F483744

General Info

Members Datasets Scaffolds Average Seq Length
858 584 1716 594

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000275|Ga0496104_0000275_26186_28183
Length 665
Sequence MADAKNPAKRGAAADAAPTGGALHRYRSHTCGALRKTDVGKPARLSGWVHRVRDHGGLLFIDLRDHYGLTQVVADPDSPAFKTAEAVRSEWVIRVDGAVRDRPVIDGKSTVNPELPTGEIEVVASXXXXLSAAKELPVPVFGEPDYPEDLRLQYRFLDLRRETLHANIMKRLEIIKSIRRRMHEAGFNEFATPILTASSPEGARDFLVPSRIHEGKFYALPQAPQQYKQLLMVSGFDRYFQIAPCFRDEDPRADRLPGEFYQLDVEMSFVEQADVFAAMEPVVTGVLEEFAGPAEGGQGKTKPVTKGWPRIPYDEAIRKYGSDKPDLRNPIEMADVTEHFRGSGFKVFAGMIEKDPKVRVWAIPAPGGGSRAFCDRMNGWAQTEGQPGLAYIFWRASTPAVSSDASGAKKGPKAPTQYSPMLAMLEGAGPVAKNLGPERTEALRAKLALGDNDAVFFAAGNPDKFYRFAGEARSKIGAELKLIKEDQFALAWIVDFPFYEWNEEEKKLDFSHNPFSMPQGGLEALEAAEASARASGTTEDYLKIKAYQYDIVCNGFEIASGGIRNHKPDTMVKAFGIVGLGPEVVEQRFGGMYRAFQYGAPPHGGMAAGIDRMVMLLVGAKNLREVALFPMNQQANDLLMGAPSEVAMKQLRELHIRVAAPERRG

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
59 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
60 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
61 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
80 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
81 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
82 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
129 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
130 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
131 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
132 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
158 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
173 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
294 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
295 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
296 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
297 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
298 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
299 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
300 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
301 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
302 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
307 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
311 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
312 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
313 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
314 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
315 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
316 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
317 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
320 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
321 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
322 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
323 2508501050 Microvirga lupini Lut6 Isolate Nodule
324 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
325 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
326 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
327 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
328 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
329 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
330 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
331 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
332 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
333 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
334 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
335 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
336 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
337 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
338 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
339 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
340 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
341 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
342 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
343 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
344 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
345 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
346 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
347 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
348 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
349 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
350 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
351 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
352 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
353 2643221580 Devosia sp. Root635 Isolate Unclassified
354 2643221591 Devosia sp. Root685 Isolate Unclassified
355 2643221607 Rhizobium sp. Root73 Isolate Unclassified
356 2643221629 Devosia sp. Root105 Isolate Unclassified
357 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
358 2643221651 Afipia sp. Root123D2 Isolate Unclassified
359 2643221662 Devosia sp. Root413D1 Isolate Unclassified
360 2643221674 Devosia sp. Root436 Isolate Unclassified
361 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
362 2643221688 Rhizobium sp. Root482 Isolate Unclassified
363 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
364 2643221733 Bosea sp. Root381 Isolate Unclassified
365 2643221734 Bosea sp. Root670 Isolate Unclassified
366 2643221736 Bosea sp. Root483D1 Isolate Unclassified
367 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
368 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
369 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
370 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
371 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
372 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
373 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
374 2791355199
375 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
376 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
377 2818991467 Bosea vestrisii 3192 Isolate Unclassified
378 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
379 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
380 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
381 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
382 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
383 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
384 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
385 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
386 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
387 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
388 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
389 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
390 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
391 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
392 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
393 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
394 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
395 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
396 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
397 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
398 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
399 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
400 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
401 2841760612 Bosea sp. Tri-49 Isolate Nodule
402 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
403 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
404 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
405 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
406 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
407 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
408 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
409 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
410 2842694124 Methylopila sp. R-72369 Isolate Unclassified
411 2844104063 Bosea sp. Tri-39 Isolate Nodule
412 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
413 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
414 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
415 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
416 2851182111 Bosea sp. Tri-44 Isolate Nodule
417 2851246043 Bosea sp. Tri-54 Isolate Nodule
418 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
419 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
420 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
421 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
422 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
423 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
424 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
425 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
426 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
427 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
428 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
429 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
430 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
431 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
432 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
433 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
434 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
435 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
436 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
437 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
438 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
439 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
440 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
441 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
442 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
443 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
444 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
445 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
446 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
447 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
448 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
449 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
450 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
451 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
452 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
453 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
454 2904699407
455 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
456 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
457 2906610324
458 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
459 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
460 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
461 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
462 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
463 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
464 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
465 2909042592 Labrys sp. LIt4 Isolate Nodule
466 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
467 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
468 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
469 2922368715
470 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
471 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
472 2922425934
473 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
474 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
475 2932401849 Devosia sp. 2618 Isolate Rhizosphere
476 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
477 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
478 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
479 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
480 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
481 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
482 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
483 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
484 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
485 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
486 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
487 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
488 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
489 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
490 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
491 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
492 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
493 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
494 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
495 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
496 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
497 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
498 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
499 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
500 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
501 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
502 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
503 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
504 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
505 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
506 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
507 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
508 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
509 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
510 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
511 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
512 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
513 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
514 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
515 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
516 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
517 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
518 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
519 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
520 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
521 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
522 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
523 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
524 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
525 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
526 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
527 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
528 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
529 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
530 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
531 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
532 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
533 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
534 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
535 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
536 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
537 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
538 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
539 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
540 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
541 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
542 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
543 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
544 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
545 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
546 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
547 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
548 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
549 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
550 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
551 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
552 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
553 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
554 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
555 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
556 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
557 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
558 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
559 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
560 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
561 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
562 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
563 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
564 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
565 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
566 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
567 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
568 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
569 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
570 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
571 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
572 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
573 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
574 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
575 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
576 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
577 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
578 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
579 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
580 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
581 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
582 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
583 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
584 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.37
Metatranscriptomes 0.12
Isolates 30.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.84
Nodule 22.61
Rhizoplane 4.43
Rhizosphere 47.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0000275 3300048907 Bacteria 45789
2 JGI24737J22298_10004391 3300001990 Bacteria 4919
3 JGI25151J46595_10000114 3300003187 Bacteria 107534
4 JGI25151J46595_10000345 3300003187 Bacteria 49779
5 JGI25406J46586_10000104 3300003203 Bacteria 37774
6 JGI25406J46586_10001599 3300003203 Bacteria 10686
7 JGI25165J46597_1002951 3300003214 Bacteria 4752
8 JGI25153J46596_10001106 3300003215 Bacteria 16363
9 JGI25160J50197_1009619 3300003354 Bacteria 3567
10 Ga0055526_1000395 3300003771 Bacteria 35228
11 Ga0055526_1001058 3300003771 Bacteria 20113
12 Ga0055524_1000020 3300003775 Bacteria 227971
13 Ga0065165_1000240 3300005262 Bacteria 93895
14 Ga0065165_1001349 3300005262 Bacteria 27140
15 Ga0065165_1001593 3300005262 Bacteria 23304
16 Ga0070676_10005386 3300005328 Bacteria 6816
17 Ga0070666_10012047 3300005335 Bacteria 5444
18 Ga0070680_100081740 3300005336 Bacteria 2666
19 Ga0070682_100007542 3300005337 Bacteria 6131
20 Ga0068868_100007248 3300005338 Bacteria 7885
21 Ga0070691_10008708 3300005341 Bacteria 4645
22 Ga0070668_100014987 3300005347 Bacteria 5791
23 Ga0070669_100003763 3300005353 Bacteria 10957
24 Ga0070671_100076617 3300005355 Bacteria 2794
25 Ga0070659_100022039 3300005366 Bacteria 4861
26 Ga0070659_100088124 3300005366 Bacteria 2485
27 Ga0070709_10002085 3300005434 Bacteria 10828
28 Ga0070710_10000842 3300005437 Bacteria 14763
29 Ga0070711_100046378 3300005439 Bacteria 2961
30 Ga0070705_100001270 3300005440 Bacteria 13596
31 Ga0070694_100002981 3300005444 Bacteria 10062
32 Ga0070694_100052535 3300005444 Bacteria 2755
33 Ga0070678_100033408 3300005456 Bacteria 3571
34 Ga0070699_100000313 3300005518 Bacteria 46877
35 Ga0070679_100036158 3300005530 Bacteria 4900
36 Ga0068853_100003443 3300005539 Bacteria 12106
37 Ga0070695_100001796 3300005545 Bacteria 12091
38 Ga0070696_100000471 3300005546 Bacteria 25273
39 Ga0070704_100012520 3300005549 Bacteria 5239
40 Ga0068855_100025861 3300005563 Bacteria 7019
41 Ga0068857_100005529 3300005577 Bacteria 10781
42 Ga0068857_100005939 3300005577 Bacteria 10426
43 Ga0068857_100034904 3300005577 Bacteria 4450
44 Ga0068856_100000082 3300005614 Bacteria 88302
45 Ga0068856_100041732 3300005614 Bacteria 4510
46 Ga0068852_100034172 3300005616 Bacteria 4228
47 Ga0068852_100048627 3300005616 Bacteria 3624
48 Ga0068859_100096721 3300005617 Bacteria 3005
49 Ga0068864_100125527 3300005618 Bacteria 2299
50 Ga0068861_100032708 3300005719 Bacteria 3832
51 Ga0068851_10001427 3300005834 Bacteria 10459
52 Ga0068851_10002938 3300005834 Bacteria 7531
53 Ga0068851_10003776 3300005834 Bacteria 6774
54 Ga0068858_100027234 3300005842 Bacteria 5311
55 Ga0068860_100000316 3300005843 Bacteria 65709
56 Ga0068860_100013358 3300005843 Bacteria 8050
57 Ga0081455_10000194 3300005937 Bacteria 77128
58 Ga0081455_10002419 3300005937 Bacteria 22263
59 Ga0081455_10002827 3300005937 Bacteria 20442
60 Ga0081455_10003658 3300005937 Bacteria 17616
61 Ga0081455_10081964 3300005937 Bacteria 2640
62 Ga0081538_10012272 3300005981 Bacteria 6878
63 Ga0081540_1000032 3300005983 Bacteria 144522
64 Ga0081540_1002092 3300005983 Bacteria 16629
65 Ga0081540_1006870 3300005983 Bacteria 8212
66 Ga0081540_1016557 3300005983 Bacteria 4606
67 Ga0081540_1028208 3300005983 Bacteria 3159
68 Ga0081539_10000273 3300005985 Bacteria 117936
69 Ga0081539_10000735 3300005985 Bacteria 65597
70 Ga0081539_10018005 3300005985 Bacteria 4927
71 Ga0081539_10036063 3300005985 Bacteria 2964
72 Ga0081539_10039885 3300005985 Bacteria 2765
73 Ga0070717_10000729 3300006028 Bacteria 21406
74 Ga0070717_10004095 3300006028 Bacteria 10520
75 Ga0075365_10024876 3300006038 Bacteria 3784
76 Ga0075365_10027613 3300006038 Bacteria 3613
77 Ga0075363_100001173 3300006048 Bacteria 9629
78 Ga0070716_100009239 3300006173 Bacteria 4913
79 Ga0075367_10010285 3300006178 Bacteria 4911
80 Ga0075367_10010355 3300006178 Bacteria 4897
81 Ga0075367_10030943 3300006178 Bacteria 3072
82 Ga0075370_10033054 3300006353 Bacteria 2894
83 Ga0075430_100004577 3300006846 Bacteria 11640
84 Ga0075430_100071354 3300006846 Bacteria 2913
85 Ga0075431_100001890 3300006847 Bacteria 19851
86 Ga0075431_100038293 3300006847 Bacteria 4937
87 Ga0075431_100136956 3300006847 Bacteria 2524
88 Ga0075433_10126425 3300006852 Bacteria 2270
89 Ga0075434_100034833 3300006871 Bacteria 4974
90 Ga0075434_100039736 3300006871 Bacteria 4660
91 Ga0075434_100043875 3300006871 Bacteria 4435
92 Ga0097620_100096717 3300006931 Bacteria 3005
93 Ga0099825_1028727 3300006941 Bacteria 2669
94 Ga0099824_1022420 3300006942 Bacteria 4169
95 Ga0099822_1017281 3300006943 Bacteria 7741
96 Ga0099823_1008783 3300006944 Bacteria 10273
97 Ga0075435_100003830 3300007076 Bacteria 10261
98 Ga0105240_10007507 3300009093 Bacteria 15822
99 Ga0105240_10010434 3300009093 Bacteria 13050
100 Ga0105240_10012340 3300009093 Bacteria 11801
101 Ga0111539_10104371 3300009094 Bacteria 3325
102 Ga0105245_10018726 3300009098 Bacteria 6057
103 Ga0105247_10027479 3300009101 Bacteria 3440
104 Ga0114129_10047185 3300009147 Bacteria 6054
105 Ga0114129_10136930 3300009147 Bacteria 3359
106 Ga0114129_10239133 3300009147 Bacteria 2441
107 Ga0105243_10088601 3300009148 Bacteria 2543
108 Ga0105237_10040828 3300009545 Bacteria 4679
109 Ga0105237_10132437 3300009545 Bacteria 2487
110 Ga0105238_10001837 3300009551 Bacteria 21282
111 Ga0105238_10047470 3300009551 Bacteria 4329
112 Ga0105238_10048472 3300009551 Bacteria 4281
113 Ga0105238_10077428 3300009551 Bacteria 3317
114 Ga0105249_10096671 3300009553 Bacteria 2772
115 Ga0105239_10115636 3300010375 Bacteria 2976
116 Ga0105239_10143534 3300010375 Bacteria 2661
117 Ga0105239_10156886 3300010375 Bacteria 2542
118 Ga0157369_10019813 3300013105 Bacteria 7528
119 Ga0157369_10078362 3300013105 Bacteria 3540
120 Ga0171462_1022 3300013250 Bacteria 141292
121 Ga0157374_10021003 3300013296 Bacteria 5802
122 Ga0157374_10088980 3300013296 Bacteria 2941
123 Ga0163162_10037819 3300013306 Bacteria 4816
124 Ga0163162_10157383 3300013306 Bacteria 2392
125 Ga0157372_10024593 3300013307 Bacteria 6545
126 Ga0157375_10012645 3300013308 Bacteria 7490
127 Ga0214544_1000002 3300021320 Bacteria 753857
128 Ga0214542_1000001 3300021321 Bacteria 1018696
129 Ga0214545_1000001 3300021324 Bacteria 1092817
130 Ga0214545_1029110 3300021324 Bacteria 2536
131 Ga0214543_1000001 3300021327 Bacteria 776921
132 Ga0213874_10002243 3300021377 Bacteria 4118
133 Ga0213876_10001406 3300021384 Bacteria 14999
134 Ga0213876_10057034 3300021384 Bacteria 2062
135 Ga0213871_10004850 3300021441 Bacteria 2727
136 Ga0207427_101831 3300025231 Bacteria 6780
137 Ga0209677_100507 3300025253 Bacteria 21817
138 Ga0209148_1000289 3300025254 Bacteria 75390
139 Ga0209233_1002026 3300025261 Bacteria 7675
140 Ga0209455_1003622 3300025272 Bacteria 5375
141 Ga0209673_1021481 3300025273 Bacteria 2256
142 Ga0209130_1000061 3300025284 Bacteria 200990
143 Ga0209675_1001320 3300025291 Bacteria 14713
144 Ga0209025_1000008 3300025294 Bacteria 1130876
145 Ga0209025_1001935 3300025294 Bacteria 23940
146 Ga0209025_1015731 3300025294 Bacteria 4532
147 Ga0209564_1000049 3300025295 Bacteria 362075
148 Ga0209564_1000054 3300025295 Bacteria 350653
149 Ga0209758_1000160 3300025297 Bacteria 154304
150 Ga0209758_1000219 3300025297 Bacteria 124186
151 Ga0209758_1007950 3300025297 Bacteria 7030
152 Ga0209758_1016520 3300025297 Bacteria 3743
153 Ga0209758_1027905 3300025297 Bacteria 2402
154 Ga0209256_1000014 3300025299 Bacteria 687409
155 Ga0209256_1003910 3300025299 Bacteria 9850
156 Ga0207426_1000705 3300025302 Bacteria 39483
157 Ga0207426_1000986 3300025302 Bacteria 27952
158 Ga0207426_1004854 3300025302 Bacteria 6370
159 Ga0207656_10001566 3300025321 Bacteria 7600
160 Ga0207656_10003271 3300025321 Bacteria 5548
161 Ga0207653_10002045 3300025885 Bacteria 6427
162 Ga0207692_10000244 3300025898 Bacteria 18518
163 Ga0207692_10000420 3300025898 Bacteria 14869
164 Ga0207647_10015806 3300025904 Bacteria 5165
165 Ga0207699_10002274 3300025906 Bacteria 9062
166 Ga0207699_10007307 3300025906 Bacteria 5397
167 Ga0207699_10009196 3300025906 Bacteria 4909
168 Ga0207643_10039285 3300025908 Bacteria 2662
169 Ga0207654_10004487 3300025911 Bacteria 7047
170 Ga0207707_10002881 3300025912 Bacteria 15359
171 Ga0207707_10090385 3300025912 Bacteria 2676
172 Ga0207695_10000015 3300025913 Bacteria 803205
173 Ga0207695_10004042 3300025913 Bacteria 20184
174 Ga0207695_10021791 3300025913 Bacteria 7299
175 Ga0207695_10191664 3300025913 Bacteria 1962
176 Ga0207671_10011502 3300025914 Bacteria 7192
177 Ga0207693_10000095 3300025915 Bacteria 78764
178 Ga0207693_10024287 3300025915 Bacteria 4812
179 Ga0207663_10057945 3300025916 Bacteria 2443
180 Ga0207660_10026805 3300025917 Bacteria 3927
181 Ga0207657_10007732 3300025919 Bacteria 10976
182 Ga0207649_10001722 3300025920 Bacteria 12581
183 Ga0207652_10133466 3300025921 Bacteria 2216
184 Ga0207694_10000082 3300025924 Bacteria 109787
185 Ga0207694_10012755 3300025924 Bacteria 6332
186 Ga0207664_10008276 3300025929 Bacteria 7245
187 Ga0207664_10063181 3300025929 Bacteria 2959
188 Ga0207706_10157034 3300025933 Bacteria 2000
189 Ga0207665_10000133 3300025939 Bacteria 49199
190 Ga0207665_10018020 3300025939 Bacteria 4639
191 Ga0207661_10001725 3300025944 Bacteria 14953
192 Ga0207667_10006555 3300025949 Bacteria 14082
193 Ga0207667_10023099 3300025949 Bacteria 6851
194 Ga0207667_10051742 3300025949 Bacteria 4328
195 Ga0207640_10003022 3300025981 Bacteria 9049
196 Ga0207678_10060660 3300026067 Bacteria 3253
197 Ga0207678_10133251 3300026067 Bacteria 2120
198 Ga0207702_10000002 3300026078 Bacteria 491507
199 Ga0207702_10000048 3300026078 Bacteria 143125
200 Ga0207676_10115078 3300026095 Bacteria 2257
201 Ga0207674_10001889 3300026116 Bacteria 26658
202 Ga0207674_10002361 3300026116 Bacteria 23864
203 Ga0207674_10042826 3300026116 Bacteria 4672
204 Ga0207683_10140204 3300026121 Bacteria 2178
205 Ga0207698_10052853 3300026142 Bacteria 3114
206 Ga0209389_1000008 3300027296 Bacteria 227385
207 Ga0209389_1000081 3300027296 Bacteria 89601
208 Ga0209589_1000001 3300027357 Bacteria 794224
209 Ga0209589_1000091 3300027357 Bacteria 89601
210 Ga0209489_100001 3300027361 Bacteria 794224
211 Ga0209489_100096 3300027361 Bacteria 122075
212 Ga0209489_100333 3300027361 Bacteria 82975
213 Ga0209700_100001 3300027363 Bacteria 794224
214 Ga0209700_100062 3300027363 Bacteria 145471
215 Ga0209588_1004092 3300027671 Bacteria 4087
216 Ga0209813_10000356 3300027866 Bacteria 11659
217 Ga0209813_10003767 3300027866 Bacteria 3576
218 Ga0207428_10062905 3300027907 Bacteria 2933
219 Ga0268266_10003536 3300028379 Bacteria 15508
220 Ga0268266_10008761 3300028379 Bacteria 8966
221 Ga0268266_10019220 3300028379 Bacteria 5818
222 Ga0268265_10000550 3300028380 Bacteria 38199
223 Ga0268264_10000430 3300028381 Bacteria 58144
224 Ga0268264_10005052 3300028381 Bacteria 11170
225 Ga0265319_1002587 3300028563 Bacteria 9756
226 Ga0265336_10000474 3300028666 Bacteria 23860
227 Ga0307517_10001000 3300028786 Bacteria 47916
228 Ga0307515_10000070 3300028794 Bacteria 239322
229 Ga0307515_10029530 3300028794 Bacteria 9260
230 Ga0307515_10068290 3300028794 Bacteria 4885
231 Ga0265338_10000086 3300028800 Bacteria 175026
232 Ga0265330_10032435 3300031235 Bacteria 2340
233 Ga0265325_10009592 3300031241 Bacteria 5651
234 Ga0265340_10001336 3300031247 Bacteria 14132
235 Ga0265339_10000418 3300031249 Bacteria 33621
236 Ga0307513_10015483 3300031456 Bacteria 9245
237 Ga0307513_10062401 3300031456 Bacteria 3939
238 Ga0307509_10133747 3300031507 Bacteria 2430
239 Ga0265313_10000154 3300031595 Bacteria 71077
240 Ga0307508_10000009 3300031616 Bacteria 256966
241 Ga0316575_10004011 3300031665 Bacteria 5156
242 Ga0265314_10017894 3300031711 Bacteria 5548
243 Ga0316576_10015722 3300031727 Bacteria 5086
244 Ga0316576_10033406 3300031727 Bacteria 3662
245 Ga0307516_10006964 3300031730 Bacteria 13112
246 Ga0307516_10030994 3300031730 Bacteria 5393
247 Ga0307409_100107547 3300031995 Bacteria 2330
248 Ga0307414_10026840 3300032004 Bacteria 3711
249 Ga0316583_10011778 3300032133 Bacteria 3155
250 Ga0315911_1000001 3300033442 Bacteria 1088602
251 Ga0373934_0003946 3300035086 Bacteria 5455
252 Ga0373923_0011642 3300035111 Bacteria 3234
253 Ga0373923_0023401 3300035111 Bacteria 2430
254 Ga0373953_0000473 3300035117 Bacteria 11091
255 Ga0373953_0001627 3300035117 Bacteria 6576
256 Ga0373954_0000442 3300035118 Bacteria 15520
257 Ga0373956_0006981 3300035119 Bacteria 4540
258 Ga0373956_0014148 3300035119 Bacteria 3328
259 Ga0373957_0012131 3300035120 Bacteria 2893
260 Ga0373943_0003057 3300035170 Bacteria 7600
261 Ga0373955_0000840 3300035172 Bacteria 13157
262 Ga0373955_0006897 3300035172 Bacteria 5193
263 Ga0373962_0002428 3300035242 Bacteria 4433
264 Ga0373931_0004195 3300035691 Bacteria 6562
265 Ga0373931_0019032 3300035691 Bacteria 3423
266 Ga0373935_0001167 3300035692 Bacteria 14418
267 Ga0373935_0035945 3300035692 Bacteria 3094
268 Ga0373933_0000041 3300035724 Bacteria 79805
269 Ga0373933_0000563 3300035724 Bacteria 23152
270 Ga0373933_0002868 3300035724 Bacteria 9630
271 Ga0373937_0002003 3300036401 Bacteria 17035
272 Ga0373937_0014572 3300036401 Bacteria 6943
273 Ga0373937_0018505 3300036401 Bacteria 6222
274 Ga0373937_0046509 3300036401 Bacteria 3969
275 Ga0372808_004186 3300036459 Bacteria 1824
276 Ga0316582_0014990 3300036647 Bacteria 4417
277 Ga0316584_0003478 3300036712 Bacteria 10245
278 Ga0373925_0004654 3300037068 Bacteria 10358
279 Ga0373925_0028798 3300037068 Bacteria 4072
280 Ga0373925_0050715 3300037068 Bacteria 3096
281 Ga0395899_0108442 3300037312 Bacteria 1998
282 Ga0395900_0001685 3300037418 Bacteria 25715
283 Ga0395900_0033546 3300037418 Bacteria 5282
284 Ga0395900_0037966 3300037418 Bacteria 4966
285 Ga0395898_0010109 3300037466 Bacteria 9876
286 Ga0395905_0007972 3300037471 Bacteria 10471
287 Ga0395905_0012612 3300037471 Bacteria 8130
288 Ga0395905_0024541 3300037471 Bacteria 5689
289 Ga0316581_0002606 3300037588 Bacteria 4347
290 Ga0436364_0138611 3300037853 Bacteria 21368
291 Ga0436364_0485287 3300037853 Bacteria 2011
292 Ga0395901_0004712 3300038443 Bacteria 13766
293 Ga0395901_0030320 3300038443 Bacteria 5572
294 Ga0436365_0286964 3300039437 Bacteria 64806
295 Ga0436365_1628681 3300039437 Bacteria 6564
296 Ga0436365_1651055 3300039437 Bacteria 2075
297 Ga0436361_0915560 3300039447 Bacteria 1891
298 Ga0436363_1213338 3300039450 Bacteria 3256
299 Ga0436363_1572654 3300039450 Bacteria 24478
300 Ga0436362_0566207 3300039453 Bacteria 11383
301 Ga0466972_0000216 3300044658 Bacteria 40702
302 Ga0466966_0000495 3300044684 Bacteria 25298
303 Ga0466961_0000937 3300044693 Bacteria 18072
304 Ga0466963_0020140 3300044694 Bacteria 4193
305 Ga0466957_0041929 3300044842 Bacteria 2768
306 Ga0466960_0007789 3300044901 Bacteria 4367
307 Ga0466959_0018432 3300045049 Bacteria 5124
308 Ga0466967_0017095 3300045976 Bacteria 5745
309 Ga0495592_0005090 3300046454 Bacteria 9683
310 Ga0495592_0018842 3300046454 Bacteria 5256
311 Ga0495592_0022433 3300046454 Bacteria 4804
312 Ga0495603_0000329 3300046455 Bacteria 25682
313 Ga0495603_0005330 3300046455 Bacteria 7670
314 Ga0495629_0000355 3300046459 Bacteria 39013
315 Ga0495629_0008864 3300046459 Bacteria 7396
316 Ga0495629_0011318 3300046459 Bacteria 6481
317 Ga0495629_0034923 3300046459 Bacteria 3554
318 Ga0495629_0036301 3300046459 Bacteria 3480
319 Ga0495651_0000265 3300046462 Bacteria 40572
320 Ga0495651_0002687 3300046462 Bacteria 13795
321 Ga0495651_0015524 3300046462 Bacteria 5892
322 Ga0495651_0029989 3300046462 Bacteria 4241
323 Ga0495651_0043715 3300046462 Bacteria 3474
324 Ga0495653_0037314 3300046463 Bacteria 3819
325 Ga0495653_0039788 3300046463 Bacteria 3680
326 Ga0495582_0005216 3300046473 Bacteria 7270
327 Ga0495582_0013187 3300046473 Bacteria 4548
328 Ga0495639_0000061 3300046475 Bacteria 48670
329 Ga0495662_0000437 3300046476 Bacteria 18723
330 Ga0495664_0008477 3300046477 Bacteria 5736
331 Ga0495664_0011752 3300046477 Bacteria 4943
332 Ga0495664_0020019 3300046477 Bacteria 3855
333 Ga0495594_0002652 3300046499 Bacteria 9308
334 Ga0495606_0005142 3300046507 Bacteria 12689
335 Ga0495608_0000435 3300046511 Bacteria 29113
336 Ga0495608_0005163 3300046511 Bacteria 9327
337 Ga0495608_0009473 3300046511 Bacteria 6804
338 Ga0495608_0045193 3300046511 Bacteria 2937
339 Ga0495616_0022794 3300046513 Bacteria 3377
340 Ga0495628_0018503 3300046516 Bacteria 5768
341 Ga0495628_0021620 3300046516 Bacteria 5290
342 Ga0495628_0048492 3300046516 Bacteria 3366
343 Ga0495648_0002320 3300046524 Bacteria 17720
344 Ga0495648_0014791 3300046524 Bacteria 5686
345 Ga0495652_0001766 3300046529 Bacteria 23183
346 Ga0495652_0002339 3300046529 Bacteria 19668
347 Ga0495652_0024014 3300046529 Bacteria 5400
348 Ga0495652_0038161 3300046529 Bacteria 4163
349 Ga0495654_0008815 3300046530 Bacteria 5550
350 Ga0495665_0000414 3300046531 Bacteria 21734
351 Ga0495640_0000826 3300046533 Bacteria 23573
352 Ga0495640_0007059 3300046533 Bacteria 8841
353 Ga0495640_0009783 3300046533 Bacteria 7449
354 Ga0495640_0020350 3300046533 Bacteria 4886
355 Ga0495640_0027153 3300046533 Bacteria 4132
356 Ga0495586_0038836 3300046535 Bacteria 2559
357 Ga0495587_0002595 3300046536 Bacteria 12066
358 Ga0495587_0007158 3300046536 Bacteria 7239
359 Ga0495587_0010142 3300046536 Bacteria 6009
360 Ga0495587_0073069 3300046536 Bacteria 1993
361 Ga0495645_0007922 3300046543 Bacteria 7393
362 Ga0495645_0011015 3300046543 Bacteria 6354
363 Ga0495645_0047289 3300046543 Bacteria 3135
364 Ga0495667_0000817 3300046559 Bacteria 20052
365 Ga0495667_0001528 3300046559 Bacteria 15306
366 Ga0495667_0013389 3300046559 Bacteria 5552
367 Ga0495668_0025684 3300046616 Bacteria 3345
368 Ga0495634_0000762 3300046642 Bacteria 31177
369 Ga0495634_0002573 3300046642 Bacteria 14976
370 Ga0495634_0008744 3300046642 Bacteria 7506
371 Ga0495625_0039677 3300046660 Bacteria 3437
372 Ga0495635_0000187 3300046663 Bacteria 39002
373 Ga0495635_0001091 3300046663 Bacteria 18022
374 Ga0495657_0020860 3300046675 Bacteria 4709
375 Ga0495599_0015434 3300046678 Bacteria 4740
376 Ga0495599_0020518 3300046678 Bacteria 4115
377 Ga0495623_0005149 3300046679 Bacteria 8581
378 Ga0495623_0025428 3300046679 Bacteria 3814
379 Ga0495623_0028344 3300046679 Bacteria 3602
380 Ga0495646_0005680 3300046680 Bacteria 7901
381 Ga0495646_0013741 3300046680 Bacteria 5147
382 Ga0495646_0018205 3300046680 Bacteria 4448
383 Ga0495646_0022600 3300046680 Bacteria 3966
384 Ga0495658_0000047 3300046683 Bacteria 59626
385 Ga0495658_0016600 3300046683 Bacteria 3790
386 Ga0495613_0002415 3300046689 Bacteria 14130
387 Ga0495624_0000188 3300046690 Bacteria 46706
388 Ga0495670_0034645 3300046691 Bacteria 2515
389 Ga0495600_0005291 3300046809 Bacteria 7775
390 Ga0495600_0013208 3300046809 Bacteria 5184
391 Ga0495600_0059430 3300046809 Bacteria 2497
392 Ga0495581_0000705 3300047315 Bacteria 17570
393 Ga0495604_0000118 3300047317 Bacteria 66698
394 Ga0495604_0008523 3300047317 Bacteria 8095
395 Ga0495604_0031356 3300047317 Bacteria 4215
396 Ga0495674_0001402 3300047319 Bacteria 23571
397 Ga0495674_0002109 3300047319 Bacteria 19517
398 Ga0495674_0011338 3300047319 Bacteria 8415
399 Ga0495674_0039692 3300047319 Bacteria 4217
400 Ga0495674_0127720 3300047319 Bacteria 2144
401 Ga0495680_0005405 3300047322 Bacteria 12029
402 Ga0495680_0006280 3300047322 Bacteria 11069
403 Ga0495680_0006879 3300047322 Bacteria 10499
404 Ga0495675_0001383 3300047444 Bacteria 14711
405 Ga0495675_0023118 3300047444 Bacteria 3961
406 Ga0495684_0001482 3300047471 Bacteria 18783
407 Ga0495684_0036877 3300047471 Bacteria 3748
408 Ga0495684_0042883 3300047471 Bacteria 3464
409 Ga0495684_0043497 3300047471 Bacteria 3439
410 Ga0495684_0100156 3300047471 Bacteria 2191
411 Ga0495593_0000616 3300047673 Bacteria 20328
412 Ga0495593_0005166 3300047673 Bacteria 7717
413 Ga0495602_0006478 3300048088 Bacteria 12283
414 Ga0495602_0021287 3300048088 Bacteria 6388
415 Ga0495602_0052016 3300048088 Bacteria 3642
416 Ga0496102_0005226 3300048905 Bacteria 11023
417 Ga0496102_0015089 3300048905 Bacteria 6726
418 Ga0496102_0098128 3300048905 Bacteria 2718
419 Ga0496104_0016718 3300048907 Bacteria 6669
420 Ga0496104_0053795 3300048907 Bacteria 3805
421 Ga0496104_0133984 3300048907 Bacteria 2380
422 Ga0496105_0004479 3300048908 Bacteria 10516
423 Ga0496105_0035771 3300048908 Bacteria 4089
424 Ga0496105_0039509 3300048908 Bacteria 3889
425 Ga0496106_0000477 3300048909 Bacteria 28442
426 Ga0496106_0001639 3300048909 Bacteria 16799
427 Ga0496106_0005089 3300048909 Bacteria 9734
428 Ga0496106_0023152 3300048909 Bacteria 4614
429 Ga0496106_0024067 3300048909 Bacteria 4527
430 Ga0496107_0002282 3300048910 Bacteria 12380
431 Ga0496107_0003815 3300048910 Bacteria 10124
432 Ga0496107_0005766 3300048910 Bacteria 8472
433 Ga0496107_0010725 3300048910 Bacteria 6374
434 Ga0496108_0004243 3300048911 Bacteria 11544
435 Ga0496108_0004668 3300048911 Bacteria 11040
436 Ga0496108_0051101 3300048911 Bacteria 3463
437 Ga0496109_0001422 3300048912 Bacteria 19864
438 Ga0496109_0075249 3300048912 Bacteria 3104
439 Ga0496109_0124066 3300048912 Bacteria 2407
440 Ga0496109_0139182 3300048912 Bacteria 2269
441 Ga0496110_0007801 3300048913 Bacteria 8576
442 Ga0496110_0066341 3300048913 Bacteria 3192
443 Ga0496112_0000021 3300048915 Bacteria 156561
444 Ga0496112_0016788 3300048915 Bacteria 6866
445 Ga0496112_0083151 3300048915 Bacteria 3166
446 Ga0496113_0035351 3300048916 Bacteria 3653
447 Ga0496114_0031480 3300048917 Bacteria 4365
448 Ga0496114_0052030 3300048917 Bacteria 3411
449 Ga0496115_0024802 3300048918 Bacteria 4664
450 Ga0496115_0118727 3300048918 Bacteria 2175
451 Ga0496116_0001763 3300048919 Bacteria 23588
452 Ga0496117_0014868 3300048920 Bacteria 6678
453 Ga0496117_0097950 3300048920 Bacteria 1866
454 Ga0496119_0103888 3300048922 Bacteria 1590
455 Ga0496121_0000456 3300048924 Bacteria 80536
456 Ga0496121_0002176 3300048924 Bacteria 30692
457 Ga0496121_0011588 3300048924 Bacteria 9761
458 Ga0496121_0012754 3300048924 Bacteria 9105
459 Ga0496121_0020849 3300048924 Bacteria 6457
460 Ga0496121_0029820 3300048924 Bacteria 5028
461 Ga0496121_0037637 3300048924 Bacteria 4294
462 Ga0496121_0079745 3300048924 Bacteria 2598
463 Ga0496121_0112356 3300048924 Bacteria 2075
464 Ga0496123_0017337 3300048926 Bacteria 5799
465 Ga0496124_0000685 3300048927 Bacteria 55748
466 Ga0496125_0000272 3300048928 Bacteria 105490
467 Ga0496125_0000989 3300048928 Bacteria 44313
468 Ga0496125_0001801 3300048928 Bacteria 29601
469 Ga0496125_0009907 3300048928 Bacteria 9690
470 Ga0496125_0030914 3300048928 Bacteria 4780
471 Ga0496126_0002820 3300048929 Bacteria 22789
472 Ga0496126_0005738 3300048929 Bacteria 14053
473 Ga0496126_0008219 3300048929 Bacteria 11286
474 Ga0496126_0126537 3300048929 Bacteria 2211
475 Ga0501032_0038878 3300049569 Bacteria 3239
476 Ga0501033_0051209 3300049570 Bacteria 3060
477 Ga0501034_0000014 3300049571 Bacteria 297798
478 Ga0501034_0001979 3300049571 Bacteria 25958
479 Ga0501034_0020852 3300049571 Bacteria 6688
480 Ga0501034_0060557 3300049571 Bacteria 3802
481 Ga0501034_0124040 3300049571 Bacteria 2568
482 Ga0501036_0017923 3300049572 Bacteria 5928
483 Ga0501036_0141968 3300049572 Bacteria 2026
484 Ga0501036_0170879 3300049572 Bacteria 1831
485 Ga0501038_0006438 3300049574 Bacteria 10869
486 Ga0501038_0014198 3300049574 Bacteria 7256
487 Ga0501038_0020066 3300049574 Bacteria 6014
488 Ga0501038_0023427 3300049574 Bacteria 5519
489 Ga0501038_0071047 3300049574 Bacteria 2953
490 Ga0501039_0016255 3300049575 Bacteria 5699
491 Ga0501039_0023199 3300049575 Bacteria 4762
492 Ga0501040_0021130 3300049576 Bacteria 4341
493 Ga0501040_0095830 3300049576 Bacteria 2065
494 Ga0501041_0009549 3300049577 Bacteria 5720
495 Ga0501043_0011238 3300049579 Bacteria 7014
496 Ga0501043_0030206 3300049579 Bacteria 4257
497 Ga0501043_0045652 3300049579 Bacteria 3445
498 Ga0501043_0066790 3300049579 Bacteria 2824
499 Ga0501046_0000010 3300049580 Bacteria 331082
500 Ga0501046_0092355 3300049580 Bacteria 2327
501 Ga0501047_0086487 3300049581 Bacteria 3012
502 Ga0501048_0016008 3300049582 Bacteria 5530
503 Ga0501048_0038810 3300049582 Bacteria 3417
504 Ga0501067_0013183 3300049583 Bacteria 4577
505 Ga0501070_0021175 3300049586 Bacteria 5457
506 Ga0501070_0042255 3300049586 Bacteria 3797
507 Ga0501071_0015019 3300049587 Bacteria 5308
508 Ga0501077_0001622 3300049593 Bacteria 13526
509 Ga0501079_0057703 3300049741 Bacteria 2995
510 Ga0501081_0013419 3300049743 Bacteria 5388
511 Ga0501035_0026188 3300049822 Bacteria 5337
512 Ga0501035_0169119 3300049822 Bacteria 1889
513 Ga0501044_0008963 3300049823 Bacteria 10938
514 Ga0501044_0020639 3300049823 Bacteria 7034
515 Ga0501044_0021545 3300049823 Bacteria 6873
516 nmdc:mga03n38_504_c1 3300050490 Bacteria 9828
517 nmdc:mga0yw44_2983_c1 3300050492 Bacteria 7380
518 nmdc:mga06z11_13585_c1 3300050494 Bacteria 3581
519 nmdc:mga06z11_408_c1 3300050494 Bacteria 16144
520 nmdc:mga06z11_4197_c1 3300050494 Bacteria 5643
521 nmdc:mga04h51_2437_c1 3300050495 Bacteria 4416
522 nmdc:mga05p37_62746_c1 3300050507 Bacteria 4573
523 nmdc:mga09592_13262_c1 3300050508 Bacteria 6729
524 nmdc:mga0qj67_12305_c1 3300050509 Bacteria 6443
525 nmdc:mga0qj67_18367_c1 3300050509 Bacteria 5329
526 nmdc:mga0qj67_28059_c1 3300050509 Bacteria 4367
527 nmdc:mga06r32_2254_c1 3300050510 Bacteria 17256
528 nmdc:mga06r32_25498_c1 3300050510 Bacteria 5501
529 nmdc:mga06r32_28292_c1 3300050510 Bacteria 5243
530 nmdc:mga06r32_5374_c1 3300050510 Bacteria 11525
531 nmdc:mga08y16_156190_c1 3300050511 Bacteria 2371
532 nmdc:mga0n895_11235_c1 3300050512 Bacteria 7976
533 nmdc:mga0n895_39869_c1 3300050512 Bacteria 4561
534 nmdc:mga0n895_97089_c1 3300050512 Bacteria 2952
535 nmdc:mga0n895_99705_c1 3300050512 Bacteria 2913
536 nmdc:mga0rr50_3247_c1 3300050513 Bacteria 9316
537 Ga0495601_0020791 3300053077 Bacteria 4011
538 Ga0495612_0001804 3300053078 Bacteria 8767
539 Ga0495612_0006069 3300053078 Bacteria 4976
540 Ga0495595_0007295 3300053084 Bacteria 4523
541 Ga0495595_0020128 3300053084 Bacteria 2901
542 Ga0495619_0001276 3300053085 Bacteria 16527
543 Ga0495619_0002636 3300053085 Bacteria 11719
544 Ga0495619_0017934 3300053085 Bacteria 4488
545 Ga0500643_000032 3300053087 Bacteria 200350
546 Ga0500566_0000026 3300053094 Bacteria 77138
547 Ga0500566_0004175 3300053094 Bacteria 8613
548 Ga0500566_0004667 3300053094 Bacteria 8146
549 Ga0500556_0000004 3300053104 Bacteria 666287
550 Ga0500556_0000572 3300053104 Bacteria 24483
551 Ga0500556_0004181 3300053104 Bacteria 4128
552 Ga0500557_000015 3300053105 Bacteria 106282
553 Ga0500572_000172 3300053111 Bacteria 22845
554 Ga0500592_002666 3300053116 Bacteria 2870
555 Ga0500593_000023 3300053117 Bacteria 52110
556 Ga0500595_000324 3300053119 Bacteria 31413
557 Ga0500595_000438 3300053119 Bacteria 25956
558 Ga0500595_001427 3300053119 Bacteria 12824
559 Ga0500608_000894 3300053122 Bacteria 10741
560 Ga0500642_0000037 3300053130 Bacteria 98684
561 Ga0500642_0000102 3300053130 Bacteria 40878
562 Ga0500652_000276 3300053131 Bacteria 19061
563 Ga0500559_0000165 3300053136 Bacteria 52143
564 Ga0500559_0000633 3300053136 Bacteria 23806
565 Ga0500559_0000893 3300053136 Bacteria 19031
566 Ga0500568_0000001 3300053139 Bacteria 988705
567 Ga0500568_0001069 3300053139 Bacteria 18534
568 Ga0500603_000047 3300053150 Bacteria 29770
569 Ga0500603_000212 3300053150 Bacteria 15404
570 Ga0500604_0000351 3300053151 Bacteria 12747
571 Ga0500604_0007533 3300053151 Bacteria 2882
572 Ga0500616_0000014 3300053153 Bacteria 637918
573 Ga0500616_0002048 3300053153 Bacteria 17733
574 Ga0500616_0013482 3300053153 Bacteria 4743
575 Ga0500622_0000794 3300053156 Bacteria 27285
576 Ga0500622_0003193 3300053156 Bacteria 11172
577 Ga0500634_0000006 3300053161 Bacteria 171639
578 Ga0500638_045575 3300053162 Bacteria 2128
579 Ga0500639_000269 3300053163 Bacteria 25662
580 Ga0500636_0000538 3300053177 Bacteria 20632
581 Ga0500636_0001759 3300053177 Bacteria 11856
582 Ga0500637_0000088 3300053178 Bacteria 33146
583 Ga0500637_0000545 3300053178 Bacteria 14737
584 Ga0500637_0076115 3300053178 Bacteria 1935
585 Ga0500596_000058 3300053735 Bacteria 15240
586 Ga0500596_001468 3300053735 Bacteria 4764
587 Ga0500601_000048 3300053737 Bacteria 25132
588 Ga0500661_000025 3300055283 Bacteria 22926
589 Ga0501082_0016959 3300060353 Bacteria 6271
590 Ga0501082_0046261 3300060353 Bacteria 3751
591 Ga0530510_0053146 3300061734 Bacteria 2927
592 Ga0530510_0101991 3300061734 Bacteria 2098
593 2507508522 2507262055 Bacteria 8048963
594 2508542587 2508501009 Bacteria 7784016
595 2508691641 2508501042 Bacteria 8719808
596 2508728424 2508501050 Bacteria 9633614
597 2509078432 2508501114 Bacteria 7082538
598 2509144370 2508501127 Bacteria 7037543
599 2509150944 2508501128 Bacteria 8613869
600 2511393499 2511231028 Bacteria 8046582
601 2513592413 2513237087 Bacteria 5817514
602 2513628006 2513237092 Bacteria 8341956
603 2513638900 2513237094 Bacteria 8789602
604 2513645773 2513237095 Bacteria 8976980
605 2513654789 2513237096 Bacteria 8722461
606 2513675892 2513237098 Bacteria 9902361
607 2513692593 2513237101 Bacteria 7952346
608 2513704834 2513237102 Bacteria 7703324
609 2513718627 2513237104 Bacteria 10034502
610 2513855790 2513237137 Bacteria 9558895
611 2513872830 2513237139 Bacteria 8737671
612 2513889179 2513237141 Bacteria 8496279
613 2513915031 2513237145 Bacteria 8979722
614 2514013591 2513237161 Bacteria 8871253
615 2515629829 2515154112 Bacteria 8294334
616 2517107499 2517093001 Bacteria 9002274
617 2517892328 2517572143 Bacteria 9484767
618 2524437423 2524023205 Bacteria 8918781
619 2524468941 2524023210 Bacteria 9029266
620 2524538585 2524023228 Bacteria 10118060
621 2528850013 2528768022 Bacteria 10457665
622 2585165630 2582581283 Bacteria 6030556
623 2603859517 2602042107 Bacteria 6226103
624 2617347452 2617270735 Bacteria 9163226
625 2617375705 2617270741 Bacteria 8201522
626 2643910693 2643221580 Bacteria 3816678
627 2643963371 2643221591 Bacteria 4397626
628 2644046494 2643221607 Bacteria 6314006
629 2644166038 2643221629 Bacteria 5850260
630 2644200847 2643221636 Bacteria 6583769
631 2644288744 2643221651 Bacteria 4798932
632 2644346956 2643221662 Bacteria 5851492
633 2644410525 2643221674 Bacteria 3919126
634 2644479284 2643221686 Bacteria 6310811
635 2644493337 2643221688 Bacteria 5260751
636 2644502332 2643221689 Bacteria 6042950
637 2644729254 2643221733 Bacteria 5690728
638 2644735108 2643221734 Bacteria 5365412
639 2644746947 2643221736 Bacteria 6608466
640 2671120424 2667528175 Bacteria 7532676
641 2723845021 2721755755 Bacteria 8322773
642 2728751127 2728368998 Bacteria 8720350
643 2745076586 2744054633 Bacteria 8678936
644 2776259647 2775506901 Bacteria 9631051
645 2793062343 2791355196 Bacteria 7323613
646 2793072329 2791355197 Bacteria 8420563
647 2793082111
648 2805915272 2802429603 Bacteria 8777136
649 2818238823 2816332527 Bacteria 8933356
650 2819719687 2818991467 Bacteria 5893227
651 2824608035 2824600985 Bacteria 8488197
652 2824616594 2824609381 Bacteria 8672835
653 2824624160 2824617872 Bacteria 8814715
654 2824632750 2824626560 Bacteria 8813858
655 2824639758 2824635225 Bacteria 8785348
656 2824648136 2824644064 Bacteria 8743947
657 2824658699 2824653114 Bacteria 8493680
658 2824665748 2824661429 Bacteria 9877870
659 2824674803 2824671348 Bacteria 8369588
660 2824685998 2824679649 Bacteria 8248951
661 2824691221 2824687955 Bacteria 8360029
662 2824701359 2824696289 Bacteria 8335049
663 2824712362 2824704595 Bacteria 9667483
664 2824721149 2824714736 Bacteria 8717648
665 2824727897 2824723954 Bacteria 8758240
666 2824736682 2824732956 Bacteria 7810675
667 2824750169 2824746037 Bacteria 7911610
668 2824759505 2824753945 Bacteria 9787441
669 2824769887 2824763712 Bacteria 9792355
670 2824779442 2824773399 Bacteria 8360218
671 2828306610 2828305725 Bacteria 4916900
672 2835317902 2835312727 Bacteria 7413381
673 2838123677 2838122688 Bacteria 8803140
674 2841762313 2841760612 Bacteria 6454112
675 2841946679 2841941048 Bacteria 8688029
676 2841949777 2841949485 Bacteria 8680857
677 2841958730 2841957949 Bacteria 8652217
678 2841971718 2841966195 Bacteria 8673214
679 2841974932 2841974524 Bacteria 8931498
680 2841983499 2841983080 Bacteria 8395090
681 2842039002 2842038055 Bacteria 8002051
682 2842048051 2842045827 Bacteria 8006841
683 2842696240 2842694124 Bacteria 4063419
684 2844109851 2844104063 Bacteria 6440972
685 2844319147 2844315083 Bacteria 8138177
686 2847936278 2847930680 Bacteria 9342022
687 2847946627 2847939898 Bacteria 8606328
688 2849079251 2849076700 Bacteria 7039503
689 2851186880 2851182111 Bacteria 6047226
690 2851248326 2851246043 Bacteria 6439203
691 2857514247 2857509624 Bacteria 7472071
692 2857529080 2857524615 Bacteria 6615449
693 2874598121 2874590934 Bacteria 8299676
694 2874605263 2874604998 Bacteria 7834745
695 2874615474 2874612657 Bacteria 8252029
696 2874627766 2874620515 Bacteria 8290088
697 2874631924 2874628541 Bacteria 8630250
698 2874645834 2874645413 Bacteria 8214782
699 2876764099 2876761206 Bacteria 10111113
700 2876778401 2876771140 Bacteria 8287509
701 2876815220 2876808645 Bacteria 8824342
702 2876825730 2876818435 Bacteria 8274608
703 2879082195 2879074833 Bacteria 8279565
704 2879090645 2879083081 Bacteria 8587928
705 2879105852 2879099564 Bacteria 10442239
706 2879111256 2879110137 Bacteria 8907982
707 2879135342 2879127579 Bacteria 8294491
708 2879150551 2879142872 Bacteria 8267021
709 2881368775 2881364244 Bacteria 7710352
710 2881671223 2881665667 Bacteria 8175609
711 2884299842 2884298095 Bacteria 3823049
712 2885373218 2885366525 Bacteria 8326213
713 2885379483 2885374607 Bacteria 8927485
714 2885386546 2885383462 Bacteria 9473874
715 2885411427 2885409591 Bacteria 9235467
716 2888384132 2888378607 Bacteria 9652610
717 2888393736 2888388044 Bacteria 7304136
718 2888424597 2888419890 Bacteria 7857137
719 2889039774 2889033259 Bacteria 9099371
720 2893070521 2893066018 Bacteria 6158120
721 2894239688 2894232714 Bacteria 8834183
722 2903730989 2903727486 Bacteria 8281579
723 2903749362 2903748898 Bacteria 9972761
724 2903774125 2903768456 Bacteria 9749579
725 2904672914 2904666416 Bacteria 8226587
726 2904695893 2904690495 Bacteria 9412302
727 2904703526
728 2904703963
729 2904714717 2904711408 Bacteria 9771557
730 2906608230 2906602504 Bacteria 8295279
731 2906618698
732 2906633337 2906626472 Bacteria 8826946
733 2906638862 2906635258 Bacteria 8601019
734 2906648225 2906643746 Bacteria 8722424
735 2906666305 2906660503 Bacteria 8595048
736 2908742622 2908739725 Bacteria 8628932
737 2908761195 2908756301 Bacteria 8864324
738 2908780246 2908775508 Bacteria 8092255
739 2909048215 2909042592 Bacteria 6499737
740 2917705064 2917699015 Bacteria 7043791
741 2919076480 2919073203 Bacteria 6531949
742 2922365422 2922361189 Bacteria 7436256
743 2922374467
744 2922391030 2922386360 Bacteria 7017218
745 2922396161 2922393267 Bacteria 8285685
746 2922430358
747 2929618131 2929615660 Bacteria 9193770
748 2929632319 2929624759 Bacteria 9339455
749 2932403361 2932401849 Bacteria 4262978
750 2932790424 2932784394 Bacteria 9704911
751 2932802718 2932801729 Bacteria 7987968
752 2932810844 2932809354 Bacteria 9135765
753 2932823824 2932818245 Bacteria 9955613
754 2932830054 2932828146 Bacteria 9745859
755 2933580059 2933577622 Bacteria 9116884
756 2935608946 2935608549 Bacteria 8203142
757 2935622719 2935616580 Bacteria 9032984
758 2935631602 2935630451 Bacteria 8169952
759 2935642481 2935638405 Bacteria 10015038
760 2935653351 2935648319 Bacteria 8801166
761 2935660178 2935656913 Bacteria 8965014
762 2935668215 2935665750 Bacteria 9571747
763 2935676246 2935675223 Bacteria 9928132
764 2935686323 2935684952 Bacteria 9590419
765 2935701141 2935694250 Bacteria 9291695
766 2935706076 2935703347 Bacteria 10242284
767 2935722342 2935713505 Bacteria 9608509
768 2935731629 2935722832 Bacteria 9608746
769 2935732237 2935732158 Bacteria 9706831
770 2935741616 2935741537 Bacteria 9707219
771 2935752288 2935750917 Bacteria 9590372
772 2935766570 2935760218 Bacteria 9817913
773 2935776942 2935769743 Bacteria 7878163
774 2935778593 2935777560 Bacteria 8077691
775 2935792258 2935785616 Bacteria 7962367
776 2935800421 2935793552 Bacteria 8012592
777 2935803074 2935801545 Bacteria 9301974
778 2935814391 2935810662 Bacteria 9401221
779 2935822106 2935819856 Bacteria 8261050
780 2935831528 2935827899 Bacteria 10038562
781 2935838388 2935837841 Bacteria 9454360
782 2935847688 2935847175 Bacteria 8228321
783 2935860968 2935855204 Bacteria 9035059
784 2935869695 2935864058 Bacteria 9784707
785 2935878886 2935873716 Bacteria 9632195
786 2935889810 2935883170 Bacteria 7964738
787 2935909040 2935908558 Bacteria 8568796
788 2935919760 2935916978 Bacteria 9113783
789 2935926386 2935926038 Bacteria 8601059
790 2935934836 2935934488 Bacteria 8602579
791 2935943286 2935942939 Bacteria 8599779
792 2935951724 2935951376 Bacteria 8602333
793 2935965779 2935959822 Bacteria 7869783
794 2935967849 2935967501 Bacteria 8603075
795 2935983812 2935975950 Bacteria 8347125
796 2935991653 2935984226 Bacteria 8302647
797 2935994717 2935992306 Bacteria 9802711
798 2936003359 2936002035 Bacteria 9362176
799 2936016221 2936011229 Bacteria 8801034
800 2936024854 2936019824 Bacteria 8804134
801 2936032102 2936028420 Bacteria 8965941
802 2936039947 2936037263 Bacteria 9446081
803 2936049963 2936046547 Bacteria 8903709
804 2936060915 2936055302 Bacteria 8785755
805 2937836998 2937836603 Bacteria 6811263
806 2940556910 2940556831 Bacteria 9590747
807 2941511396 2941507105 Bacteria 8166816
808 2941519097 2941515067 Bacteria 8166720
809 2941526323 2941523033 Bacteria 8169134
810 2941532884 2941531003 Bacteria 7653939
811 2941538944 2941538514 Bacteria 9402094
812 3005480279 3005474847 Bacteria 9259049
813 3005484385 3005483717 Bacteria 7877331
814 3005510386 3005506211 Bacteria 6943378
815 3005587982 3005587118 Bacteria 7794411
816 3005599298 3005594810 Bacteria 8716512
817 3005714976 3005710791 Bacteria 7622528
818 3005722381 3005718088 Bacteria 8283608
819 8001849792 8001845381 Bacteria 5804942
820 8006927083 8006926726 Bacteria 6749210
821 8006940605 8006933436 Bacteria 10410654
822 8006965808 8006964411 Bacteria 8966052
823 8006980294 8006973647 Bacteria 10679141
824 8006986460 8006984368 Bacteria 9651211
825 8006995971 8006994254 Bacteria 8309700
826 8016522263 8016511872 Bacteria 9921665
827 8016529550 8016522445 Bacteria 8156687
828 8016534762 8016530956 Bacteria 8155261
829 8016547981 8016539877 Bacteria 8155419
830 8016562528 8016557553 Bacteria 8154380
831 8016573112 8016566248 Bacteria 8158151
832 8016577256 8016575299 Bacteria 8154085
833 8016591673 8016583857 Bacteria 10421953
834 8016600317 8016595262 Bacteria 8149947
835 8016614504 8016613128 Bacteria 8794220
836 8016626495 8016622563 Bacteria 7999408
837 8016640260 8016630954 Bacteria 9217207
838 8017063294 8017057580 Bacteria 10023680
839 8019544942 8019538911 Bacteria 7872763
840 8019553590 8019547302 Bacteria 7996444
841 8019556673 8019555841 Bacteria 9642137
842 8019568636 8019565922 Bacteria 9639779
843 8019582728 8019576017 Bacteria 10049540
844 8019600836 8019597564 Bacteria 10041141
845 8019617718 8019608314 Bacteria 10042931
846 8019628246 8019619141 Bacteria 9218857
847 8019634380 8019629233 Bacteria 8687553
848 8019645352 8019638758 Bacteria 9062356
849 8019658479 8019648815 Bacteria 10014479
850 8019662259 8019659431 Bacteria 8577854
851 8019684327 8019678201 Bacteria 8863603
852 8019690143 8019687851 Bacteria 8712826
853 8055746280 8055742211 Bacteria 9226248
854 8056673804 8056673599 Bacteria 7871253
855 8056686714 8056681323 Bacteria 8472857
856 8056695268 8056689827 Bacteria 6712655
857 8056968098 8056967851 Bacteria 9038162
858 8057535531 8057529695 Bacteria 6306553
859 Ga0496104_0000275
860 JGI24737J22298_10004391
861 JGI25151J46595_10000114
862 JGI25151J46595_10000345
863 JGI25406J46586_10000104
864 JGI25406J46586_10001599
865 JGI25165J46597_1002951
866 JGI25153J46596_10001106
867 JGI25160J50197_1009619
868 Ga0055526_1000395
869 Ga0055526_1001058
870 Ga0055524_1000020
871 Ga0065165_1000240
872 Ga0065165_1001349
873 Ga0065165_1001593
874 Ga0070676_10005386
875 Ga0070666_10012047
876 Ga0070680_100081740
877 Ga0070682_100007542
878 Ga0068868_100007248
879 Ga0070691_10008708
880 Ga0070668_100014987
881 Ga0070669_100003763
882 Ga0070671_100076617
883 Ga0070659_100022039
884 Ga0070659_100088124
885 Ga0070709_10002085
886 Ga0070710_10000842
887 Ga0070711_100046378
888 Ga0070705_100001270
889 Ga0070694_100002981
890 Ga0070694_100052535
891 Ga0070678_100033408
892 Ga0070699_100000313
893 Ga0070679_100036158
894 Ga0068853_100003443
895 Ga0070695_100001796
896 Ga0070696_100000471
897 Ga0070704_100012520
898 Ga0068855_100025861
899 Ga0068857_100005529
900 Ga0068857_100005939
901 Ga0068857_100034904
902 Ga0068856_100000082
903 Ga0068856_100041732
904 Ga0068852_100034172
905 Ga0068852_100048627
906 Ga0068859_100096721
907 Ga0068864_100125527
908 Ga0068861_100032708
909 Ga0068851_10001427
910 Ga0068851_10002938
911 Ga0068851_10003776
912 Ga0068858_100027234
913 Ga0068860_100000316
914 Ga0068860_100013358
915 Ga0081455_10000194
916 Ga0081455_10002419
917 Ga0081455_10002827
918 Ga0081455_10003658
919 Ga0081455_10081964
920 Ga0081538_10012272
921 Ga0081540_1000032
922 Ga0081540_1002092
923 Ga0081540_1006870
924 Ga0081540_1016557
925 Ga0081540_1028208
926 Ga0081539_10000273
927 Ga0081539_10000735
928 Ga0081539_10018005
929 Ga0081539_10036063
930 Ga0081539_10039885
931 Ga0070717_10000729
932 Ga0070717_10004095
933 Ga0075365_10024876
934 Ga0075365_10027613
935 Ga0075363_100001173
936 Ga0070716_100009239
937 Ga0075367_10010285
938 Ga0075367_10010355
939 Ga0075367_10030943
940 Ga0075370_10033054
941 Ga0075430_100004577
942 Ga0075430_100071354
943 Ga0075431_100001890
944 Ga0075431_100038293
945 Ga0075431_100136956
946 Ga0075433_10126425
947 Ga0075434_100034833
948 Ga0075434_100039736
949 Ga0075434_100043875
950 Ga0097620_100096717
951 Ga0099825_1028727
952 Ga0099824_1022420
953 Ga0099822_1017281
954 Ga0099823_1008783
955 Ga0075435_100003830
956 Ga0105240_10007507
957 Ga0105240_10010434
958 Ga0105240_10012340
959 Ga0111539_10104371
960 Ga0105245_10018726
961 Ga0105247_10027479
962 Ga0114129_10047185
963 Ga0114129_10136930
964 Ga0114129_10239133
965 Ga0105243_10088601
966 Ga0105237_10040828
967 Ga0105237_10132437
968 Ga0105238_10001837
969 Ga0105238_10047470
970 Ga0105238_10048472
971 Ga0105238_10077428
972 Ga0105249_10096671
973 Ga0105239_10115636
974 Ga0105239_10143534
975 Ga0105239_10156886
976 Ga0157369_10019813
977 Ga0157369_10078362
978 Ga0171462_1022
979 Ga0157374_10021003
980 Ga0157374_10088980
981 Ga0163162_10037819
982 Ga0163162_10157383
983 Ga0157372_10024593
984 Ga0157375_10012645
985 Ga0214544_1000002
986 Ga0214542_1000001
987 Ga0214545_1000001
988 Ga0214545_1029110
989 Ga0214543_1000001
990 Ga0213874_10002243
991 Ga0213876_10001406
992 Ga0213876_10057034
993 Ga0213871_10004850
994 Ga0207427_101831
995 Ga0209677_100507
996 Ga0209148_1000289
997 Ga0209233_1002026
998 Ga0209455_1003622
999 Ga0209673_1021481
1000 Ga0209130_1000061
1001 Ga0209675_1001320
1002 Ga0209025_1000008
1003 Ga0209025_1001935
1004 Ga0209025_1015731
1005 Ga0209564_1000049
1006 Ga0209564_1000054
1007 Ga0209758_1000160
1008 Ga0209758_1000219
1009 Ga0209758_1007950
1010 Ga0209758_1016520
1011 Ga0209758_1027905
1012 Ga0209256_1000014
1013 Ga0209256_1003910
1014 Ga0207426_1000705
1015 Ga0207426_1000986
1016 Ga0207426_1004854
1017 Ga0207656_10001566
1018 Ga0207656_10003271
1019 Ga0207653_10002045
1020 Ga0207692_10000244
1021 Ga0207692_10000420
1022 Ga0207647_10015806
1023 Ga0207699_10002274
1024 Ga0207699_10007307
1025 Ga0207699_10009196
1026 Ga0207643_10039285
1027 Ga0207654_10004487
1028 Ga0207707_10002881
1029 Ga0207707_10090385
1030 Ga0207695_10000015
1031 Ga0207695_10004042
1032 Ga0207695_10021791
1033 Ga0207695_10191664
1034 Ga0207671_10011502
1035 Ga0207693_10000095
1036 Ga0207693_10024287
1037 Ga0207663_10057945
1038 Ga0207660_10026805
1039 Ga0207657_10007732
1040 Ga0207649_10001722
1041 Ga0207652_10133466
1042 Ga0207694_10000082
1043 Ga0207694_10012755
1044 Ga0207664_10008276
1045 Ga0207664_10063181
1046 Ga0207706_10157034
1047 Ga0207665_10000133
1048 Ga0207665_10018020
1049 Ga0207661_10001725
1050 Ga0207667_10006555
1051 Ga0207667_10023099
1052 Ga0207667_10051742
1053 Ga0207640_10003022
1054 Ga0207678_10060660
1055 Ga0207678_10133251
1056 Ga0207702_10000002
1057 Ga0207702_10000048
1058 Ga0207676_10115078
1059 Ga0207674_10001889
1060 Ga0207674_10002361
1061 Ga0207674_10042826
1062 Ga0207683_10140204
1063 Ga0207698_10052853
1064 Ga0209389_1000008
1065 Ga0209389_1000081
1066 Ga0209589_1000001
1067 Ga0209589_1000091
1068 Ga0209489_100001
1069 Ga0209489_100096
1070 Ga0209489_100333
1071 Ga0209700_100001
1072 Ga0209700_100062
1073 Ga0209588_1004092
1074 Ga0209813_10000356
1075 Ga0209813_10003767
1076 Ga0207428_10062905
1077 Ga0268266_10003536
1078 Ga0268266_10008761
1079 Ga0268266_10019220
1080 Ga0268265_10000550
1081 Ga0268264_10000430
1082 Ga0268264_10005052
1083 Ga0265319_1002587
1084 Ga0265336_10000474
1085 Ga0307517_10001000
1086 Ga0307515_10000070
1087 Ga0307515_10029530
1088 Ga0307515_10068290
1089 Ga0265338_10000086
1090 Ga0265330_10032435
1091 Ga0265325_10009592
1092 Ga0265340_10001336
1093 Ga0265339_10000418
1094 Ga0307513_10015483
1095 Ga0307513_10062401
1096 Ga0307509_10133747
1097 Ga0265313_10000154
1098 Ga0307508_10000009
1099 Ga0316575_10004011
1100 Ga0265314_10017894
1101 Ga0316576_10015722
1102 Ga0316576_10033406
1103 Ga0307516_10006964
1104 Ga0307516_10030994
1105 Ga0307409_100107547
1106 Ga0307414_10026840
1107 Ga0316583_10011778
1108 Ga0315911_1000001
1109 Ga0373934_0003946
1110 Ga0373923_0011642
1111 Ga0373923_0023401
1112 Ga0373953_0000473
1113 Ga0373953_0001627
1114 Ga0373954_0000442
1115 Ga0373956_0006981
1116 Ga0373956_0014148
1117 Ga0373957_0012131
1118 Ga0373943_0003057
1119 Ga0373955_0000840
1120 Ga0373955_0006897
1121 Ga0373962_0002428
1122 Ga0373931_0004195
1123 Ga0373931_0019032
1124 Ga0373935_0001167
1125 Ga0373935_0035945
1126 Ga0373933_0000041
1127 Ga0373933_0000563
1128 Ga0373933_0002868
1129 Ga0373937_0002003
1130 Ga0373937_0014572
1131 Ga0373937_0018505
1132 Ga0373937_0046509
1133 Ga0372808_004186
1134 Ga0316582_0014990
1135 Ga0316584_0003478
1136 Ga0373925_0004654
1137 Ga0373925_0028798
1138 Ga0373925_0050715
1139 Ga0395899_0108442
1140 Ga0395900_0001685
1141 Ga0395900_0033546
1142 Ga0395900_0037966
1143 Ga0395898_0010109
1144 Ga0395905_0007972
1145 Ga0395905_0012612
1146 Ga0395905_0024541
1147 Ga0316581_0002606
1148 Ga0436364_0138611
1149 Ga0436364_0485287
1150 Ga0395901_0004712
1151 Ga0395901_0030320
1152 Ga0436365_0286964
1153 Ga0436365_1628681
1154 Ga0436365_1651055
1155 Ga0436361_0915560
1156 Ga0436363_1213338
1157 Ga0436363_1572654
1158 Ga0436362_0566207
1159 Ga0466972_0000216
1160 Ga0466966_0000495
1161 Ga0466961_0000937
1162 Ga0466963_0020140
1163 Ga0466957_0041929
1164 Ga0466960_0007789
1165 Ga0466959_0018432
1166 Ga0466967_0017095
1167 Ga0495592_0005090
1168 Ga0495592_0018842
1169 Ga0495592_0022433
1170 Ga0495603_0000329
1171 Ga0495603_0005330
1172 Ga0495629_0000355
1173 Ga0495629_0008864
1174 Ga0495629_0011318
1175 Ga0495629_0034923
1176 Ga0495629_0036301
1177 Ga0495651_0000265
1178 Ga0495651_0002687
1179 Ga0495651_0015524
1180 Ga0495651_0029989
1181 Ga0495651_0043715
1182 Ga0495653_0037314
1183 Ga0495653_0039788
1184 Ga0495582_0005216
1185 Ga0495582_0013187
1186 Ga0495639_0000061
1187 Ga0495662_0000437
1188 Ga0495664_0008477
1189 Ga0495664_0011752
1190 Ga0495664_0020019
1191 Ga0495594_0002652
1192 Ga0495606_0005142
1193 Ga0495608_0000435
1194 Ga0495608_0005163
1195 Ga0495608_0009473
1196 Ga0495608_0045193
1197 Ga0495616_0022794
1198 Ga0495628_0018503
1199 Ga0495628_0021620
1200 Ga0495628_0048492
1201 Ga0495648_0002320
1202 Ga0495648_0014791
1203 Ga0495652_0001766
1204 Ga0495652_0002339
1205 Ga0495652_0024014
1206 Ga0495652_0038161
1207 Ga0495654_0008815
1208 Ga0495665_0000414
1209 Ga0495640_0000826
1210 Ga0495640_0007059
1211 Ga0495640_0009783
1212 Ga0495640_0020350
1213 Ga0495640_0027153
1214 Ga0495586_0038836
1215 Ga0495587_0002595
1216 Ga0495587_0007158
1217 Ga0495587_0010142
1218 Ga0495587_0073069
1219 Ga0495645_0007922
1220 Ga0495645_0011015
1221 Ga0495645_0047289
1222 Ga0495667_0000817
1223 Ga0495667_0001528
1224 Ga0495667_0013389
1225 Ga0495668_0025684
1226 Ga0495634_0000762
1227 Ga0495634_0002573
1228 Ga0495634_0008744
1229 Ga0495625_0039677
1230 Ga0495635_0000187
1231 Ga0495635_0001091
1232 Ga0495657_0020860
1233 Ga0495599_0015434
1234 Ga0495599_0020518
1235 Ga0495623_0005149
1236 Ga0495623_0025428
1237 Ga0495623_0028344
1238 Ga0495646_0005680
1239 Ga0495646_0013741
1240 Ga0495646_0018205
1241 Ga0495646_0022600
1242 Ga0495658_0000047
1243 Ga0495658_0016600
1244 Ga0495613_0002415
1245 Ga0495624_0000188
1246 Ga0495670_0034645
1247 Ga0495600_0005291
1248 Ga0495600_0013208
1249 Ga0495600_0059430
1250 Ga0495581_0000705
1251 Ga0495604_0000118
1252 Ga0495604_0008523
1253 Ga0495604_0031356
1254 Ga0495674_0001402
1255 Ga0495674_0002109
1256 Ga0495674_0011338
1257 Ga0495674_0039692
1258 Ga0495674_0127720
1259 Ga0495680_0005405
1260 Ga0495680_0006280
1261 Ga0495680_0006879
1262 Ga0495675_0001383
1263 Ga0495675_0023118
1264 Ga0495684_0001482
1265 Ga0495684_0036877
1266 Ga0495684_0042883
1267 Ga0495684_0043497
1268 Ga0495684_0100156
1269 Ga0495593_0000616
1270 Ga0495593_0005166
1271 Ga0495602_0006478
1272 Ga0495602_0021287
1273 Ga0495602_0052016
1274 Ga0496102_0005226
1275 Ga0496102_0015089
1276 Ga0496102_0098128
1277 Ga0496104_0016718
1278 Ga0496104_0053795
1279 Ga0496104_0133984
1280 Ga0496105_0004479
1281 Ga0496105_0035771
1282 Ga0496105_0039509
1283 Ga0496106_0000477
1284 Ga0496106_0001639
1285 Ga0496106_0005089
1286 Ga0496106_0023152
1287 Ga0496106_0024067
1288 Ga0496107_0002282
1289 Ga0496107_0003815
1290 Ga0496107_0005766
1291 Ga0496107_0010725
1292 Ga0496108_0004243
1293 Ga0496108_0004668
1294 Ga0496108_0051101
1295 Ga0496109_0001422
1296 Ga0496109_0075249
1297 Ga0496109_0124066
1298 Ga0496109_0139182
1299 Ga0496110_0007801
1300 Ga0496110_0066341
1301 Ga0496112_0000021
1302 Ga0496112_0016788
1303 Ga0496112_0083151
1304 Ga0496113_0035351
1305 Ga0496114_0031480
1306 Ga0496114_0052030
1307 Ga0496115_0024802
1308 Ga0496115_0118727
1309 Ga0496116_0001763
1310 Ga0496117_0014868
1311 Ga0496117_0097950
1312 Ga0496119_0103888
1313 Ga0496121_0000456
1314 Ga0496121_0002176
1315 Ga0496121_0011588
1316 Ga0496121_0012754
1317 Ga0496121_0020849
1318 Ga0496121_0029820
1319 Ga0496121_0037637
1320 Ga0496121_0079745
1321 Ga0496121_0112356
1322 Ga0496123_0017337
1323 Ga0496124_0000685
1324 Ga0496125_0000272
1325 Ga0496125_0000989
1326 Ga0496125_0001801
1327 Ga0496125_0009907
1328 Ga0496125_0030914
1329 Ga0496126_0002820
1330 Ga0496126_0005738
1331 Ga0496126_0008219
1332 Ga0496126_0126537
1333 Ga0501032_0038878
1334 Ga0501033_0051209
1335 Ga0501034_0000014
1336 Ga0501034_0001979
1337 Ga0501034_0020852
1338 Ga0501034_0060557
1339 Ga0501034_0124040
1340 Ga0501036_0017923
1341 Ga0501036_0141968
1342 Ga0501036_0170879
1343 Ga0501038_0006438
1344 Ga0501038_0014198
1345 Ga0501038_0020066
1346 Ga0501038_0023427
1347 Ga0501038_0071047
1348 Ga0501039_0016255
1349 Ga0501039_0023199
1350 Ga0501040_0021130
1351 Ga0501040_0095830
1352 Ga0501041_0009549
1353 Ga0501043_0011238
1354 Ga0501043_0030206
1355 Ga0501043_0045652
1356 Ga0501043_0066790
1357 Ga0501046_0000010
1358 Ga0501046_0092355
1359 Ga0501047_0086487
1360 Ga0501048_0016008
1361 Ga0501048_0038810
1362 Ga0501067_0013183
1363 Ga0501070_0021175
1364 Ga0501070_0042255
1365 Ga0501071_0015019
1366 Ga0501077_0001622
1367 Ga0501079_0057703
1368 Ga0501081_0013419
1369 Ga0501035_0026188
1370 Ga0501035_0169119
1371 Ga0501044_0008963
1372 Ga0501044_0020639
1373 Ga0501044_0021545
1374 nmdc:mga03n38_504_c1
1375 nmdc:mga0yw44_2983_c1
1376 nmdc:mga06z11_13585_c1
1377 nmdc:mga06z11_408_c1
1378 nmdc:mga06z11_4197_c1
1379 nmdc:mga04h51_2437_c1
1380 nmdc:mga05p37_62746_c1
1381 nmdc:mga09592_13262_c1
1382 nmdc:mga0qj67_12305_c1
1383 nmdc:mga0qj67_18367_c1
1384 nmdc:mga0qj67_28059_c1
1385 nmdc:mga06r32_2254_c1
1386 nmdc:mga06r32_25498_c1
1387 nmdc:mga06r32_28292_c1
1388 nmdc:mga06r32_5374_c1
1389 nmdc:mga08y16_156190_c1
1390 nmdc:mga0n895_11235_c1
1391 nmdc:mga0n895_39869_c1
1392 nmdc:mga0n895_97089_c1
1393 nmdc:mga0n895_99705_c1
1394 nmdc:mga0rr50_3247_c1
1395 Ga0495601_0020791
1396 Ga0495612_0001804
1397 Ga0495612_0006069
1398 Ga0495595_0007295
1399 Ga0495595_0020128
1400 Ga0495619_0001276
1401 Ga0495619_0002636
1402 Ga0495619_0017934
1403 Ga0500643_000032
1404 Ga0500566_0000026
1405 Ga0500566_0004175
1406 Ga0500566_0004667
1407 Ga0500556_0000004
1408 Ga0500556_0000572
1409 Ga0500556_0004181
1410 Ga0500557_000015
1411 Ga0500572_000172
1412 Ga0500592_002666
1413 Ga0500593_000023
1414 Ga0500595_000324
1415 Ga0500595_000438
1416 Ga0500595_001427
1417 Ga0500608_000894
1418 Ga0500642_0000037
1419 Ga0500642_0000102
1420 Ga0500652_000276
1421 Ga0500559_0000165
1422 Ga0500559_0000633
1423 Ga0500559_0000893
1424 Ga0500568_0000001
1425 Ga0500568_0001069
1426 Ga0500603_000047
1427 Ga0500603_000212
1428 Ga0500604_0000351
1429 Ga0500604_0007533
1430 Ga0500616_0000014
1431 Ga0500616_0002048
1432 Ga0500616_0013482
1433 Ga0500622_0000794
1434 Ga0500622_0003193
1435 Ga0500634_0000006
1436 Ga0500638_045575
1437 Ga0500639_000269
1438 Ga0500636_0000538
1439 Ga0500636_0001759
1440 Ga0500637_0000088
1441 Ga0500637_0000545
1442 Ga0500637_0076115
1443 Ga0500596_000058
1444 Ga0500596_001468
1445 Ga0500601_000048
1446 Ga0500661_000025
1447 Ga0501082_0016959
1448 Ga0501082_0046261
1449 Ga0530510_0053146
1450 Ga0530510_0101991
1451 2507508522
1452 2508542587
1453 2508691641
1454 2508728424
1455 2509078432
1456 2509144370
1457 2509150944
1458 2511393499
1459 2513592413
1460 2513628006
1461 2513638900
1462 2513645773
1463 2513654789
1464 2513675892
1465 2513692593
1466 2513704834
1467 2513718627
1468 2513855790
1469 2513872830
1470 2513889179
1471 2513915031
1472 2514013591
1473 2515629829
1474 2517107499
1475 2517892328
1476 2524437423
1477 2524468941
1478 2524538585
1479 2528850013
1480 2585165630
1481 2603859517
1482 2617347452
1483 2617375705
1484 2643910693
1485 2643963371
1486 2644046494
1487 2644166038
1488 2644200847
1489 2644288744
1490 2644346956
1491 2644410525
1492 2644479284
1493 2644493337
1494 2644502332
1495 2644729254
1496 2644735108
1497 2644746947
1498 2671120424
1499 2723845021
1500 2728751127
1501 2745076586
1502 2776259647
1503 2793062343
1504 2793072329
1505 2793082111
1506 2805915272
1507 2818238823
1508 2819719687
1509 2824608035
1510 2824616594
1511 2824624160
1512 2824632750
1513 2824639758
1514 2824648136
1515 2824658699
1516 2824665748
1517 2824674803
1518 2824685998
1519 2824691221
1520 2824701359
1521 2824712362
1522 2824721149
1523 2824727897
1524 2824736682
1525 2824750169
1526 2824759505
1527 2824769887
1528 2824779442
1529 2828306610
1530 2835317902
1531 2838123677
1532 2841762313
1533 2841946679
1534 2841949777
1535 2841958730
1536 2841971718
1537 2841974932
1538 2841983499
1539 2842039002
1540 2842048051
1541 2842696240
1542 2844109851
1543 2844319147
1544 2847936278
1545 2847946627
1546 2849079251
1547 2851186880
1548 2851248326
1549 2857514247
1550 2857529080
1551 2874598121
1552 2874605263
1553 2874615474
1554 2874627766
1555 2874631924
1556 2874645834
1557 2876764099
1558 2876778401
1559 2876815220
1560 2876825730
1561 2879082195
1562 2879090645
1563 2879105852
1564 2879111256
1565 2879135342
1566 2879150551
1567 2881368775
1568 2881671223
1569 2884299842
1570 2885373218
1571 2885379483
1572 2885386546
1573 2885411427
1574 2888384132
1575 2888393736
1576 2888424597
1577 2889039774
1578 2893070521
1579 2894239688
1580 2903730989
1581 2903749362
1582 2903774125
1583 2904672914
1584 2904695893
1585 2904703526
1586 2904703963
1587 2904714717
1588 2906608230
1589 2906618698
1590 2906633337
1591 2906638862
1592 2906648225
1593 2906666305
1594 2908742622
1595 2908761195
1596 2908780246
1597 2909048215
1598 2917705064
1599 2919076480
1600 2922365422
1601 2922374467
1602 2922391030
1603 2922396161
1604 2922430358
1605 2929618131
1606 2929632319
1607 2932403361
1608 2932790424
1609 2932802718
1610 2932810844
1611 2932823824
1612 2932830054
1613 2933580059
1614 2935608946
1615 2935622719
1616 2935631602
1617 2935642481
1618 2935653351
1619 2935660178
1620 2935668215
1621 2935676246
1622 2935686323
1623 2935701141
1624 2935706076
1625 2935722342
1626 2935731629
1627 2935732237
1628 2935741616
1629 2935752288
1630 2935766570
1631 2935776942
1632 2935778593
1633 2935792258
1634 2935800421
1635 2935803074
1636 2935814391
1637 2935822106
1638 2935831528
1639 2935838388
1640 2935847688
1641 2935860968
1642 2935869695
1643 2935878886
1644 2935889810
1645 2935909040
1646 2935919760
1647 2935926386
1648 2935934836
1649 2935943286
1650 2935951724
1651 2935965779
1652 2935967849
1653 2935983812
1654 2935991653
1655 2935994717
1656 2936003359
1657 2936016221
1658 2936024854
1659 2936032102
1660 2936039947
1661 2936049963
1662 2936060915
1663 2937836998
1664 2940556910
1665 2941511396
1666 2941519097
1667 2941526323
1668 2941532884
1669 2941538944
1670 3005480279
1671 3005484385
1672 3005510386
1673 3005587982
1674 3005599298
1675 3005714976
1676 3005722381
1677 8001849792
1678 8006927083
1679 8006940605
1680 8006965808
1681 8006980294
1682 8006986460
1683 8006995971
1684 8016522263
1685 8016529550
1686 8016534762
1687 8016547981
1688 8016562528
1689 8016573112
1690 8016577256
1691 8016591673
1692 8016600317
1693 8016614504
1694 8016626495
1695 8016640260
1696 8017063294
1697 8019544942
1698 8019553590
1699 8019556673
1700 8019568636
1701 8019582728
1702 8019600836
1703 8019617718
1704 8019628246
1705 8019634380
1706 8019645352
1707 8019658479
1708 8019662259
1709 8019684327
1710 8019690143
1711 8055746280
1712 8056673804
1713 8056686714
1714 8056695268
1715 8056968098
1716 8057535531

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00152

tRNA-synt_2

tRNA synthetases class II (D, K and N)

147

633

0.98

PF01336

tRNA_anti-codon

OB-fold nucleic acid binding domain

43

130

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gro-assembly1.cif.gz_B crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori 0.9728 5 107
5gro-assembly1.cif.gz_B crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori 0.9635 5 107
6hhx-assembly1.cif.gz_A structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)cytidine 0.8937 5 582
7ap4-assembly1.cif.gz_A thermus thermophilus aspartyl-trna synthetase in complex with compound asps7hmdda 0.8937 5 582
6sjc-assembly1.cif.gz_A structure of t. thermophilus asprs in complex with 5'-o-(n-(l-aspartyl)-sulfamoyl)adenosine 0.8921 2 582
ID Description Score Start End Superfamily
1l0wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9782 5 110 2.40.50.140
5groB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9728 5 107 2.40.50.140
4o2dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9726 5 108 2.40.50.140
1c0aA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9649 5 108 2.40.50.140
5groB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9635 5 107 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A440IP98-F1-model_v4 deleted 1.001 2 75
AF-A0A2N7XT15-F1-model_v4 Aspartate--tRNA ligase 0.9928 417 498 GO:0004812
GO:0005524
GO:0006418
AF-A0A848THE6-F1-model_v4 Aspartate--tRNA ligase 0.9878 1 83 GO:0003676
GO:0004815
GO:0005524
GO:0006422
AF-A0A3M1FX05-F1-model_v4 Aspartate--tRNA ligase 0.986 1 80 GO:0003676
GO:0004815
GO:0005524
GO:0006422
AF-A0A357X821-F1-model_v4 deleted 0.9852 1 150

Map