290 | |||
| 1089 | Ga0265338_10000086 | |||
| 1090 | Ga0265330_10032435 | |||
| 1091 | Ga0265325_10009592 | |||
| 1092 | Ga0265340_10001336 | |||
| 1093 | Ga0265339_10000418 | |||
| 1094 | Ga0307513_10015483 | |||
| 1095 | Ga0307513_10062401 | |||
| 1096 | Ga0307509_10133747 | |||
| 1097 | Ga0265313_10000154 | |||
| 1098 | Ga0307508_10000009 | |||
| 1099 | Ga0316575_10004011 | |||
| 1100 | Ga0265314_10017894 | |||
| 1101 | Ga0316576_10015722 | |||
| 1102 | Ga0316576_10033406 | |||
| 1103 | Ga0307516_10006964 | |||
| 1104 | Ga0307516_10030994 | |||
| 1105 | Ga0307409_100107547 | |||
| 1106 | Ga0307414_10026840 | |||
| 1107 | Ga0316583_10011778 | |||
| 1108 | Ga0315911_1000001 | |||
| 1109 | Ga0373934_0003946 | |||
| 1110 | Ga0373923_0011642 | |||
| 1111 | Ga0373923_0023401 | |||
| 1112 | Ga0373953_0000473 | |||
| 1113 | Ga0373953_0001627 | |||
| 1114 | Ga0373954_0000442 | |||
| 1115 | Ga0373956_0006981 | |||
| 1116 | Ga0373956_0014148 | |||
| 1117 | Ga0373957_0012131 | |||
| 1118 | Ga0373943_0003057 | |||
| 1119 | Ga0373955_0000840 | |||
| 1120 | Ga0373955_0006897 | |||
| 1121 | Ga0373962_0002428 | |||
| 1122 | Ga0373931_0004195 | |||
| 1123 | Ga0373931_0019032 | |||
| 1124 | Ga0373935_0001167 | |||
| 1125 | Ga0373935_0035945 | |||
| 1126 | Ga0373933_0000041 | |||
| 1127 | Ga0373933_0000563 | |||
| 1128 | Ga0373933_0002868 | |||
| 1129 | Ga0373937_0002003 | |||
| 1130 | Ga0373937_0014572 | |||
| 1131 | Ga0373937_0018505 | |||
| 1132 | Ga0373937_0046509 | |||
| 1133 | Ga0372808_004186 | |||
| 1134 | Ga0316582_0014990 | |||
| 1135 | Ga0316584_0003478 | |||
| 1136 | Ga0373925_0004654 | |||
| 1137 | Ga0373925_0028798 | |||
| 1138 | Ga0373925_0050715 | |||
| 1139 | Ga0395899_0108442 | |||
| 1140 | Ga0395900_0001685 | |||
| 1141 | Ga0395900_0033546 | |||
| 1142 | Ga0395900_0037966 | |||
| 1143 | Ga0395898_0010109 | |||
| 1144 | Ga0395905_0007972 | |||
| 1145 | Ga0395905_0012612 | |||
| 1146 | Ga0395905_0024541 | |||
| 1147 | Ga0316581_0002606 | |||
| 1148 | Ga0436364_0138611 | |||
| 1149 | Ga0436364_0485287 | |||
| 1150 | Ga0395901_0004712 | |||
| 1151 | Ga0395901_0030320 | |||
| 1152 | Ga0436365_0286964 | |||
| 1153 | Ga0436365_1628681 | |||
| 1154 | Ga0436365_1651055 | |||
| 1155 | Ga0436361_0915560 | |||
| 1156 | Ga0436363_1213338 | |||
| 1157 | Ga0436363_1572654 | |||
| 1158 | Ga0436362_0566207 | |||
| 1159 | Ga0466972_0000216 | |||
| 1160 | Ga0466966_0000495 | |||
| 1161 | Ga0466961_0000937 | |||
| 1162 | Ga0466963_0020140 | |||
| 1163 | Ga0466957_0041929 | |||
| 1164 | Ga0466960_0007789 | |||
| 1165 | Ga0466959_0018432 | |||
| 1166 | Ga0466967_0017095 | |||
| 1167 | Ga0495592_0005090 | |||
| 1168 | Ga0495592_0018842 | |||
| 1169 | Ga0495592_0022433 | |||
| 1170 | Ga0495603_0000329 | |||
| 1171 | Ga0495603_0005330 | |||
| 1172 | Ga0495629_0000355 | |||
| 1173 | Ga0495629_0008864 | |||
| 1174 | Ga0495629_0011318 | |||
| 1175 | Ga0495629_0034923 | |||
| 1176 | Ga0495629_0036301 | |||
| 1177 | Ga0495651_0000265 | |||
| 1178 | Ga0495651_0002687 | |||
| 1179 | Ga0495651_0015524 | |||
| 1180 | Ga0495651_0029989 | |||
| 1181 | Ga0495651_0043715 | |||
| 1182 | Ga0495653_0037314 | |||
| 1183 | Ga0495653_0039788 | |||
| 1184 | Ga0495582_0005216 | |||
| 1185 | Ga0495582_0013187 | |||
| 1186 | Ga0495639_0000061 | |||
| 1187 | Ga0495662_0000437 | |||
| 1188 | Ga0495664_0008477 | |||
| 1189 | Ga0495664_0011752 | |||
| 1190 | Ga0495664_0020019 | |||
| 1191 | Ga0495594_0002652 | |||
| 1192 | Ga0495606_0005142 | |||
| 1193 | Ga0495608_0000435 | |||
| 1194 | Ga0495608_0005163 | |||
| 1195 | Ga0495608_0009473 | |||
| 1196 | Ga0495608_0045193 | |||
| 1197 | Ga0495616_0022794 | |||
| 1198 | Ga0495628_0018503 | |||
| 1199 | Ga0495628_0021620 | |||
| 1200 | Ga0495628_0048492 | |||
| 1201 | Ga0495648_0002320 | |||
| 1202 | Ga0495648_0014791 | |||
| 1203 | Ga0495652_0001766 | |||
| 1204 | Ga0495652_0002339 | |||
| 1205 | Ga0495652_0024014 | |||
| 1206 | Ga0495652_0038161 | |||
| 1207 | Ga0495654_0008815 | |||
| 1208 | Ga0495665_0000414 | |||
| 1209 | Ga0495640_0000826 | |||
| 1210 | Ga0495640_0007059 | |||
| 1211 | Ga0495640_0009783 | |||
| 1212 | Ga0495640_0020350 | |||
| 1213 | Ga0495640_0027153 | |||
| 1214 | Ga0495586_0038836 | |||
| 1215 | Ga0495587_0002595 | |||
| 1216 | Ga0495587_0007158 | |||
| 1217 | Ga0495587_0010142 | |||
| 1218 | Ga0495587_0073069 | |||
| 1219 | Ga0495645_0007922 | |||
| 1220 | Ga0495645_0011015 | |||
| 1221 | Ga0495645_0047289 | |||
| 1222 | Ga0495667_0000817 | |||
| 1223 | Ga0495667_0001528 | |||
| 1224 | Ga0495667_0013389 | |||
| 1225 | Ga0495668_0025684 | |||
| 1226 | Ga0495634_0000762 | |||
| 1227 | Ga0495634_0002573 | |||
| 1228 | Ga0495634_0008744 | |||
| 1229 | Ga0495625_0039677 | |||
| 1230 | Ga0495635_0000187 | |||
| 1231 | Ga0495635_0001091 | |||
| 1232 | Ga0495657_0020860 | |||
| 1233 | Ga0495599_0015434 | |||
| 1234 | Ga0495599_0020518 | |||
| 1235 | Ga0495623_0005149 | |||
| 1236 | Ga0495623_0025428 | |||
| 1237 | Ga0495623_0028344 | |||
| 1238 | Ga0495646_0005680 | |||
| 1239 | Ga0495646_0013741 | |||
| 1240 | Ga0495646_0018205 | |||
| 1241 | Ga0495646_0022600 | |||
| 1242 | Ga0495658_0000047 | |||
| 1243 | Ga0495658_0016600 | |||
| 1244 | Ga0495613_0002415 | |||
| 1245 | Ga0495624_0000188 | |||
| 1246 | Ga0495670_0034645 | |||
| 1247 | Ga0495600_0005291 | |||
| 1248 | Ga0495600_0013208 | |||
| 1249 | Ga0495600_0059430 | |||
| 1250 | Ga0495581_0000705 | |||
| 1251 | Ga0495604_0000118 | |||
| 1252 | Ga0495604_0008523 | |||
| 1253 | Ga0495604_0031356 | |||
| 1254 | Ga0495674_0001402 | |||
| 1255 | Ga0495674_0002109 | |||
| 1256 | Ga0495674_0011338 | |||
| 1257 | Ga0495674_0039692 | |||
| 1258 | Ga0495674_0127720 | |||
| 1259 | Ga0495680_0005405 | |||
| 1260 | Ga0495680_0006280 | |||
| 1261 | Ga0495680_0006879 | |||
| 1262 | Ga0495675_0001383 | |||
| 1263 | Ga0495675_0023118 | |||
| 1264 | Ga0495684_0001482 | |||
| 1265 | Ga0495684_0036877 | |||
| 1266 | Ga0495684_0042883 | |||
| 1267 | Ga0495684_0043497 | |||
| 1268 | Ga0495684_0100156 | |||
| 1269 | Ga0495593_0000616 | |||
| 1270 | Ga0495593_0005166 | |||
| 1271 | Ga0495602_0006478 | |||
| 1272 | Ga0495602_0021287 | |||
| 1273 | Ga0495602_0052016 | |||
| 1274 | Ga0496102_0005226 | |||
| 1275 | Ga0496102_0015089 | |||
| 1276 | Ga0496102_0098128 | |||
| 1277 | Ga0496104_0016718 | |||
| 1278 | Ga0496104_0053795 | |||
| 1279 | Ga0496104_0133984 | |||
| 1280 | Ga0496105_0004479 | |||
| 1281 | Ga0496105_0035771 | |||
| 1282 | Ga0496105_0039509 | |||
| 1283 | Ga0496106_0000477 | |||
| 1284 | Ga0496106_0001639 | |||
| 1285 | Ga0496106_0005089 | |||
| 1286 | Ga0496106_0023152 | |||
| 1287 | Ga0496106_0024067 | |||
| 1288 | Ga0496107_0002282 | |||
| 1289 | Ga0496107_0003815 | |||
| 1290 | Ga0496107_0005766 | |||
| 1291 | Ga0496107_0010725 | |||
| 1292 | Ga0496108_0004243 | |||
| 1293 | Ga0496108_0004668 | |||
| 1294 | Ga0496108_0051101 | |||
| 1295 | Ga0496109_0001422 | |||
| 1296 | Ga0496109_0075249 | |||
| 1297 | Ga0496109_0124066 | |||
| 1298 | Ga0496109_0139182 | |||
| 1299 | Ga0496110_0007801 | |||
| 1300 | Ga0496110_0066341 | |||
| 1301 | Ga0496112_0000021 | |||
| 1302 | Ga0496112_0016788 | |||
| 1303 | Ga0496112_0083151 | |||
| 1304 | Ga0496113_0035351 | |||
| 1305 | Ga0496114_0031480 | |||
| 1306 | Ga0496114_0052030 | |||
| 1307 | Ga0496115_0024802 | |||
| 1308 | Ga0496115_0118727 | |||
| 1309 | Ga0496116_0001763 | |||
| 1310 | Ga0496117_0014868 | |||
| 1311 | Ga0496117_0097950 | |||
| 1312 | Ga0496119_0103888 | |||
| 1313 | Ga0496121_0000456 | |||
| 1314 | Ga0496121_0002176 | |||
| 1315 | Ga0496121_0011588 | |||
| 1316 | Ga0496121_0012754 | |||
| 1317 | Ga0496121_0020849 | |||
| 1318 | Ga0496121_0029820 | |||
| 1319 | Ga0496121_0037637 | |||
| 1320 | Ga0496121_0079745 | |||
| 1321 | Ga0496121_0112356 | |||
| 1322 | Ga0496123_0017337 | |||
| 1323 | Ga0496124_0000685 | |||
| 1324 | Ga0496125_0000272 | |||
| 1325 | Ga0496125_0000989 | |||
| 1326 | Ga0496125_0001801 | |||
| 1327 | Ga0496125_0009907 | |||
| 1328 | Ga0496125_0030914 | |||
| 1329 | Ga0496126_0002820 | |||
| 1330 | Ga0496126_0005738 | |||
| 1331 | Ga0496126_0008219 | |||
| 1332 | Ga0496126_0126537 | |||
| 1333 | Ga0501032_0038878 | |||
| 1334 | Ga0501033_0051209 | |||
| 1335 | Ga0501034_0000014 | |||
| 1336 | Ga0501034_0001979 | |||
| 1337 | Ga0501034_0020852 | |||
| 1338 | Ga0501034_0060557 | |||
| 1339 | Ga0501034_0124040 | |||
| 1340 | Ga0501036_0017923 | |||
| 1341 | Ga0501036_0141968 | |||
| 1342 | Ga0501036_0170879 | |||
| 1343 | Ga0501038_0006438 | |||
| 1344 | Ga0501038_0014198 | |||
| 1345 | Ga0501038_0020066 | |||
| 1346 | Ga0501038_0023427 | |||
| 1347 | Ga0501038_0071047 | |||
| 1348 | Ga0501039_0016255 | |||
| 1349 | Ga0501039_0023199 | |||
| 1350 | Ga0501040_0021130 | |||
| 1351 | Ga0501040_0095830 | |||
| 1352 | Ga0501041_0009549 | |||
| 1353 | Ga0501043_0011238 | |||
| 1354 | Ga0501043_0030206 | |||
| 1355 | Ga0501043_0045652 | |||
| 1356 | Ga0501043_0066790 | |||
| 1357 | Ga0501046_0000010 | |||
| 1358 | Ga0501046_0092355 | |||
| 1359 | Ga0501047_0086487 | |||
| 1360 | Ga0501048_0016008 | |||
| 1361 | Ga0501048_0038810 | |||
| 1362 | Ga0501067_0013183 | |||
| 1363 | Ga0501070_0021175 | |||
| 1364 | Ga0501070_0042255 | |||
| 1365 | Ga0501071_0015019 | |||
| 1366 | Ga0501077_0001622 | |||
| 1367 | Ga0501079_0057703 | |||
| 1368 | Ga0501081_0013419 | |||
| 1369 | Ga0501035_0026188 | |||
| 1370 | Ga0501035_0169119 | |||
| 1371 | Ga0501044_0008963 | |||
| 1372 | Ga0501044_0020639 | |||
| 1373 | Ga0501044_0021545 | |||
| 1374 | nmdc:mga03n38_504_c1 | |||
| 1375 | nmdc:mga0yw44_2983_c1 | |||
| 1376 | nmdc:mga06z11_13585_c1 | |||
| 1377 | nmdc:mga06z11_408_c1 | |||
| 1378 | nmdc:mga06z11_4197_c1 | |||
| 1379 | nmdc:mga04h51_2437_c1 | |||
| 1380 | nmdc:mga05p37_62746_c1 | |||
| 1381 | nmdc:mga09592_13262_c1 | |||
| 1382 | nmdc:mga0qj67_12305_c1 | |||
| 1383 | nmdc:mga0qj67_18367_c1 | |||
| 1384 | nmdc:mga0qj67_28059_c1 | |||
| 1385 | nmdc:mga06r32_2254_c1 | |||
| 1386 | nmdc:mga06r32_25498_c1 | |||
| 1387 | nmdc:mga06r32_28292_c1 | |||
| 1388 | nmdc:mga06r32_5374_c1 | |||
| 1389 | nmdc:mga08y16_156190_c1 | |||
| 1390 | nmdc:mga0n895_11235_c1 | |||
| 1391 | nmdc:mga0n895_39869_c1 | |||
| 1392 | nmdc:mga0n895_97089_c1 | |||
| 1393 | nmdc:mga0n895_99705_c1 | |||
| 1394 | nmdc:mga0rr50_3247_c1 | |||
| 1395 | Ga0495601_0020791 | |||
| 1396 | Ga0495612_0001804 | |||
| 1397 | Ga0495612_0006069 | |||
| 1398 | Ga0495595_0007295 | |||
| 1399 | Ga0495595_0020128 | |||
| 1400 | Ga0495619_0001276 | |||
| 1401 | Ga0495619_0002636 | |||
| 1402 | Ga0495619_0017934 | |||
| 1403 | Ga0500643_000032 | |||
| 1404 | Ga0500566_0000026 | |||
| 1405 | Ga0500566_0004175 | |||
| 1406 | Ga0500566_0004667 | |||
| 1407 | Ga0500556_0000004 | |||
| 1408 | Ga0500556_0000572 | |||
| 1409 | Ga0500556_0004181 | |||
| 1410 | Ga0500557_000015 | |||
| 1411 | Ga0500572_000172 | |||
| 1412 | Ga0500592_002666 | |||
| 1413 | Ga0500593_000023 | |||
| 1414 | Ga0500595_000324 | |||
| 1415 | Ga0500595_000438 | |||
| 1416 | Ga0500595_001427 | |||
| 1417 | Ga0500608_000894 | |||
| 1418 | Ga0500642_0000037 | |||
| 1419 | Ga0500642_0000102 | |||
| 1420 | Ga0500652_000276 | |||
| 1421 | Ga0500559_0000165 | |||
| 1422 | Ga0500559_0000633 | |||
| 1423 | Ga0500559_0000893 | |||
| 1424 | Ga0500568_0000001 | |||
| 1425 | Ga0500568_0001069 | |||
| 1426 | Ga0500603_000047 | |||
| 1427 | Ga0500603_000212 | |||
| 1428 | Ga0500604_0000351 | |||
| 1429 | Ga0500604_0007533 | |||
| 1430 | Ga0500616_0000014 | |||
| 1431 | Ga0500616_0002048 | |||
| 1432 | Ga0500616_0013482 | |||
| 1433 | Ga0500622_0000794 | |||
| 1434 | Ga0500622_0003193 | |||
| 1435 | Ga0500634_0000006 | |||
| 1436 | Ga0500638_045575 | |||
| 1437 | Ga0500639_000269 | |||
| 1438 | Ga0500636_0000538 | |||
| 1439 | Ga0500636_0001759 | |||
| 1440 | Ga0500637_0000088 | |||
| 1441 | Ga0500637_0000545 | |||
| 1442 | Ga0500637_0076115 | |||
| 1443 | Ga0500596_000058 | |||
| 1444 | Ga0500596_001468 | |||
| 1445 | Ga0500601_000048 | |||
| 1446 | Ga0500661_000025 | |||
| 1447 | Ga0501082_0016959 | |||
| 1448 | Ga0501082_0046261 | |||
| 1449 | Ga0530510_0053146 | |||
| 1450 | Ga0530510_0101991 | |||
| 1451 | 2507508522 | |||
| 1452 | 2508542587 | |||
| 1453 | 2508691641 | |||
| 1454 | 2508728424 | |||
| 1455 | 2509078432 | |||
| 1456 | 2509144370 | |||
| 1457 | 2509150944 | |||
| 1458 | 2511393499 | |||
| 1459 | 2513592413 | |||
| 1460 | 2513628006 | |||
| 1461 | 2513638900 | |||
| 1462 | 2513645773 | |||
| 1463 | 2513654789 | |||
| 1464 | 2513675892 | |||
| 1465 | 2513692593 | |||
| 1466 | 2513704834 | |||
| 1467 | 2513718627 | |||
| 1468 | 2513855790 | |||
| 1469 | 2513872830 | |||
| 1470 | 2513889179 | |||
| 1471 | 2513915031 | |||
| 1472 | 2514013591 | |||
| 1473 | 2515629829 | |||
| 1474 | 2517107499 | |||
| 1475 | 2517892328 | |||
| 1476 | 2524437423 | |||
| 1477 | 2524468941 | |||
| 1478 | 2524538585 | |||
| 1479 | 2528850013 | |||
| 1480 | 2585165630 | |||
| 1481 | 2603859517 | |||
| 1482 | 2617347452 | |||
| 1483 | 2617375705 | |||
| 1484 | 2643910693 | |||
| 1485 | 2643963371 | |||
| 1486 | 2644046494 | |||
| 1487 | 2644166038 | |||
| 1488 | 2644200847 | |||
| 1489 | 2644288744 | |||
| 1490 | 2644346956 | |||
| 1491 | 2644410525 | |||
| 1492 | 2644479284 | |||
| 1493 | 2644493337 | |||
| 1494 | 2644502332 | |||
| 1495 | 2644729254 | |||
| 1496 | 2644735108 | |||
| 1497 | 2644746947 | |||
| 1498 | 2671120424 | |||
| 1499 | 2723845021 | |||
| 1500 | 2728751127 | |||
| 1501 | 2745076586 | |||
| 1502 | 2776259647 | |||
| 1503 | 2793062343 | |||
| 1504 | 2793072329 | |||
| 1505 | 2793082111 | |||
| 1506 | 2805915272 | |||
| 1507 | 2818238823 | |||
| 1508 | 2819719687 | |||
| 1509 | 2824608035 | |||
| 1510 | 2824616594 | |||
| 1511 | 2824624160 | |||
| 1512 | 2824632750 | |||
| 1513 | 2824639758 | |||
| 1514 | 2824648136 | |||
| 1515 | 2824658699 | |||
| 1516 | 2824665748 | |||
| 1517 | 2824674803 | |||
| 1518 | 2824685998 | |||
| 1519 | 2824691221 | |||
| 1520 | 2824701359 | |||
| 1521 | 2824712362 | |||
| 1522 | 2824721149 | |||
| 1523 | 2824727897 | |||
| 1524 | 2824736682 | |||
| 1525 | 2824750169 | |||
| 1526 | 2824759505 | |||
| 1527 | 2824769887 | |||
| 1528 | 2824779442 | |||
| 1529 | 2828306610 | |||
| 1530 | 2835317902 | |||
| 1531 | 2838123677 | |||
| 1532 | 2841762313 | |||
| 1533 | 2841946679 | |||
| 1534 | 2841949777 | |||
| 1535 | 2841958730 | |||
| 1536 | 2841971718 | |||
| 1537 | 2841974932 | |||
| 1538 | 2841983499 | |||
| 1539 | 2842039002 | |||
| 1540 | 2842048051 | |||
| 1541 | 2842696240 | |||
| 1542 | 2844109851 | |||
| 1543 | 2844319147 | |||
| 1544 | 2847936278 | |||
| 1545 | 2847946627 | |||
| 1546 | 2849079251 | |||
| 1547 | 2851186880 | |||
| 1548 | 2851248326 | |||
| 1549 | 2857514247 | |||
| 1550 | 2857529080 | |||
| 1551 | 2874598121 | |||
| 1552 | 2874605263 | |||
| 1553 | 2874615474 | |||
| 1554 | 2874627766 | |||
| 1555 | 2874631924 | |||
| 1556 | 2874645834 | |||
| 1557 | 2876764099 | |||
| 1558 | 2876778401 | |||
| 1559 | 2876815220 | |||
| 1560 | 2876825730 | |||
| 1561 | 2879082195 | |||
| 1562 | 2879090645 | |||
| 1563 | 2879105852 | |||
| 1564 | 2879111256 | |||
| 1565 | 2879135342 | |||
| 1566 | 2879150551 | |||
| 1567 | 2881368775 | |||
| 1568 | 2881671223 | |||
| 1569 | 2884299842 | |||
| 1570 | 2885373218 | |||
| 1571 | 2885379483 | |||
| 1572 | 2885386546 | |||
| 1573 | 2885411427 | |||
| 1574 | 2888384132 | |||
| 1575 | 2888393736 | |||
| 1576 | 2888424597 | |||
| 1577 | 2889039774 | |||
| 1578 | 2893070521 | |||
| 1579 | 2894239688 | |||
| 1580 | 2903730989 | |||
| 1581 | 2903749362 | |||
| 1582 | 2903774125 | |||
| 1583 | 2904672914 | |||
| 1584 | 2904695893 | |||
| 1585 | 2904703526 | |||
| 1586 | 2904703963 | |||
| 1587 | 2904714717 | |||
| 1588 | 2906608230 | |||
| 1589 | 2906618698 | |||
| 1590 | 2906633337 | |||
| 1591 | 2906638862 | |||
| 1592 | 2906648225 | |||
| 1593 | 2906666305 | |||
| 1594 | 2908742622 | |||
| 1595 | 2908761195 | |||
| 1596 | 2908780246 | |||
| 1597 | 2909048215 | |||
| 1598 | 2917705064 | |||
| 1599 | 2919076480 | |||
| 1600 | 2922365422 | |||
| 1601 | 2922374467 | |||
| 1602 | 2922391030 | |||
| 1603 | 2922396161 | |||
| 1604 | 2922430358 | |||
| 1605 | 2929618131 | |||
| 1606 | 2929632319 | |||
| 1607 | 2932403361 | |||
| 1608 | 2932790424 | |||
| 1609 | 2932802718 | |||
| 1610 | 2932810844 | |||
| 1611 | 2932823824 | |||
| 1612 | 2932830054 | |||
| 1613 | 2933580059 | |||
| 1614 | 2935608946 | |||
| 1615 | 2935622719 | |||
| 1616 | 2935631602 | |||
| 1617 | 2935642481 | |||
| 1618 | 2935653351 | |||
| 1619 | 2935660178 | |||
| 1620 | 2935668215 | |||
| 1621 | 2935676246 | |||
| 1622 | 2935686323 | |||
| 1623 | 2935701141 | |||
| 1624 | 2935706076 | |||
| 1625 | 2935722342 | |||
| 1626 | 2935731629 | |||
| 1627 | 2935732237 | |||
| 1628 | 2935741616 | |||
| 1629 | 2935752288 | |||
| 1630 | 2935766570 | |||
| 1631 | 2935776942 | |||
| 1632 | 2935778593 | |||
| 1633 | 2935792258 | |||
| 1634 | 2935800421 | |||
| 1635 | 2935803074 | |||
| 1636 | 2935814391 | |||
| 1637 | 2935822106 | |||
| 1638 | 2935831528 | |||
| 1639 | 2935838388 | |||
| 1640 | 2935847688 | |||
| 1641 | 2935860968 | |||
| 1642 | 2935869695 | |||
| 1643 | 2935878886 | |||
| 1644 | 2935889810 | |||
| 1645 | 2935909040 | |||
| 1646 | 2935919760 | |||
| 1647 | 2935926386 | |||
| 1648 | 2935934836 | |||
| 1649 | 2935943286 | |||
| 1650 | 2935951724 | |||
| 1651 | 2935965779 | |||
| 1652 | 2935967849 | |||
| 1653 | 2935983812 | |||
| 1654 | 2935991653 | |||
| 1655 | 2935994717 | |||
| 1656 | 2936003359 | |||
| 1657 | 2936016221 | |||
| 1658 | 2936024854 | |||
| 1659 | 2936032102 | |||
| 1660 | 2936039947 | |||
| 1661 | 2936049963 | |||
| 1662 | 2936060915 | |||
| 1663 | 2937836998 | |||
| 1664 | 2940556910 | |||
| 1665 | 2941511396 | |||
| 1666 | 2941519097 | |||
| 1667 | 2941526323 | |||
| 1668 | 2941532884 | |||
| 1669 | 2941538944 | |||
| 1670 | 3005480279 | |||
| 1671 | 3005484385 | |||
| 1672 | 3005510386 | |||
| 1673 | 3005587982 | |||
| 1674 | 3005599298 | |||
| 1675 | 3005714976 | |||
| 1676 | 3005722381 | |||
| 1677 | 8001849792 | |||
| 1678 | 8006927083 | |||
| 1679 | 8006940605 | |||
| 1680 | 8006965808 | |||
| 1681 | 8006980294 | |||
| 1682 | 8006986460 | |||
| 1683 | 8006995971 | |||
| 1684 | 8016522263 | |||
| 1685 | 8016529550 | |||
| 1686 | 8016534762 | |||
| 1687 | 8016547981 | |||
| 1688 | 8016562528 | |||
| 1689 | 8016573112 | |||
| 1690 | 8016577256 | |||
| 1691 | 8016591673 | |||
| 1692 | 8016600317 | |||
| 1693 | 8016614504 | |||
| 1694 | 8016626495 | |||
| 1695 | 8016640260 | |||
| 1696 | 8017063294 | |||
| 1697 | 8019544942 | |||
| 1698 | 8019553590 | |||
| 1699 | 8019556673 | |||
| 1700 | 8019568636 | |||
| 1701 | 8019582728 | |||
| 1702 | 8019600836 | |||
| 1703 | 8019617718 | |||
| 1704 | 8019628246 | |||
| 1705 | 8019634380 | |||
| 1706 | 8019645352 | |||
| 1707 | 8019658479 | |||
| 1708 | 8019662259 | |||
| 1709 | 8019684327 | |||
| 1710 | 8019690143 | |||
| 1711 | 8055746280 | |||
| 1712 | 8056673804 | |||
| 1713 | 8056686714 | |||
| 1714 | 8056695268 | |||
| 1715 | 8056968098 | |||
| 1716 | 8057535531 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gro-assembly1.cif.gz_B | crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori | 0.9728 | 5 | 107 |
| 5gro-assembly1.cif.gz_B | crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori | 0.9635 | 5 | 107 |
| 6hhx-assembly1.cif.gz_A | structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)cytidine | 0.8937 | 5 | 582 |
| 7ap4-assembly1.cif.gz_A | thermus thermophilus aspartyl-trna synthetase in complex with compound asps7hmdda | 0.8937 | 5 | 582 |
| 6sjc-assembly1.cif.gz_A | structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)adenosine | 0.8921 | 2 | 582 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1l0wB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9782 | 5 | 110 | 2.40.50.140 |
| 5groB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9728 | 5 | 107 | 2.40.50.140 |
| 4o2dB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9726 | 5 | 108 | 2.40.50.140 |
| 1c0aA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9649 | 5 | 108 | 2.40.50.140 |
| 5groB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9635 | 5 | 107 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A440IP98-F1-model_v4 | deleted | 1.001 | 2 | 75 |
|
| AF-A0A2N7XT15-F1-model_v4 | Aspartate--tRNA ligase | 0.9928 | 417 | 498 |
GO:0004812
GO:0005524 GO:0006418 |
| AF-A0A848THE6-F1-model_v4 | Aspartate--tRNA ligase | 0.9878 | 1 | 83 |
GO:0003676
GO:0004815 GO:0005524 GO:0006422 |
| AF-A0A3M1FX05-F1-model_v4 | Aspartate--tRNA ligase | 0.986 | 1 | 80 |
GO:0003676
GO:0004815 GO:0005524 GO:0006422 |
| AF-A0A357X821-F1-model_v4 | deleted | 0.9852 | 1 | 150 |
|