F483750

General Info

Members Datasets Scaffolds Average Seq Length
858 756 298 157

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0027499|Ga0501031_0027499_1415_1945
Length 176
Sequence MLHKAGAVRPKEDGMTLEFRVNGRIGKPVAEVFDAVVNPAKLSGYFTTLGGASAPLVEGTTVTWWGMAPVVVEKVEKDALIVLRWDAMVEEGEAPYKTRVEMRFQPLEDGGTMVTIAETGWRDNARGQKSSYMNCEGWSQMLACMKAYLEYGINLREGYYPSEMKGVVTAEQQDFV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
10 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
11 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
12 2512875024 Mesorhizobium loti R88b Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
15 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
16 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
17 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
18 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
19 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
20 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
21 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
22 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
23 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
24 2516143018 Ensifer sp. BR816 Isolate Nodule
25 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
26 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
27 2519899620 Rhizobium sp. Pop5 Isolate Nodule
28 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
29 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
30 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
31 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
32 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
33 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
34 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
35 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
36 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
37 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
38 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
39 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
40 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
41 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
42 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
43 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
44 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
45 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
46 2643221557 Ensifer sp. Root558 Isolate Unclassified
47 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
48 2643221610 Ensifer sp. Root74 Isolate Unclassified
49 2643221618 Ensifer sp. Root231 Isolate Unclassified
50 2643221626 Ensifer sp. Root31 Isolate Unclassified
51 2643221655 Ensifer sp. Root1252 Isolate Unclassified
52 2643221659 Ensifer sp. Root127 Isolate Unclassified
53 2643221668 Ensifer sp. Root423 Isolate Unclassified
54 2643221675 Ensifer sp. Root1298 Isolate Unclassified
55 2643221680 Ensifer sp. Root1312 Isolate Unclassified
56 2643221698 Ensifer sp. Root142 Isolate Unclassified
57 2643221712 Ensifer sp. Root258 Isolate Unclassified
58 2643221723 Ensifer sp. Root278 Isolate Unclassified
59 2643221726 Ensifer sp. Root954 Isolate Unclassified
60 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
61 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
62 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
63 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
64 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
65 2718217882 Rhizobium sp. N741 Isolate Nodule
66 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
67 2718218009 Rhizobium sp. N561 Isolate Nodule
68 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
69 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
70 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
71 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
72 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
73 2718218363 Rhizobium sp. N113 Isolate Nodule
74 2718218365 Rhizobium sp. N731 Isolate Nodule
75 2718218366 Rhizobium sp. N621 Isolate Nodule
76 2721755514 Rhizobium sp. N6212 Isolate Nodule
77 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
78 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
79 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
80 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
81 2721755810 Rhizobium sp. N871 Isolate Nodule
82 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
83 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
84 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
85 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
86 2728369365 Rhizobium sp. N1341 Isolate Nodule
87 2728369397 Rhizobium sp. N1314 Isolate Nodule
88 2738543024 Aminobacter sp. AP02 Isolate Unclassified
89 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
90 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
91 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
92 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
93 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
94 2791355256 Rhizobium sp. M10 Isolate Nodule
95 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
96 2791355262 Rhizobium sp. M1 Isolate Nodule
97 2791355264 Rhizobium sp. S9 Isolate Nodule
98 2791355265 Rhizobium sp. H4 Isolate Nodule
99 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
100 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
101 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
102 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
103 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
104 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
105 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
106 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
107 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
108 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
109 2838048938 Rhizobium pisi 27/80 Isolate Nodule
110 2838061910 Rhizobium phaseoli L15 Isolate Nodule
111 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
112 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
113 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
114 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
115 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
116 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
117 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
118 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
119 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
120 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
121 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
122 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
123 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
124 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
125 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
126 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
127 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
128 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
129 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
130 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
131 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
132 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
133 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
134 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
135 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
136 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
137 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
138 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
139 2844163670 Ensifer sp. 1H6 Isolate Unclassified
140 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
141 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
142 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
143 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
144 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
145 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
146 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
147 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
148 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
149 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
150 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
151 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
152 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
153 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
154 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
155 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
156 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
157 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
158 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
159 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
160 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
161 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
162 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
163 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
164 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
165 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
166 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
167 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
168 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
169 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
170 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
171 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
172 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
173 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
174 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
175 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
176 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
177 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
178 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
179 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
180 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
181 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
182 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
183 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
184 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
185 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
186 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
187 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
188 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
189 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
190 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
191 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
192 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
193 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
194 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
195 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
196 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
197 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
198 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
199 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
200 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
201 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
202 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
203 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
204 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
205 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
206 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
207 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
208 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
209 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
210 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
211 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
212 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
213 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
214 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
215 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
216 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
217 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
218 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
219 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
220 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
221 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
222 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
223 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
224 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
225 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
226 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
227 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
228 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
229 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
230 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
231 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
232 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
233 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
234 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
235 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
236 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
237 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
238 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
239 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
240 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
241 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
242 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
243 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
244 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
245 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
246 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
247 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
248 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
249 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
250 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
251 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
252 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
253 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
254 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
255 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
256 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
257 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
258 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
259 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
260 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
261 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
262 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
263 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
264 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
265 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
266 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
267 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
268 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
269 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
270 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
271 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
272 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
273 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
274 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
275 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
276 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
277 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
278 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
279 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
280 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
281 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
282 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
283 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
284 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
285 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
286 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
287 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
288 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
289 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
290 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
291 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
292 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
293 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
294 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
295 2933599457 Rhizobium phaseoli M3 Isolate Nodule
296 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
297 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
298 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
299 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
300 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
301 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
302 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
303 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
304 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
305 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
306 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
307 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
308 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
309 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
310 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
311 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
312 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
313 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
314 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
315 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
316 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
317 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
318 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
319 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
320 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
321 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
322 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
323 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
324 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
325 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
326 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
327 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
328 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
329 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
330 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
331 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
332 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
333 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
334 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
335 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
336 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
337 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
338 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
339 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
340 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
341 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
342 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
343 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
344 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
345 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
346 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
347 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
348 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
349 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
350 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
351 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
352 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
353 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
354 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
355 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
356 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
357 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
358 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
359 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
360 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
361 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
362 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
363 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
364 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
365 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
366 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
367 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
368 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
369 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
370 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
371 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
372 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
373 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
374 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
375 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
376 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
377 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
378 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
379 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
380 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
381 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
382 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
383 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
384 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
385 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
386 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
387 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
388 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
389 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
390 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
391 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
392 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
393 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
394 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
395 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
396 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
397 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
398 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
399 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
400 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
401 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
402 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
403 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
404 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
405 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
406 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
407 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
408 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
409 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
410 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
411 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
412 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
413 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
414 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
415 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
416 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
417 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
418 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
419 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
420 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
421 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
422 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
423 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
424 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
425 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
426 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
427 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
428 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
429 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
430 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
431 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
432 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
433 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
434 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
435 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
436 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
437 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
438 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
439 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
440 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
441 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
442 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
443 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
444 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
445 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
446 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
447 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
448 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
449 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
450 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
451 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
452 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
453 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
454 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
455 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
456 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
457 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
458 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
459 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
460 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
461 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
462 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
463 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
464 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
465 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
466 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
467 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
468 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
469 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
470 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
471 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
472 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
473 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
474 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
475 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
476 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
477 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
478 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
479 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
480 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
481 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
482 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
483 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
484 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
485 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
486 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
487 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
488 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
489 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
490 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
491 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
492 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
493 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
494 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
495 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
496 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
497 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
498 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
499 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
500 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
501 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
502 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
503 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
504 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
505 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
506 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
507 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
508 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
509 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
510 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
511 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
512 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
513 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
514 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
515 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
516 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
517 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
518 2996893221 Rhizobium sp. R635 Isolate Nodule
519 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
520 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
521 3004167301 Mesorhizobium loti 582 Isolate Unclassified
522 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
523 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
524 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
525 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
526 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
527 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
528 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
529 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
530 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
531 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
532 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
533 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
534 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
535 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
536 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
537 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
538 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
539 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
540 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
541 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
542 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
543 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
544 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
545 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
546 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
547 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
548 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
549 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
550 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
551 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
552 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
553 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
554 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
555 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
556 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
557 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
558 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
559 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
560 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
561 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
562 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
563 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
564 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
565 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
566 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
567 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
568 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
569 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
570 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
571 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
572 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
573 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
574 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
575 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
576 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
577 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
578 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
579 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
580 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
581 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
582 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
583 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
584 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
585 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
586 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
587 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
588 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
589 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
590 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
591 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
592 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
593 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
594 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
595 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
596 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
597 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
598 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
599 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
600 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
601 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
602 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
603 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
604 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
605 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
606 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
607 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
608 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
609 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
610 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
611 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
612 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
613 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
614 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
615 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
616 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
617 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
618 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
619 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
620 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
621 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
622 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
623 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
634 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
637 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
638 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
639 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
640 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
641 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
642 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
643 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
644 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
645 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
646 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
647 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
648 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
649 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
650 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
651 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
652 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
653 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
654 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
655 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
656 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
657 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
658 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
659 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
660 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
661 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
662 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
663 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
664 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
665 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
666 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
667 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
668 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
669 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
670 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
671 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
672 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
673 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
674 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
675 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
676 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
677 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
678 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
679 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
680 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
681 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
682 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
683 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
684 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
685 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
686 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
687 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
688 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
689 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
690 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
691 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
692 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
693 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
694 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
695 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
696 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
697 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
698 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
699 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
700 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
701 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
702 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
703 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
704 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
705 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
706 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
707 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
708 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
709 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
710 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
711 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
712 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
713 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
714 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
715 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
716 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
717 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
718 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
719 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
720 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
721 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
722 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
723 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
724 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
725 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
726 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
727 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
728 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
729 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
730 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
731 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
732 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
733 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
734 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
735 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
736 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
737 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
738 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
739 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
740 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
741 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
742 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
743 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
744 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
745 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
746 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
747 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
748 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
749 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
750 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
751 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
752 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
753 8024501048 Rhizobium sp. H4 Isolate Nodule
754 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
755 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
756 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 34.73
Metatranscriptomes 0
Isolates 65.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.88
Nodule 60.02
Rhizoplane 1.28
Rhizosphere 21.91
Stem 0
Stem Tuber 0
Unclassified 9.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5973844 2162886012 Bacteria 2292
2 JGI25157J39369_1001905 3300002741 Bacteria 6330
3 JGI25159J45721_1000002 3300002987 Bacteria 289163
4 JGI25151J46595_10003263 3300003187 Bacteria 9018
5 JGI25151J46595_10037268 3300003187 Bacteria 1825
6 JGI25406J46586_10020174 3300003203 Bacteria 2701
7 JGI25165J46597_1000026 3300003214 Bacteria 332550
8 rootH1_10308392 3300003323 Bacteria 1478
9 JGI25160J50197_1000008 3300003354 Bacteria 289163
10 JGI25161J50226_1000380 3300003374 Bacteria 22370
11 Ga0055526_1001532 3300003771 Bacteria 16363
12 Ga0055526_1020128 3300003771 Bacteria 2393
13 Ga0055524_1009409 3300003775 Bacteria 3975
14 Ga0055524_1042053 3300003775 Bacteria 1142
15 Ga0055536_1000472 3300003781 Bacteria 28068
16 Ga0055528_1000695 3300003790 Bacteria 23949
17 Ga0055530_10028298 3300003791 Bacteria 1515
18 Ga0055540_1048502 3300003792 Bacteria 885
19 Ga0055531_10048091 3300003794 Bacteria 1154
20 Ga0055543_1001421 3300004625 Bacteria 9510
21 Ga0065165_1000015 3300005262 Bacteria 289201
22 Ga0065714_10069095 3300005288 Bacteria 4393
23 Ga0065715_10119301 3300005293 Bacteria 2279
24 Ga0065715_10452646 3300005293 Unclassified 824
25 Ga0070658_10087132 3300005327 Bacteria 2569
26 Ga0070658_10644078 3300005327 Unclassified 919
27 Ga0070683_101176108 3300005329 Bacteria 737
28 Ga0070670_101507696 3300005331 Bacteria 617
29 Ga0070682_100529678 3300005337 Bacteria 918
30 Ga0070660_100087258 3300005339 Bacteria 2456
31 Ga0070689_100294181 3300005340 Bacteria 1350
32 Ga0070708_101028304 3300005445 Bacteria 772
33 Ga0070663_100447920 3300005455 Bacteria 1064
34 Ga0070663_100462331 3300005455 Bacteria 1048
35 Ga0068853_100009794 3300005539 Bacteria 7735
36 Ga0070665_100017478 3300005548 Bacteria 7202
37 Ga0068855_100391737 3300005563 Bacteria 1524
38 Ga0068855_100549196 3300005563 Bacteria 1251
39 Ga0070664_100257734 3300005564 Bacteria 1569
40 Ga0068857_101107891 3300005577 Bacteria 765
41 Ga0068854_101707541 3300005578 Bacteria 576
42 Ga0068856_100148752 3300005614 Bacteria 2350
43 Ga0068852_100499633 3300005616 Bacteria 1211
44 Ga0068852_100584685 3300005616 Bacteria 1120
45 Ga0068861_100200569 3300005719 Bacteria 1674
46 Ga0081455_10140534 3300005937 Bacteria 1876
47 Ga0081455_10281489 3300005937 Bacteria 1201
48 Ga0081540_1028275 3300005983 Bacteria 3153
49 Ga0081539_10011472 3300005985 Bacteria 6997
50 Ga0075365_10018565 3300006038 Bacteria 4278
51 Ga0075365_10103065 3300006038 Bacteria 1955
52 Ga0075364_10081734 3300006051 Bacteria 2136
53 Ga0075362_10066582 3300006177 Bacteria 1637
54 Ga0075367_10040262 3300006178 Bacteria 2728
55 Ga0075367_10139142 3300006178 Bacteria 1503
56 Ga0075370_10142444 3300006353 Bacteria 1402
57 Ga0079104_1002663 3300006946 Bacteria 9244
58 Ga0105251_10028986 3300009011 Bacteria 2792
59 Ga0105240_10190481 3300009093 Bacteria 2412
60 Ga0105240_10250975 3300009093 Bacteria 2046
61 Ga0105240_10257546 3300009093 Bacteria 2014
62 Ga0105245_12189446 3300009098 Bacteria 607
63 Ga0105241_10141126 3300009174 Bacteria 1962
64 Ga0105237_10037744 3300009545 Bacteria 4882
65 Ga0105237_10184515 3300009545 Bacteria 2086
66 Ga0105237_10307718 3300009545 Bacteria 1587
67 Ga0105237_10897705 3300009545 Bacteria 893
68 Ga0105238_10014332 3300009551 Bacteria 8013
69 Ga0123341_1000014 3300009765 Bacteria 91980
70 Ga0123342_1013393 3300009766 Bacteria 8240
71 Ga0105239_10113116 3300010375 Bacteria 3010
72 Ga0105239_10148900 3300010375 Bacteria 2612
73 Ga0105239_10655268 3300010375 Bacteria 1199
74 Ga0171463_1001 3300013249 Bacteria 1406070
75 Ga0157374_10361575 3300013296 Bacteria 1443
76 Ga0163162_12480084 3300013306 Bacteria 596
77 Ga0157372_10548781 3300013307 Bacteria 1347
78 Ga0182008_10014738 3300014497 Bacteria 4089
79 Ga0157379_10250630 3300014968 Bacteria 1607
80 Ga0157376_11106017 3300014969 Bacteria 818
81 Ga0157376_11273300 3300014969 Bacteria 765
82 Ga0182006_1023627 3300015261 Bacteria 2544
83 Ga0182007_10129746 3300015262 Bacteria 847
84 Ga0182005_1034307 3300015265 Bacteria 1380
85 Ga0183363_1371 3300015690 Bacteria 4706
86 Ga0163161_10624466 3300017792 Unclassified 891
87 Ga0163161_10806972 3300017792 Bacteria 789
88 Ga0163161_11253818 3300017792 Unclassified 643
89 Ga0214544_1009397 3300021320 Bacteria 15366
90 Ga0214542_1000006 3300021321 Bacteria 345164
91 Ga0214542_1016019 3300021321 Bacteria 7491
92 Ga0214543_1000003 3300021327 Bacteria 692327
93 Ga0214543_1000014 3300021327 Bacteria 324986
94 Ga0228711_1000001 3300022739 Bacteria 357377
95 Ga0228710_1000001 3300022740 Bacteria 314328
96 Ga0209436_103040 3300025208 Bacteria 4638
97 Ga0207425_1034930 3300025245 Bacteria 983
98 Ga0209646_1009064 3300025246 Bacteria 1585
99 Ga0209026_1000032 3300025250 Bacteria 322378
100 Ga0209148_1000317 3300025254 Bacteria 67724
101 Ga0209759_1000168 3300025256 Bacteria 111106
102 Ga0209233_1000030 3300025261 Bacteria 636702
103 Ga0209455_1000152 3300025272 Bacteria 125942
104 Ga0209673_1000060 3300025273 Bacteria 263602
105 Ga0209130_1000007 3300025284 Bacteria 591584
106 Ga0209130_1009004 3300025284 Bacteria 2884
107 Ga0209130_1020116 3300025284 Bacteria 1533
108 Ga0209676_1000901 3300025292 Bacteria 37489
109 Ga0209025_1000100 3300025294 Bacteria 229182
110 Ga0209025_1000149 3300025294 Bacteria 173393
111 Ga0209025_1059964 3300025294 Bacteria 1432
112 Ga0209564_1000116 3300025295 Bacteria 207889
113 Ga0209564_1000439 3300025295 Bacteria 71637
114 Ga0209758_1002727 3300025297 Bacteria 17386
115 Ga0209050_1001222 3300025298 Bacteria 29857
116 Ga0209256_1000302 3300025299 Bacteria 86634
117 Ga0209256_1001410 3300025299 Bacteria 24985
118 Ga0209256_1001505 3300025299 Bacteria 23627
119 Ga0207426_1000064 3300025302 Bacteria 358276
120 Ga0209051_1001024 3300025303 Bacteria 26621
121 Ga0209257_1004371 3300025304 Bacteria 10994
122 Ga0207647_10015579 3300025904 Bacteria 5207
123 Ga0207647_10307730 3300025904 Bacteria 901
124 Ga0207705_11060381 3300025909 Bacteria 625
125 Ga0207705_11294730 3300025909 Unclassified 557
126 Ga0207695_10093719 3300025913 Bacteria 3012
127 Ga0207695_10218061 3300025913 Bacteria 1816
128 Ga0207671_10009507 3300025914 Bacteria 8121
129 Ga0207671_10077697 3300025914 Bacteria 2485
130 Ga0207649_11010219 3300025920 Bacteria 655
131 Ga0207694_10005781 3300025924 Bacteria 9472
132 Ga0207694_10354572 3300025924 Bacteria 1215
133 Ga0207650_11211618 3300025925 Bacteria 643
134 Ga0207669_11395023 3300025937 Bacteria 596
135 Ga0207661_10648741 3300025944 Bacteria 970
136 Ga0207667_10314258 3300025949 Bacteria 1600
137 Ga0207640_10868167 3300025981 Bacteria 786
138 Ga0207639_10191343 3300026041 Bacteria 1748
139 Ga0207639_10481515 3300026041 Bacteria 1131
140 Ga0207678_10555793 3300026067 Bacteria 1004
141 Ga0207702_10099181 3300026078 Bacteria 2567
142 Ga0207702_10973178 3300026078 Bacteria 841
143 Ga0207675_100361887 3300026118 Bacteria 1423
144 Ga0207698_10212487 3300026142 Bacteria 1742
145 Ga0207698_10438004 3300026142 Bacteria 1258
146 Ga0209281_1000164 3300027111 Bacteria 157372
147 Ga0209281_1000332 3300027111 Bacteria 81534
148 Ga0209995_1018296 3300027471 Bacteria 1155
149 Ga0209968_1040726 3300027526 Bacteria 794
150 Ga0210002_1001574 3300027617 Bacteria 3245
151 Ga0209282_1000007 3300027666 Bacteria 254917
152 Ga0268266_10055195 3300028379 Bacteria 3415
153 Ga0268266_10247192 3300028379 Bacteria 1649
154 Ga0307515_10010909 3300028794 Bacteria 17337
155 Ga0265330_10092837 3300031235 Unclassified 1295
156 Ga0265316_10003337 3300031344 Bacteria 16268
157 Ga0307513_10683123 3300031456 Bacteria 733
158 Ga0307408_100143678 3300031548 Bacteria 1876
159 Ga0307408_100504969 3300031548 Unclassified 1059
160 Ga0265342_10142060 3300031712 Bacteria 1339
161 Ga0307405_10398356 3300031731 Bacteria 1077
162 Ga0307405_10484934 3300031731 Bacteria 988
163 Ga0307413_10329468 3300031824 Bacteria 1170
164 Ga0307410_10084137 3300031852 Bacteria 2242
165 Ga0307410_10760979 3300031852 Bacteria 821
166 Ga0307407_10402170 3300031903 Unclassified 983
167 Ga0307412_10278503 3300031911 Bacteria 1312
168 Ga0307412_10580729 3300031911 Bacteria 946
169 Ga0315914_1000006 3300031967 Bacteria 239817
170 Ga0307409_100531361 3300031995 Bacteria 1151
171 Ga0307414_10007022 3300032004 Bacteria 6311
172 Ga0307414_10978351 3300032004 Bacteria 778
173 Ga0307411_10347892 3300032005 Unclassified 1207
174 Ga0307415_100788128 3300032126 Bacteria 866
175 Ga0315913_1000002 3300033430 Bacteria 241452
176 Ga0315915_1000001 3300033464 Bacteria 481518
177 Ga0395900_0000086 3300037418 Bacteria 171749
178 Ga0395900_0037626 3300037418 Bacteria 4988
179 Ga0395900_0113571 3300037418 Bacteria 2780
180 Ga0395900_0204313 3300037418 Bacteria 1997
181 Ga0395900_0542594 3300037418 Bacteria 1108
182 Ga0395900_0563002 3300037418 Bacteria 1083
183 Ga0395898_0000285 3300037466 Bacteria 122279
184 Ga0395898_0377081 3300037466 Bacteria 1353
185 Ga0395905_0000133 3300037471 Bacteria 123500
186 Ga0395905_0013448 3300037471 Bacteria 7842
187 Ga0395905_0057943 3300037471 Bacteria 3623
188 Ga0395905_0202608 3300037471 Bacteria 1860
189 Ga0395905_0712137 3300037471 Bacteria 906
190 Ga0395901_0000092 3300038443 Bacteria 121976
191 Ga0395901_0092747 3300038443 Bacteria 3161
192 Ga0439436_0095732 3300041404 Bacteria 827
193 Ga0451797_0807725 3300041453 Bacteria 679
194 Ga0451807_1405731 3300041486 Bacteria 893
195 Ga0451843_0881156 3300041509 Bacteria 930
196 Ga0439432_175970 3300042006 Bacteria 624
197 Ga0439432_209490 3300042006 Bacteria 564
198 Ga0439449_0004505 3300042007 Bacteria 5381
199 Ga0439449_0048980 3300042007 Bacteria 1564
200 Ga0439452_091809 3300042010 Bacteria 656
201 Ga0439457_097133 3300042014 Bacteria 685
202 Ga0439462_0012305 3300042015 Bacteria 2185
203 Ga0439462_0066951 3300042015 Bacteria 974
204 Ga0450907_057460 3300042146 Bacteria 671
205 Ga0466972_0030469 3300044658 Bacteria 2655
206 Ga0466965_0073933 3300044683 Bacteria 1717
207 Ga0453684_0017407 3300044712 Bacteria 11135
208 Ga0453684_0125593 3300044712 Bacteria 3089
209 Ga0453684_0645549 3300044712 Bacteria 1155
210 Ga0466968_0219107 3300044735 Bacteria 896
211 Ga0466960_0010566 3300044901 Bacteria 3837
212 Ga0495638_0016774 3300046460 Bacteria 4897
213 Ga0495638_0096771 3300046460 Bacteria 1771
214 Ga0495668_0048543 3300046616 Bacteria 2355
215 Ga0496102_0218210 3300048905 Bacteria 1798
216 Ga0496104_0296385 3300048907 Bacteria 1530
217 Ga0496110_1017699 3300048913 Unclassified 736
218 Ga0496111_0903756 3300048914 Bacteria 636
219 Ga0496112_0147547 3300048915 Bacteria 2320
220 Ga0496112_0182878 3300048915 Bacteria 2060
221 Ga0496113_0690889 3300048916 Bacteria 815
222 Ga0496116_0324828 3300048919 Bacteria 718
223 Ga0496117_0004346 3300048920 Bacteria 15725
224 Ga0496117_0205089 3300048920 Bacteria 1111
225 Ga0496117_0305698 3300048920 Bacteria 840
226 Ga0496118_0274577 3300048921 Bacteria 942
227 Ga0496119_0315895 3300048922 Unclassified 766
228 Ga0496119_0316580 3300048922 Bacteria 765
229 Ga0496120_0003298 3300048923 Bacteria 14842
230 Ga0496120_0046760 3300048923 Bacteria 2499
231 Ga0496121_0242835 3300048924 Bacteria 1254
232 Ga0496122_0000492 3300048925 Bacteria 82125
233 Ga0496122_0074246 3300048925 Bacteria 2407
234 Ga0496123_0000460 3300048926 Bacteria 71476
235 Ga0496124_0000679 3300048927 Bacteria 55901
236 Ga0496124_0125990 3300048927 Bacteria 2040
237 Ga0496124_0280936 3300048927 Bacteria 1214
238 Ga0496125_0006717 3300048928 Bacteria 12370
239 Ga0496125_0068286 3300048928 Bacteria 2797
240 Ga0496125_0201839 3300048928 Bacteria 1301
241 Ga0496126_0000811 3300048929 Bacteria 55747
242 Ga0496126_0067806 3300048929 Bacteria 3187
243 Ga0496126_0156100 3300048929 Bacteria 1953
244 Ga0496126_0310346 3300048929 Bacteria 1299
245 Ga0496126_0556107 3300048929 Bacteria 910
246 Ga0501031_0000016 3300049568 Bacteria 110858
247 Ga0501031_0027499 3300049568 Bacteria 3708
248 Ga0501032_0000044 3300049569 Bacteria 110899
249 Ga0501032_0110421 3300049569 Bacteria 1820
250 Ga0501032_0488473 3300049569 Bacteria 787
251 Ga0501033_0000052 3300049570 Bacteria 110545
252 Ga0501033_0050698 3300049570 Bacteria 3078
253 Ga0501034_0000212 3300049571 Bacteria 110795
254 Ga0501034_0106196 3300049571 Bacteria 2801
255 Ga0501034_0190948 3300049571 Bacteria 2010
256 Ga0501036_0000022 3300049572 Bacteria 111251
257 Ga0501036_0068018 3300049572 Bacteria 3014
258 Ga0501036_0196357 3300049572 Bacteria 1698
259 Ga0501036_1071239 3300049572 Bacteria 659
260 Ga0501037_0000052 3300049573 Bacteria 110932
261 Ga0501037_0177474 3300049573 Bacteria 1512
262 Ga0501038_0000044 3300049574 Bacteria 110876
263 Ga0501038_0145408 3300049574 Bacteria 1936
264 Ga0501039_0000042 3300049575 Bacteria 113008
265 Ga0501039_0178980 3300049575 Bacteria 1668
266 Ga0501043_0000054 3300049579 Bacteria 105924
267 Ga0501043_0016295 3300049579 Bacteria 5828
268 Ga0501043_0205076 3300049579 Bacteria 1529
269 Ga0501043_0265183 3300049579 Bacteria 1320
270 Ga0501046_0147468 3300049580 Bacteria 1776
271 Ga0501047_0000247 3300049581 Bacteria 64318
272 Ga0501047_0172411 3300049581 Bacteria 2032
273 Ga0501047_0446572 3300049581 Bacteria 1123
274 Ga0501048_0352098 3300049582 Bacteria 1050
275 Ga0501068_0216144 3300049584 Bacteria 1218
276 Ga0501070_0036686 3300049586 Bacteria 4094
277 Ga0501080_0662982 3300049742 Bacteria 922
278 Ga0501083_0075369 3300049744 Bacteria 2241
279 Ga0501035_0000095 3300049822 Bacteria 110735
280 Ga0501035_0558067 3300049822 Bacteria 937
281 Ga0501035_1289438 3300049822 Bacteria 563
282 Ga0501044_0000091 3300049823 Bacteria 111251
283 Ga0501044_0055765 3300049823 Bacteria 4058
284 Ga0501044_0104329 3300049823 Bacteria 2849
285 Ga0501044_0172718 3300049823 Bacteria 2131
286 Ga0501044_0336996 3300049823 Bacteria 1430
287 nmdc:mga03683_265999_c1 3300050489 Bacteria 799
288 nmdc:mga03n38_40232_c1 3300050490 Bacteria 2031
289 nmdc:mga00v17_371351_c1 3300050491 Bacteria 930
290 nmdc:mga0yw44_492503_c1 3300050492 Bacteria 832
291 nmdc:mga0sz30_88995_c1 3300050516 Bacteria 1342
292 Ga0500595_115477 3300053119 Bacteria 761
293 Ga0500604_0062408 3300053151 Bacteria 1173
294 Ga0500620_000145 3300053155 Bacteria 14299
295 Ga0500627_0018583 3300053158 Bacteria 2753
296 Ga0500627_0155179 3300053158 Bacteria 1034
297 Ga0500611_004297 3300053727 Bacteria 1911
298 Ga0500611_057268 3300053727 Bacteria 912

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031852 Ga0307410_10084137 Ga0307410_100841373 126
2 iso_pu_bacteria 2970510686 2970511646 133
3 iso_pu_bacteria 2924748358 2924748705 134
4 iso_pu_bacteria 2958041894 2958055471 135
5 iso_pu_bacteria 2960693952 2960699316 136
6 3300017792 Ga0163161_10806972 Ga0163161_108069721 138
7 3300031548 Ga0307408_100504969 Ga0307408_1005049692 139
8 3300031903 Ga0307407_10402170 Ga0307407_104021702 139
9 3300032005 Ga0307411_10347892 Ga0307411_103478922 139
10 3300005288 Ga0065714_10069095 Ga0065714_100690952 140
11 3300005293 Ga0065715_10452646 Ga0065715_104526461 140
12 3300014969 Ga0157376_11273300 Ga0157376_112733002 140
13 3300017792 Ga0163161_11253818 Ga0163161_112538181 140
14 3300027471 Ga0209995_1018296 Ga0209995_10182962 140
15 3300027526 Ga0209968_1040726 Ga0209968_10407262 140
16 3300027617 Ga0210002_1001574 Ga0210002_10015744 140
17 3300031235 Ga0265330_10092837 Ga0265330_100928372 140
18 3300031344 Ga0265316_10003337 Ga0265316_100033379 140
19 3300031712 Ga0265342_10142060 Ga0265342_101420602 140
20 3300032004 Ga0307414_10007022 Ga0307414_100070227 140
21 3300037418 Ga0395900_0204313 Ga0395900_0204313_284_736 140
22 3300044712 Ga0453684_0017407 Ga0453684_0017407_1285_1788 140
23 3300044712 Ga0453684_0125593 Ga0453684_0125593_2199_2660 140
24 3300044712 Ga0453684_0645549 Ga0453684_0645549_300_761 140
25 3300005339 Ga0070660_100087258 Ga0070660_1000872581 141
26 3300005340 Ga0070689_100294181 Ga0070689_1002941812 141
27 3300013307 Ga0157372_10548781 Ga0157372_105487813 141
28 iso_pu_bacteria 2643221564 2643836885 141
29 iso_pu_bacteria 3003930520 3003932624 142
30 3300032126 Ga0307415_100788128 Ga0307415_1007881281 143
31 iso_pu_bacteria 2508501122 2509108477 143
32 iso_pu_bacteria 2508501127 2509142139 143
33 iso_pu_bacteria 2509276019 2509374496 143
34 iso_pu_bacteria 2509276022 2509394220 143
35 iso_pu_bacteria 2509276033 2509447802 143
36 iso_pu_bacteria 2510065057 2510306609 143
37 iso_pu_bacteria 2510065059 2510318082 143
38 iso_pu_bacteria 2511231052 2511500972 143
39 iso_pu_bacteria 2512047086 2512532388 143
40 iso_pu_bacteria 2512875016 2512933321 143
41 iso_pu_bacteria 2512875024 2512961422 143
42 iso_pu_bacteria 2512875026 2512972286 143
43 iso_pu_bacteria 2513237086 2513583490 143
44 iso_pu_bacteria 2513237089 2513603365 143
45 iso_pu_bacteria 2513237090 2513610397 143
46 iso_pu_bacteria 2513237091 2513620773 143
47 iso_pu_bacteria 2513237140 2513881139 143
48 iso_pu_bacteria 2513237143 2513907124 143
49 iso_pu_bacteria 2513237156 2513983970 143
50 iso_pu_bacteria 2513237160 2514004820 143
51 iso_pu_bacteria 2513237305 2514417124 143
52 iso_pu_bacteria 2515154107 2515608087 143
53 iso_pu_bacteria 2516143018 2516208841 143
54 iso_pu_bacteria 2516653046 2516892253 143
55 iso_pu_bacteria 2517487022 2517569049 143
56 iso_pu_bacteria 2519899620 2520377859 143
57 iso_pu_bacteria 2524023207 2524451185 143
58 iso_pu_bacteria 2529292951 2530646832 143
59 iso_pu_bacteria 2551306084 2551676432 143
60 iso_pu_bacteria 2551306085 2551687211 143
61 iso_pu_bacteria 2551306086 2551692942 143
62 iso_pu_bacteria 2551306087 2551703187 143
63 iso_pu_bacteria 2551306089 2551712352 143
64 iso_pu_bacteria 2551306090 2551720673 143
65 iso_pu_bacteria 2551306091 2551731099 143
66 iso_pu_bacteria 2551306092 2551731977 143
67 iso_pu_bacteria 2551306093 2551740403 143
68 iso_pu_bacteria 2558860100 2558863523 143
69 iso_pu_bacteria 2588253730 2588519389 143
70 iso_pu_bacteria 2597489875 2597811665 143
71 iso_pu_bacteria 2599185301 2599937207 143
72 iso_pu_bacteria 2599185352 2600191887 143
73 iso_pu_bacteria 2643221551 2643777050 143
74 iso_pu_bacteria 2643221555 2643795498 143
75 iso_pu_bacteria 2643221557 2643807247 143
76 iso_pu_bacteria 2643221610 2644069486 143
77 iso_pu_bacteria 2643221618 2644109038 143
78 iso_pu_bacteria 2643221626 2644151559 143
79 iso_pu_bacteria 2643221655 2644311694 143
80 iso_pu_bacteria 2643221659 2644329951 143
81 iso_pu_bacteria 2643221668 2644380629 143
82 iso_pu_bacteria 2643221675 2644420640 143
83 iso_pu_bacteria 2643221680 2644454165 143
84 iso_pu_bacteria 2643221698 2644546625 143
85 iso_pu_bacteria 2643221712 2644617493 143
86 iso_pu_bacteria 2643221723 2644675697 143
87 iso_pu_bacteria 2643221726 2644689502 143
88 iso_pu_bacteria 2657244999 2657683307 143
89 iso_pu_bacteria 2687453392 2688596569 143
90 iso_pu_bacteria 2690316117 2692316865 143
91 iso_pu_bacteria 2693429783 2694629952 143
92 iso_pu_bacteria 2693429784 2694635764 143
93 iso_pu_bacteria 2718217882 2719182484 143
94 iso_pu_bacteria 2718217997 2719666788 143
95 iso_pu_bacteria 2718218009 2719733203 143
96 iso_pu_bacteria 2718218199 2720493208 143
97 iso_pu_bacteria 2718218232 2720614684 143
98 iso_pu_bacteria 2718218233 2720621457 143
99 iso_pu_bacteria 2718218235 2720632785 143
100 iso_pu_bacteria 2718218269 2720776509 143
101 iso_pu_bacteria 2718218363 2721148597 143
102 iso_pu_bacteria 2718218365 2721159983 143
103 iso_pu_bacteria 2718218366 2721165411 143
104 iso_pu_bacteria 2721755514 2722841581 143
105 iso_pu_bacteria 2721755556 2723028097 143
106 iso_pu_bacteria 2721755684 2723561728 143
107 iso_pu_bacteria 2721755685 2723568357 143
108 iso_pu_bacteria 2721755686 2723573679 143
109 iso_pu_bacteria 2721755810 2724045959 143
110 iso_pu_bacteria 2721755819 2724091116 143
111 iso_pu_bacteria 2721755822 2724105622 143
112 iso_pu_bacteria 2721755823 2724111449 143
113 iso_pu_bacteria 2728369352 2730109033 143
114 iso_pu_bacteria 2728369365 2730165719 143
115 iso_pu_bacteria 2728369397 2730299615 143
116 iso_pu_bacteria 2738543024 2739310196 143
117 iso_pu_bacteria 2751185821 2753460769 143
118 iso_pu_bacteria 2756170246 2756673973 143
119 iso_pu_bacteria 2791355091 2792622723 143
120 iso_pu_bacteria 2791355092 2792628356 143
121 iso_pu_bacteria 2791355094 2792638382 143
122 iso_pu_bacteria 2791355256 2793293762 143
123 iso_pu_bacteria 2791355259 2793313180 143
124 iso_pu_bacteria 2791355262 2793333253 143
125 iso_pu_bacteria 2791355264 2793347256 143
126 iso_pu_bacteria 2791355265 2793356607 143
127 iso_pu_bacteria 2802428858 2802717692 143
128 iso_pu_bacteria 2802428859 2802723380 143
129 iso_pu_bacteria 2802428860 2802731169 143
130 iso_pu_bacteria 2802428861 2802736176 143
131 iso_pu_bacteria 2802428862 2802743614 143
132 iso_pu_bacteria 2802428863 2802750674 143
133 iso_pu_bacteria 2802429268 2804751303 143
134 iso_pu_bacteria 2802429605 2805930626 143
135 iso_pu_bacteria 2802429606 2805934196 143
136 iso_pu_bacteria 2838022645 2838024416 143
137 iso_pu_bacteria 2838048938 2838051300 143
138 iso_pu_bacteria 2838061910 2838063723 143
139 iso_pu_bacteria 2838068647 2838074293 143
140 iso_pu_bacteria 2838074704 2838076401 143
141 iso_pu_bacteria 2838668709 2838671272 143
142 iso_pu_bacteria 2838701080 2838703547 143
143 iso_pu_bacteria 2841734538 2841736997 143
144 iso_pu_bacteria 2842146304 2842149451 143
145 iso_pu_bacteria 2842192696 2842197783 143
146 iso_pu_bacteria 2842198810 2842199959 143
147 iso_pu_bacteria 2842205361 2842208183 143
148 iso_pu_bacteria 2842250916 2842253911 143
149 iso_pu_bacteria 2842264693 2842266490 143
150 iso_pu_bacteria 2842278818 2842281808 143
151 iso_pu_bacteria 2842285085 2842288913 143
152 iso_pu_bacteria 2842317721 2842321524 143
153 iso_pu_bacteria 2842402390 2842406420 143
154 iso_pu_bacteria 2842409023 2842413153 143
155 iso_pu_bacteria 2842415677 2842419796 143
156 iso_pu_bacteria 2842422224 2842427917 143
157 iso_pu_bacteria 2842428310 2842429809 143
158 iso_pu_bacteria 2842434925 2842436531 143
159 iso_pu_bacteria 2842441272 2842444234 143
160 iso_pu_bacteria 2842447887 2842450905 143
161 iso_pu_bacteria 2842462802 2842464230 143
162 iso_pu_bacteria 2842469257 2842470860 143
163 iso_pu_bacteria 2842489311 2842493140 143
164 iso_pu_bacteria 2842495871 2842499290 143
165 iso_pu_bacteria 2844002411 2844002479 143
166 iso_pu_bacteria 2844009547 2844011806 143
167 iso_pu_bacteria 2844163670 2844168562 143
168 iso_pu_bacteria 2847417321 2847418069 143
169 iso_pu_bacteria 2847670302 2847674342 143
170 iso_pu_bacteria 2847686936 2847690460 143
171 iso_pu_bacteria 2848992105 2848993043 143
172 iso_pu_bacteria 2850079185 2850080438 143
173 iso_pu_bacteria 2855825444 2855831323 143
174 iso_pu_bacteria 2855839649 2855840448 143
175 iso_pu_bacteria 2855872281 2855879181 143
176 iso_pu_bacteria 2856314179 2856317742 143
177 iso_pu_bacteria 2856320880 2856321383 143
178 iso_pu_bacteria 2856328259 2856328277 143
179 iso_pu_bacteria 2856334872 2856341036 143
180 iso_pu_bacteria 2856342000 2856342522 143
181 iso_pu_bacteria 2856349417 2856350088 143
182 iso_pu_bacteria 2856364286 2856366442 143
183 iso_pu_bacteria 2857349434 2857356872 143
184 iso_pu_bacteria 2857367948 2857368543 143
185 iso_pu_bacteria 2858800743 2858800977 143
186 iso_pu_bacteria 2869162929 2869165101 143
187 iso_pu_bacteria 2869169390 2869169990 143
188 iso_pu_bacteria 2869234852 2869236261 143
189 iso_pu_bacteria 2869242130 2869244390 143
190 iso_pu_bacteria 2869249662 2869255824 143
191 iso_pu_bacteria 2869256925 2869263632 143
192 iso_pu_bacteria 2869264136 2869268672 143
193 iso_pu_bacteria 2869271264 2869273923 143
194 iso_pu_bacteria 2869278585 2869285320 143
195 iso_pu_bacteria 2869285874 2869288147 143
196 iso_pu_bacteria 2871429161 2871430033 143
197 iso_pu_bacteria 2871435913 2871443610 143
198 iso_pu_bacteria 2871444079 2871450494 143
199 iso_pu_bacteria 2871451962 2871453946 143
200 iso_pu_bacteria 2871459585 2871464709 143
201 iso_pu_bacteria 2871466892 2871469524 143
202 iso_pu_bacteria 2871474448 2871479550 143
203 iso_pu_bacteria 2871481445 2871482142 143
204 iso_pu_bacteria 2871495908 2871497741 143
205 iso_pu_bacteria 2874102143 2874102399 143
206 iso_pu_bacteria 2874109183 2874113793 143
207 iso_pu_bacteria 2874116593 2874121104 143
208 iso_pu_bacteria 2874123672 2874130314 143
209 iso_pu_bacteria 2874131515 2874137915 143
210 iso_pu_bacteria 2874139085 2874146437 143
211 iso_pu_bacteria 2874146452 2874151780 143
212 iso_pu_bacteria 2874155637 2874159412 143
213 iso_pu_bacteria 2874162495 2874164687 143
214 iso_pu_bacteria 2876363079 2876364426 143
215 iso_pu_bacteria 2876369609 2876374257 143
216 iso_pu_bacteria 2876377896 2876382343 143
217 iso_pu_bacteria 2876386047 2876388473 143
218 iso_pu_bacteria 2876392853 2876396540 143
219 iso_pu_bacteria 2876399893 2876402079 143
220 iso_pu_bacteria 2876406927 2876408073 143
221 iso_pu_bacteria 2876413966 2876417831 143
222 iso_pu_bacteria 2876420981 2876422746 143
223 iso_pu_bacteria 2878035449 2878038801 143
224 iso_pu_bacteria 2878730984 2878735897 143
225 iso_pu_bacteria 2878738818 2878741484 143
226 iso_pu_bacteria 2878745973 2878749658 143
227 iso_pu_bacteria 2878760144 2878761964 143
228 iso_pu_bacteria 2878767105 2878768930 143
229 iso_pu_bacteria 2878774303 2878776894 143
230 iso_pu_bacteria 2878781027 2878783783 143
231 iso_pu_bacteria 2878788777 2878794650 143
232 iso_pu_bacteria 2881147464 2881149105 143
233 iso_pu_bacteria 2881155292 2881160338 143
234 iso_pu_bacteria 2881161766 2881165943 143
235 iso_pu_bacteria 2881853255 2881853470 143
236 iso_pu_bacteria 2882632389 2882638384 143
237 iso_pu_bacteria 2885305155 2885307425 143
238 iso_pu_bacteria 2885312484 2885313540 143
239 iso_pu_bacteria 2885326080 2885333955 143
240 iso_pu_bacteria 2885334103 2885335569 143
241 iso_pu_bacteria 2885342637 2885349459 143
242 iso_pu_bacteria 2885350715 2885355194 143
243 iso_pu_bacteria 2888337043 2888337633 143
244 iso_pu_bacteria 2888343758 2888344952 143
245 iso_pu_bacteria 2888350351 2888354151 143
246 iso_pu_bacteria 2889010040 2889015864 143
247 iso_pu_bacteria 2889016732 2889019083 143
248 iso_pu_bacteria 2891373044 2891374734 143
249 iso_pu_bacteria 2896384573 2896386602 143
250 iso_pu_bacteria 2903448605 2903455049 143
251 iso_pu_bacteria 2903492973 2903493887 143
252 iso_pu_bacteria 2903513507 2903517213 143
253 iso_pu_bacteria 2903521522 2903523411 143
254 iso_pu_bacteria 2903528002 2903531387 143
255 iso_pu_bacteria 2903540706 2903542539 143
256 iso_pu_bacteria 2904659560 2904663316 143
257 iso_pu_bacteria 2906308376 2906310696 143
258 iso_pu_bacteria 2906321335 2906324759 143
259 iso_pu_bacteria 2906328253 2906333556 143
260 iso_pu_bacteria 2906354277 2906359581 143
261 iso_pu_bacteria 2906363423 2906367961 143
262 iso_pu_bacteria 2906370794 2906375190 143
263 iso_pu_bacteria 2906378014 2906381624 143
264 iso_pu_bacteria 2906386501 2906392436 143
265 iso_pu_bacteria 2906393657 2906399335 143
266 iso_pu_bacteria 2906401398 2906405021 143
267 iso_pu_bacteria 2906408224 2906408554 143
268 iso_pu_bacteria 2906414383 2906417807 143
269 iso_pu_bacteria 2906427513 2906433242 143
270 iso_pu_bacteria 2913295892 2913297482 143
271 iso_pu_bacteria 2915980308 2915986172 143
272 iso_pu_bacteria 2915986958 2915990592 143
273 iso_pu_bacteria 2915993759 2915996260 143
274 iso_pu_bacteria 2916000859 2916005738 143
275 iso_pu_bacteria 2916007675 2916010927 143
276 iso_pu_bacteria 2916014648 2916016564 143
277 iso_pu_bacteria 2916021584 2916024763 143
278 iso_pu_bacteria 2916028427 2916032180 143
279 iso_pu_bacteria 2916035215 2916038165 143
280 iso_pu_bacteria 2916041962 2916047183 143
281 iso_pu_bacteria 2916048683 2916053211 143
282 iso_pu_bacteria 2916055098 2916055357 143
283 iso_pu_bacteria 2916061851 2916062823 143
284 iso_pu_bacteria 2916068649 2916074960 143
285 iso_pu_bacteria 2916076590 2916079316 143
286 iso_pu_bacteria 2920760137 2920762913 143
287 iso_pu_bacteria 2921201388 2921205723 143
288 iso_pu_bacteria 2921208531 2921213531 143
289 iso_pu_bacteria 2921237296 2921241623 143
290 iso_pu_bacteria 2921244191 2921247515 143
291 iso_pu_bacteria 2921250672 2921250954 143
292 iso_pu_bacteria 2921257292 2921260004 143
293 iso_pu_bacteria 2921263974 2921264234 143
294 iso_pu_bacteria 2921282425 2921282769 143
295 iso_pu_bacteria 2921289301 2921290129 143
296 iso_pu_bacteria 2921296804 2921299968 143
297 iso_pu_bacteria 2922130491 2922134277 143
298 iso_pu_bacteria 2922151315 2922155474 143
299 iso_pu_bacteria 2922158528 2922159594 143
300 iso_pu_bacteria 2922172374 2922174900 143
301 iso_pu_bacteria 2922178524 2922183755 143
302 iso_pu_bacteria 2922185730 2922192453 143
303 iso_pu_bacteria 2924144063 2924145599 143
304 iso_pu_bacteria 2924150972 2924155882 143
305 iso_pu_bacteria 2924158325 2924160574 143
306 iso_pu_bacteria 2924165586 2924168150 143
307 iso_pu_bacteria 2924172951 2924177846 143
308 iso_pu_bacteria 2924179722 2924186313 143
309 iso_pu_bacteria 2924186466 2924189513 143
310 iso_pu_bacteria 2924193448 2924198249 143
311 iso_pu_bacteria 2924200457 2924204058 143
312 iso_pu_bacteria 2924207177 2924209910 143
313 iso_pu_bacteria 2924214083 2924215175 143
314 iso_pu_bacteria 2924221636 2924226228 143
315 iso_pu_bacteria 2924228884 2924234935 143
316 iso_pu_bacteria 2924718760 2924726317 143
317 iso_pu_bacteria 2924726620 2924732285 143
318 iso_pu_bacteria 2924733363 2924737117 143
319 iso_pu_bacteria 2924741084 2924744313 143
320 iso_pu_bacteria 2924754689 2924760907 143
321 iso_pu_bacteria 2924776078 2924779166 143
322 iso_pu_bacteria 2933599457 2933604749 143
323 iso_pu_bacteria 2936367885 2936374994 143
324 iso_pu_bacteria 2936375103 2936380685 143
325 iso_pu_bacteria 2936996657 2937001095 143
326 iso_pu_bacteria 2937002841 2937009513 143
327 iso_pu_bacteria 2937009748 2937010887 143
328 iso_pu_bacteria 2937016420 2937018983 143
329 iso_pu_bacteria 2937023124 2937027924 143
330 iso_pu_bacteria 2937029754 2937029867 143
331 iso_pu_bacteria 2937036028 2937036893 143
332 iso_pu_bacteria 2937042894 2937048990 143
333 iso_pu_bacteria 2937049772 2937056283 143
334 iso_pu_bacteria 2937056579 2937061297 143
335 iso_pu_bacteria 2937063883 2937064387 143
336 iso_pu_bacteria 2937071275 2937072867 143
337 iso_pu_bacteria 2937078374 2937082974 143
338 iso_pu_bacteria 2937084907 2937091252 143
339 iso_pu_bacteria 2937091812 2937095590 143
340 iso_pu_bacteria 2937098957 2937103634 143
341 iso_pu_bacteria 2937106411 2937109777 143
342 iso_pu_bacteria 2937113482 2937118317 143
343 iso_pu_bacteria 2937119839 2937121186 143
344 iso_pu_bacteria 2937126314 2937129820 143
345 iso_pu_bacteria 2937813078 2937817523 143
346 iso_pu_bacteria 2937836603 2937841153 143
347 iso_pu_bacteria 2937848649 2937849444 143
348 iso_pu_bacteria 2937861824 2937865945 143
349 iso_pu_bacteria 2937868953 2937876734 143
350 iso_pu_bacteria 2937877337 2937883181 143
351 iso_pu_bacteria 2937891427 2937893073 143
352 iso_pu_bacteria 2937972304 2937979205 143
353 iso_pu_bacteria 2937980651 2937985871 143
354 iso_pu_bacteria 2937994558 2937996392 143
355 iso_pu_bacteria 2938014810 2938014884 143
356 iso_pu_bacteria 2941499720 2941500261 143
357 iso_pu_bacteria 2957375807 2957380026 143
358 iso_pu_bacteria 2957382221 2957385068 143
359 iso_pu_bacteria 2957388812 2957389131 143
360 iso_pu_bacteria 2957395598 2957396753 143
361 iso_pu_bacteria 2957402308 2957405447 143
362 iso_pu_bacteria 2957408893 2957413250 143
363 iso_pu_bacteria 2957415311 2957419200 143
364 iso_pu_bacteria 2957422303 2957427734 143
365 iso_pu_bacteria 2957430029 2957431090 143
366 iso_pu_bacteria 2957437181 2957441964 143
367 iso_pu_bacteria 2957443900 2957446652 143
368 iso_pu_bacteria 2957450854 2957454191 143
369 iso_pu_bacteria 2957457609 2957462449 143
370 iso_pu_bacteria 2957464669 2957467747 143
371 iso_pu_bacteria 2957471148 2957477789 143
372 iso_pu_bacteria 2957478035 2957480627 143
373 iso_pu_bacteria 2957484790 2957485789 143
374 iso_pu_bacteria 2957491536 2957495995 143
375 iso_pu_bacteria 2957498199 2957501037 143
376 iso_pu_bacteria 2957505466 2957509593 143
377 iso_pu_bacteria 2958034702 2958041025 143
378 iso_pu_bacteria 2958041894 2958057519 143
379 iso_pu_bacteria 2958064165 2958070210 143
380 iso_pu_bacteria 2958071322 2958073278 143
381 iso_pu_bacteria 2958084443 2958090347 143
382 iso_pu_bacteria 2958092219 2958100256 143
383 iso_pu_bacteria 2958100919 2958101188 143
384 iso_pu_bacteria 2958108152 2958108861 143
385 iso_pu_bacteria 2958115193 2958115209 143
386 iso_pu_bacteria 2958122699 2958127985 143
387 iso_pu_bacteria 2958130278 2958132549 143
388 iso_pu_bacteria 2958137437 2958137734 143
389 iso_pu_bacteria 2958144490 2958145418 143
390 iso_pu_bacteria 2958158011 2958160290 143
391 iso_pu_bacteria 2958165035 2958166862 143
392 iso_pu_bacteria 2958172287 2958174352 143
393 iso_pu_bacteria 2958179912 2958182363 143
394 iso_pu_bacteria 2960584000 2960586645 143
395 iso_pu_bacteria 2960591022 2960595572 143
396 iso_pu_bacteria 2960597568 2960600574 143
397 iso_pu_bacteria 2960603979 2960609474 143
398 iso_pu_bacteria 2960610863 2960616787 143
399 iso_pu_bacteria 2960617483 2960617705 143
400 iso_pu_bacteria 2960624210 2960625693 143
401 iso_pu_bacteria 2960631154 2960633227 143
402 iso_pu_bacteria 2960637947 2960640208 143
403 iso_pu_bacteria 2960645483 2960648727 143
404 iso_pu_bacteria 2960652885 2960653708 143
405 iso_pu_bacteria 2960660292 2960666406 143
406 iso_pu_bacteria 2960667422 2960673926 143
407 iso_pu_bacteria 2960674078 2960678833 143
408 iso_pu_bacteria 2960680706 2960684161 143
409 iso_pu_bacteria 2960687367 2960692023 143
410 iso_pu_bacteria 2961077736 2961080208 143
411 iso_pu_bacteria 2961114664 2961118343 143
412 iso_pu_bacteria 2961127735 2961129154 143
413 iso_pu_bacteria 2961136820 2961142184 143
414 iso_pu_bacteria 2961163497 2961165332 143
415 iso_pu_bacteria 2961183825 2961187341 143
416 iso_pu_bacteria 2963644680 2963645883 143
417 iso_pu_bacteria 2964607997 2964610232 143
418 iso_pu_bacteria 2964615318 2964620007 143
419 iso_pu_bacteria 2964621998 2964627808 143
420 iso_pu_bacteria 2964628898 2964633116 143
421 iso_pu_bacteria 2964636051 2964641283 143
422 iso_pu_bacteria 2964643177 2964646162 143
423 iso_pu_bacteria 2964649959 2964653104 143
424 iso_pu_bacteria 2964656573 2964661883 143
425 iso_pu_bacteria 2964663802 2964665971 143
426 iso_pu_bacteria 2964670856 2964671685 143
427 iso_pu_bacteria 2964678106 2964681097 143
428 iso_pu_bacteria 2964685014 2964688109 143
429 iso_pu_bacteria 2964691889 2964695842 143
430 iso_pu_bacteria 2964698721 2964703594 143
431 iso_pu_bacteria 2964705432 2964708093 143
432 iso_pu_bacteria 2964712639 2964716300 143
433 iso_pu_bacteria 2964719344 2964726456 143
434 iso_pu_bacteria 2965018300 2965020154 143
435 iso_pu_bacteria 2965025482 2965030811 143
436 iso_pu_bacteria 2965032056 2965037198 143
437 iso_pu_bacteria 2965040258 2965040729 143
438 iso_pu_bacteria 2965047637 2965054556 143
439 iso_pu_bacteria 2965062239 2965065594 143
440 iso_pu_bacteria 2965089291 2965089418 143
441 iso_pu_bacteria 2965102966 2965108095 143
442 iso_pu_bacteria 2965110997 2965116892 143
443 iso_pu_bacteria 2965119406 2965122976 143
444 iso_pu_bacteria 2967671571 2967672143 143
445 iso_pu_bacteria 2967678726 2967681044 143
446 iso_pu_bacteria 2967686174 2967686414 143
447 iso_pu_bacteria 2967693043 2967693247 143
448 iso_pu_bacteria 2967699805 2967704239 143
449 iso_pu_bacteria 2967706974 2967712949 143
450 iso_pu_bacteria 2967714385 2967716528 143
451 iso_pu_bacteria 2967721400 2967724588 143
452 iso_pu_bacteria 2967728569 2967734736 143
453 iso_pu_bacteria 2967735183 2967737579 143
454 iso_pu_bacteria 2967742019 2967747874 143
455 iso_pu_bacteria 2967748971 2967752104 143
456 iso_pu_bacteria 2967762386 2967764432 143
457 iso_pu_bacteria 2967769361 2967770793 143
458 iso_pu_bacteria 2967775926 2967782178 143
459 iso_pu_bacteria 2968016561 2968022619 143
460 iso_pu_bacteria 2968083720 2968089393 143
461 iso_pu_bacteria 2968091066 2968091706 143
462 iso_pu_bacteria 2968097103 2968102037 143
463 iso_pu_bacteria 2968110612 2968114404 143
464 iso_pu_bacteria 2968117919 2968123519 143
465 iso_pu_bacteria 2968128360 2968133324 143
466 iso_pu_bacteria 2968138860 2968139804 143
467 iso_pu_bacteria 2968171901 2968173733 143
468 iso_pu_bacteria 2970019648 2970026072 143
469 iso_pu_bacteria 2970026789 2970031790 143
470 iso_pu_bacteria 2970033650 2970037803 143
471 iso_pu_bacteria 2970040964 2970043284 143
472 iso_pu_bacteria 2970047711 2970052886 143
473 iso_pu_bacteria 2970054988 2970059607 143
474 iso_pu_bacteria 2970061556 2970065293 143
475 iso_pu_bacteria 2970068827 2970069515 143
476 iso_pu_bacteria 2970076120 2970076968 143
477 iso_pu_bacteria 2970082768 2970085647 143
478 iso_pu_bacteria 2970088815 2970093309 143
479 iso_pu_bacteria 2970095765 2970096867 143
480 iso_pu_bacteria 2970102677 2970106928 143
481 iso_pu_bacteria 2970109326 2970109818 143
482 iso_pu_bacteria 2970116247 2970117967 143
483 iso_pu_bacteria 2970122695 2970124460 143
484 iso_pu_bacteria 2970129317 2970129519 143
485 iso_pu_bacteria 2970136068 2970143149 143
486 iso_pu_bacteria 2970149975 2970153813 143
487 iso_pu_bacteria 2970156795 2970163691 143
488 iso_pu_bacteria 2970164137 2970167505 143
489 iso_pu_bacteria 2970170962 2970171795 143
490 iso_pu_bacteria 2970177841 2970182813 143
491 iso_pu_bacteria 2970184632 2970188256 143
492 iso_pu_bacteria 2970191845 2970198323 143
493 iso_pu_bacteria 2970469710 2970475203 143
494 iso_pu_bacteria 2970489779 2970491373 143
495 iso_pu_bacteria 2970532167 2970536307 143
496 iso_pu_bacteria 2970540015 2970543460 143
497 iso_pu_bacteria 2970547951 2970549264 143
498 iso_pu_bacteria 2970554993 2970556819 143
499 iso_pu_bacteria 2970593180 2970599936 143
500 iso_pu_bacteria 2970619444 2970623763 143
501 iso_pu_bacteria 2970627176 2970630915 143
502 iso_pu_bacteria 2977516862 2977518435 143
503 iso_pu_bacteria 2977523885 2977527657 143
504 iso_pu_bacteria 2977530762 2977531898 143
505 iso_pu_bacteria 2977537788 2977537990 143
506 iso_pu_bacteria 2977544691 2977544931 143
507 iso_pu_bacteria 2977551784 2977551988 143
508 iso_pu_bacteria 2977558990 2977561671 143
509 iso_pu_bacteria 2977565890 2977568983 143
510 iso_pu_bacteria 2977572785 2977578960 143
511 iso_pu_bacteria 2977579622 2977581493 143
512 iso_pu_bacteria 2977843712 2977847810 143
513 iso_pu_bacteria 2977851361 2977857412 143
514 iso_pu_bacteria 2977858184 2977861239 143
515 iso_pu_bacteria 2977864932 2977868787 143
516 iso_pu_bacteria 2977872689 2977879259 143
517 iso_pu_bacteria 2977898635 2977904323 143
518 iso_pu_bacteria 2977907340 2977910751 143
519 iso_pu_bacteria 2977915119 2977915757 143
520 iso_pu_bacteria 2977922695 2977923722 143
521 iso_pu_bacteria 2977935797 2977937956 143
522 iso_pu_bacteria 2977950692 2977955846 143
523 iso_pu_bacteria 2977957713 2977957911 143
524 iso_pu_bacteria 2977971508 2977974692 143
525 iso_pu_bacteria 2977986579 2977989584 143
526 iso_pu_bacteria 2979710463 2979713275 143
527 iso_pu_bacteria 2979742915 2979751114 143
528 iso_pu_bacteria 2979764755 2979768437 143
529 iso_pu_bacteria 2979772303 2979773020 143
530 iso_pu_bacteria 2979779861 2979782707 143
531 iso_pu_bacteria 2979793036 2979793574 143
532 iso_pu_bacteria 2987636660 2987644153 143
533 iso_pu_bacteria 2987645492 2987651630 143
534 iso_pu_bacteria 2987652177 2987654068 143
535 iso_pu_bacteria 2987659509 2987661339 143
536 iso_pu_bacteria 2987673487 2987678075 143
537 iso_pu_bacteria 2989349275 2989354224 143
538 iso_pu_bacteria 2989771324 2989772010 143
539 iso_pu_bacteria 2996341866 2996341901 143
540 iso_pu_bacteria 2996348954 2996353370 143
541 iso_pu_bacteria 2996386984 2996393449 143
542 iso_pu_bacteria 2996893221 2996895921 143
543 iso_pu_bacteria 3000135777 3000141649 143
544 iso_pu_bacteria 3004167301 3004173904 143
545 iso_pu_bacteria 3004188549 3004190388 143
546 iso_pu_bacteria 3004195979 3004198722 143
547 iso_pu_bacteria 3004203850 3004208302 143
548 iso_pu_bacteria 3004211236 3004212937 143
549 iso_pu_bacteria 3004218560 3004220616 143
550 iso_pu_bacteria 3004232784 3004233249 143
551 iso_pu_bacteria 3004239961 3004243557 143
552 iso_pu_bacteria 3004248173 3004249922 143
553 iso_pu_bacteria 3004268573 3004272140 143
554 iso_pu_bacteria 3004275668 3004280052 143
555 iso_pu_bacteria 3004289098 3004297039 143
556 iso_pu_bacteria 643692032 643825046 143
557 iso_pu_bacteria 648276728 648736367 143
558 iso_pu_bacteria 649633066 649871124 143
559 iso_pu_bacteria 8003992118 8003992946 143
560 iso_pu_bacteria 8003999396 8004000182 143
561 iso_pu_bacteria 8004300914 8004305789 143
562 iso_pu_bacteria 8004312739 8004318754 143
563 iso_pu_bacteria 8004361976 8004368722 143
564 iso_pu_bacteria 8004387939 8004389934 143
565 iso_pu_bacteria 8004395343 8004401425 143
566 iso_pu_bacteria 8004445564 8004450992 143
567 iso_pu_bacteria 8004633249 8004639509 143
568 iso_pu_bacteria 8004640170 8004645307 143
569 iso_pu_bacteria 8004695233 8004702702 143
570 iso_pu_bacteria 8004703790 8004713965 143
571 iso_pu_bacteria 8004714634 8004718331 143
572 iso_pu_bacteria 8004727605 8004728102 143
573 iso_pu_bacteria 8005282627 8005288864 143
574 iso_pu_bacteria 8005376324 8005378317 143
575 iso_pu_bacteria 8005430974 8005434246 143
576 iso_pu_bacteria 8005497431 8005501535 143
577 iso_pu_bacteria 8005626139 8005631803 143
578 iso_pu_bacteria 8005668836 8005672956 143
579 iso_pu_bacteria 8024501048 8024506075 143
580 iso_pu_bacteria 8054558443 8054562248 143
581 iso_pu_bacteria 8055617313 8055618523 143
582 iso_pu_bacteria 8056382006 8056386905 143
583 3300005719 Ga0068861_100200569 Ga0068861_1002005691 144
584 3300005937 Ga0081455_10281489 Ga0081455_102814892 144
585 3300005983 Ga0081540_1028275 Ga0081540_10282752 144
586 3300026118 Ga0207675_100361887 Ga0207675_1003618871 144
587 3300049569 Ga0501032_0488473 Ga0501032_0488473_45_521 145
588 3300049570 Ga0501033_0050698 Ga0501033_0050698_1254_1730 145
589 3300049572 Ga0501036_0196357 Ga0501036_0196357_1183_1659 145
590 3300049579 Ga0501043_0265183 Ga0501043_0265183_779_1255 145
591 3300049581 Ga0501047_0172411 Ga0501047_0172411_1027_1503 145
592 3300049822 Ga0501035_1289438 Ga0501035_1289438_41_517 145
593 3300049823 Ga0501044_0104329 Ga0501044_0104329_1928_2404 145
594 iso_pu_bacteria 637000159 637076403 145
595 3300005327 Ga0070658_10644078 Ga0070658_106440782 146
596 3300005331 Ga0070670_101507696 Ga0070670_1015076961 146
597 3300025909 Ga0207705_11294730 Ga0207705_112947301 146
598 3300025925 Ga0207650_11211618 Ga0207650_112116181 146
599 3300002741 JGI25157J39369_1001905 JGI25157J39369_10019054 147
600 3300002987 JGI25159J45721_1000002 JGI25159J45721_1000002278 147
601 3300003187 JGI25151J46595_10003263 JGI25151J46595_100032637 147
602 3300003187 JGI25151J46595_10037268 JGI25151J46595_100372683 147
603 3300003203 JGI25406J46586_10020174 JGI25406J46586_100201742 147
604 3300003214 JGI25165J46597_1000026 JGI25165J46597_1000026177 147
605 3300003354 JGI25160J50197_1000008 JGI25160J50197_1000008278 147
606 3300003374 JGI25161J50226_1000380 JGI25161J50226_100038020 147
607 3300003771 Ga0055526_1001532 Ga0055526_100153212 147
608 3300003771 Ga0055526_1020128 Ga0055526_10201283 147
609 3300003775 Ga0055524_1009409 Ga0055524_10094093 147
610 3300003775 Ga0055524_1042053 Ga0055524_10420532 147
611 3300003781 Ga0055536_1000472 Ga0055536_100047215 147
612 3300003790 Ga0055528_1000695 Ga0055528_100069520 147
613 3300003791 Ga0055530_10028298 Ga0055530_100282982 147
614 3300003792 Ga0055540_1048502 Ga0055540_10485022 147
615 3300003794 Ga0055531_10048091 Ga0055531_100480912 147
616 3300004625 Ga0055543_1001421 Ga0055543_10014217 147
617 3300005262 Ga0065165_1000015 Ga0065165_1000015279 147
618 3300005327 Ga0070658_10087132 Ga0070658_100871324 147
619 3300005329 Ga0070683_101176108 Ga0070683_1011761081 147
620 3300005337 Ga0070682_100529678 Ga0070682_1005296782 147
621 3300005445 Ga0070708_101028304 Ga0070708_1010283041 147
622 3300005455 Ga0070663_100447920 Ga0070663_1004479202 147
623 3300005455 Ga0070663_100462331 Ga0070663_1004623312 147
624 3300005539 Ga0068853_100009794 Ga0068853_1000097947 147
625 3300005563 Ga0068855_100391737 Ga0068855_1003917372 147
626 3300005563 Ga0068855_100549196 Ga0068855_1005491963 147
627 3300005564 Ga0070664_100257734 Ga0070664_1002577343 147
628 3300005577 Ga0068857_101107891 Ga0068857_1011078912 147
629 3300005578 Ga0068854_101707541 Ga0068854_1017075411 147
630 3300005614 Ga0068856_100148752 Ga0068856_1001487523 147
631 3300005616 Ga0068852_100499633 Ga0068852_1004996332 147
632 3300005616 Ga0068852_100584685 Ga0068852_1005846852 147
633 3300005937 Ga0081455_10140534 Ga0081455_101405343 147
634 3300005985 Ga0081539_10011472 Ga0081539_100114726 147
635 3300006038 Ga0075365_10018565 Ga0075365_100185657 147
636 3300006038 Ga0075365_10103065 Ga0075365_101030652 147
637 3300006051 Ga0075364_10081734 Ga0075364_100817343 147
638 3300006177 Ga0075362_10066582 Ga0075362_100665823 147
639 3300006178 Ga0075367_10040262 Ga0075367_100402622 147
640 3300006178 Ga0075367_10139142 Ga0075367_101391422 147
641 3300006353 Ga0075370_10142444 Ga0075370_101424442 147
642 3300006946 Ga0079104_1002663 Ga0079104_10026632 147
643 3300009011 Ga0105251_10028986 Ga0105251_100289862 147
644 3300009093 Ga0105240_10190481 Ga0105240_101904812 147
645 3300009093 Ga0105240_10250975 Ga0105240_102509753 147
646 3300009093 Ga0105240_10257546 Ga0105240_102575465 147
647 3300009098 Ga0105245_12189446 Ga0105245_121894461 147
648 3300009174 Ga0105241_10141126 Ga0105241_101411263 147
649 3300009545 Ga0105237_10037744 Ga0105237_100377443 147
650 3300009545 Ga0105237_10184515 Ga0105237_101845154 147
651 3300009545 Ga0105237_10307718 Ga0105237_103077182 147
652 3300009545 Ga0105237_10897705 Ga0105237_108977051 147
653 3300009551 Ga0105238_10014332 Ga0105238_100143323 147
654 3300009765 Ga0123341_1000014 Ga0123341_100001443 147
655 3300009766 Ga0123342_1013393 Ga0123342_10133937 147
656 3300010375 Ga0105239_10113116 Ga0105239_101131163 147
657 3300010375 Ga0105239_10148900 Ga0105239_101489004 147
658 3300010375 Ga0105239_10655268 Ga0105239_106552682 147
659 3300013249 Ga0171463_1001 Ga0171463_1001268 147
660 3300013296 Ga0157374_10361575 Ga0157374_103615752 147
661 3300013306 Ga0163162_12480084 Ga0163162_124800841 147
662 3300014497 Ga0182008_10014738 Ga0182008_100147383 147
663 3300014968 Ga0157379_10250630 Ga0157379_102506301 147
664 3300014969 Ga0157376_11106017 Ga0157376_111060172 147
665 3300015261 Ga0182006_1023627 Ga0182006_10236273 147
666 3300015262 Ga0182007_10129746 Ga0182007_101297462 147
667 3300015265 Ga0182005_1034307 Ga0182005_10343071 147
668 3300015690 Ga0183363_1371 Ga0183363_13716 147
669 3300017792 Ga0163161_10624466 Ga0163161_106244662 147
670 3300021320 Ga0214544_1009397 Ga0214544_100939711 147
671 3300021321 Ga0214542_1000006 Ga0214542_10000064 147
672 3300021321 Ga0214542_1016019 Ga0214542_10160196 147
673 3300021327 Ga0214543_1000003 Ga0214543_1000003437 147
674 3300021327 Ga0214543_1000014 Ga0214543_1000014319 147
675 3300022739 Ga0228711_1000001 Ga0228711_1000001114 147
676 3300022740 Ga0228710_1000001 Ga0228710_1000001211 147
677 3300025208 Ga0209436_103040 Ga0209436_1030404 147
678 3300025245 Ga0207425_1034930 Ga0207425_10349302 147
679 3300025246 Ga0209646_1009064 Ga0209646_10090642 147
680 3300025250 Ga0209026_1000032 Ga0209026_1000032320 147
681 3300025254 Ga0209148_1000317 Ga0209148_100031726 147
682 3300025256 Ga0209759_1000168 Ga0209759_100016857 147
683 3300025261 Ga0209233_1000030 Ga0209233_1000030219 147
684 3300025272 Ga0209455_1000152 Ga0209455_100015233 147
685 3300025273 Ga0209673_1000060 Ga0209673_100006086 147
686 3300025284 Ga0209130_1000007 Ga0209130_100000724 147
687 3300025284 Ga0209130_1009004 Ga0209130_10090044 147
688 3300025284 Ga0209130_1020116 Ga0209130_10201161 147
689 3300025292 Ga0209676_1000901 Ga0209676_100090126 147
690 3300025294 Ga0209025_1000100 Ga0209025_1000100169 147
691 3300025294 Ga0209025_1000149 Ga0209025_100014921 147
692 3300025294 Ga0209025_1059964 Ga0209025_10599641 147
693 3300025295 Ga0209564_1000116 Ga0209564_100011686 147
694 3300025295 Ga0209564_1000439 Ga0209564_100043969 147
695 3300025297 Ga0209758_1002727 Ga0209758_10027278 147
696 3300025298 Ga0209050_1001222 Ga0209050_100122232 147
697 3300025299 Ga0209256_1000302 Ga0209256_100030216 147
698 3300025299 Ga0209256_1001410 Ga0209256_100141022 147
699 3300025299 Ga0209256_1001505 Ga0209256_10015054 147
700 3300025302 Ga0207426_1000064 Ga0207426_100006424 147
701 3300025303 Ga0209051_1001024 Ga0209051_10010244 147
702 3300025304 Ga0209257_1004371 Ga0209257_10043718 147
703 3300025904 Ga0207647_10015579 Ga0207647_100155795 147
704 3300025904 Ga0207647_10307730 Ga0207647_103077302 147
705 3300025909 Ga0207705_11060381 Ga0207705_110603811 147
706 3300025913 Ga0207695_10093719 Ga0207695_100937194 147
707 3300025913 Ga0207695_10218061 Ga0207695_102180612 147
708 3300025914 Ga0207671_10009507 Ga0207671_100095073 147
709 3300025914 Ga0207671_10077697 Ga0207671_100776975 147
710 3300025920 Ga0207649_11010219 Ga0207649_110102192 147
711 3300025924 Ga0207694_10005781 Ga0207694_100057818 147
712 3300025924 Ga0207694_10354572 Ga0207694_103545721 147
713 3300025937 Ga0207669_11395023 Ga0207669_113950231 147
714 3300025944 Ga0207661_10648741 Ga0207661_106487412 147
715 3300025949 Ga0207667_10314258 Ga0207667_103142582 147
716 3300025981 Ga0207640_10868167 Ga0207640_108681671 147
717 3300026041 Ga0207639_10191343 Ga0207639_101913433 147
718 3300026041 Ga0207639_10481515 Ga0207639_104815152 147
719 3300026067 Ga0207678_10555793 Ga0207678_105557932 147
720 3300026078 Ga0207702_10099181 Ga0207702_100991814 147
721 3300026078 Ga0207702_10973178 Ga0207702_109731782 147
722 3300026142 Ga0207698_10212487 Ga0207698_102124872 147
723 3300026142 Ga0207698_10438004 Ga0207698_104380042 147
724 3300027111 Ga0209281_1000164 Ga0209281_100016419 147
725 3300027111 Ga0209281_1000332 Ga0209281_100033224 147
726 3300027666 Ga0209282_1000007 Ga0209282_1000007138 147
727 3300028379 Ga0268266_10247192 Ga0268266_102471923 147
728 3300028794 Ga0307515_10010909 Ga0307515_1001090911 147
729 3300031456 Ga0307513_10683123 Ga0307513_106831232 147
730 3300031548 Ga0307408_100143678 Ga0307408_1001436783 147
731 3300031731 Ga0307405_10398356 Ga0307405_103983562 147
732 3300031824 Ga0307413_10329468 Ga0307413_103294683 147
733 3300031911 Ga0307412_10278503 Ga0307412_102785032 147
734 3300031911 Ga0307412_10580729 Ga0307412_105807292 147
735 3300031967 Ga0315914_1000006 Ga0315914_1000006105 147
736 3300031995 Ga0307409_100531361 Ga0307409_1005313612 147
737 3300032004 Ga0307414_10978351 Ga0307414_109783512 147
738 3300033430 Ga0315913_1000002 Ga0315913_1000002138 147
739 3300033464 Ga0315915_1000001 Ga0315915_1000001349 147
740 3300037418 Ga0395900_0000086 Ga0395900_0000086_167342_167824 147
741 3300037418 Ga0395900_0037626 Ga0395900_0037626_1658_2140 147
742 3300037418 Ga0395900_0113571 Ga0395900_0113571_2217_2699 147
743 3300037418 Ga0395900_0542594 Ga0395900_0542594_43_525 147
744 3300037418 Ga0395900_0563002 Ga0395900_0563002_541_1023 147
745 3300037466 Ga0395898_0000285 Ga0395898_0000285_3926_4408 147
746 3300037466 Ga0395898_0377081 Ga0395898_0377081_588_1070 147
747 3300037471 Ga0395905_0000133 Ga0395905_0000133_119093_119575 147
748 3300037471 Ga0395905_0013448 Ga0395905_0013448_3632_4114 147
749 3300037471 Ga0395905_0057943 Ga0395905_0057943_2030_2512 147
750 3300037471 Ga0395905_0202608 Ga0395905_0202608_1076_1558 147
751 3300037471 Ga0395905_0712137 Ga0395905_0712137_396_878 147
752 3300038443 Ga0395901_0000092 Ga0395901_0000092_117569_118051 147
753 3300038443 Ga0395901_0092747 Ga0395901_0092747_1776_2258 147
754 3300041404 Ga0439436_0095732 Ga0439436_0095732_35_517 147
755 3300041453 Ga0451797_0807725 Ga0451797_0807725_90_572 147
756 3300041486 Ga0451807_1405731 Ga0451807_1405731_106_588 147
757 3300041509 Ga0451843_0881156 Ga0451843_0881156_131_619 147
758 3300042006 Ga0439432_209490 Ga0439432_209490_13_495 147
759 3300042007 Ga0439449_0004505 Ga0439449_0004505_1210_1692 147
760 3300042007 Ga0439449_0048980 Ga0439449_0048980_1026_1508 147
761 3300042010 Ga0439452_091809 Ga0439452_091809_30_533 147
762 3300042014 Ga0439457_097133 Ga0439457_097133_192_674 147
763 3300042015 Ga0439462_0012305 Ga0439462_0012305_1143_1646 147
764 3300042015 Ga0439462_0066951 Ga0439462_0066951_270_752 147
765 3300042146 Ga0450907_057460 Ga0450907_057460_77_580 147
766 3300044658 Ga0466972_0030469 Ga0466972_0030469_679_1161 147
767 3300044683 Ga0466965_0073933 Ga0466965_0073933_1222_1704 147
768 3300044735 Ga0466968_0219107 Ga0466968_0219107_400_882 147
769 3300044901 Ga0466960_0010566 Ga0466960_0010566_1947_2429 147
770 3300046460 Ga0495638_0016774 Ga0495638_0016774_887_1375 147
771 3300046460 Ga0495638_0096771 Ga0495638_0096771_248_733 147
772 3300046616 Ga0495668_0048543 Ga0495668_0048543_218_700 147
773 3300048905 Ga0496102_0218210 Ga0496102_0218210_590_1072 147
774 3300048907 Ga0496104_0296385 Ga0496104_0296385_27_509 147
775 3300048913 Ga0496110_1017699 Ga0496110_1017699_20_505 147
776 3300048914 Ga0496111_0903756 Ga0496111_0903756_136_618 147
777 3300048915 Ga0496112_0147547 Ga0496112_0147547_960_1442 147
778 3300048915 Ga0496112_0182878 Ga0496112_0182878_1275_1757 147
779 3300048916 Ga0496113_0690889 Ga0496113_0690889_275_757 147
780 3300048919 Ga0496116_0324828 Ga0496116_0324828_206_688 147
781 3300048920 Ga0496117_0004346 Ga0496117_0004346_12789_13277 147
782 3300048920 Ga0496117_0205089 Ga0496117_0205089_497_979 147
783 3300048920 Ga0496117_0305698 Ga0496117_0305698_158_640 147
784 3300048921 Ga0496118_0274577 Ga0496118_0274577_103_585 147
785 3300048922 Ga0496119_0315895 Ga0496119_0315895_145_630 147
786 3300048922 Ga0496119_0316580 Ga0496119_0316580_86_568 147
787 3300048923 Ga0496120_0003298 Ga0496120_0003298_8167_8649 147
788 3300048923 Ga0496120_0046760 Ga0496120_0046760_926_1408 147
789 3300048924 Ga0496121_0242835 Ga0496121_0242835_319_801 147
790 3300048925 Ga0496122_0000492 Ga0496122_0000492_65810_66298 147
791 3300048925 Ga0496122_0074246 Ga0496122_0074246_1615_2100 147
792 3300048926 Ga0496123_0000460 Ga0496123_0000460_48661_49149 147
793 3300048927 Ga0496124_0000679 Ga0496124_0000679_33063_33551 147
794 3300048927 Ga0496124_0125990 Ga0496124_0125990_741_1223 147
795 3300048927 Ga0496124_0280936 Ga0496124_0280936_240_722 147
796 3300048928 Ga0496125_0006717 Ga0496125_0006717_11314_11802 147
797 3300048928 Ga0496125_0068286 Ga0496125_0068286_145_630 147
798 3300048928 Ga0496125_0201839 Ga0496125_0201839_533_1015 147
799 3300048929 Ga0496126_0000811 Ga0496126_0000811_13007_13495 147
800 3300048929 Ga0496126_0067806 Ga0496126_0067806_1371_1853 147
801 3300048929 Ga0496126_0156100 Ga0496126_0156100_1351_1836 147
802 3300048929 Ga0496126_0310346 Ga0496126_0310346_758_1258 147
803 3300048929 Ga0496126_0556107 Ga0496126_0556107_362_844 147
804 3300049568 Ga0501031_0000016 Ga0501031_0000016_107027_107512 147
805 3300049568 Ga0501031_0027499 Ga0501031_0027499_1415_1945 147
806 3300049569 Ga0501032_0000044 Ga0501032_0000044_107027_107512 147
807 3300049569 Ga0501032_0110421 Ga0501032_0110421_1095_1577 147
808 3300049570 Ga0501033_0000052 Ga0501033_0000052_106701_107186 147
809 3300049571 Ga0501034_0000212 Ga0501034_0000212_107027_107512 147
810 3300049571 Ga0501034_0106196 Ga0501034_0106196_825_1313 147
811 3300049571 Ga0501034_0190948 Ga0501034_0190948_13_495 147
812 3300049572 Ga0501036_0000022 Ga0501036_0000022_3285_3770 147
813 3300049572 Ga0501036_0068018 Ga0501036_0068018_391_873 147
814 3300049572 Ga0501036_1071239 Ga0501036_1071239_133_621 147
815 3300049573 Ga0501037_0000052 Ga0501037_0000052_107027_107512 147
816 3300049573 Ga0501037_0177474 Ga0501037_0177474_380_862 147
817 3300049574 Ga0501038_0000044 Ga0501038_0000044_3421_3906 147
818 3300049574 Ga0501038_0145408 Ga0501038_0145408_320_802 147
819 3300049575 Ga0501039_0000042 Ga0501039_0000042_109239_109724 147
820 3300049575 Ga0501039_0178980 Ga0501039_0178980_944_1432 147
821 3300049579 Ga0501043_0000054 Ga0501043_0000054_102019_102504 147
822 3300049579 Ga0501043_0016295 Ga0501043_0016295_5251_5739 147
823 3300049579 Ga0501043_0205076 Ga0501043_0205076_425_907 147
824 3300049580 Ga0501046_0147468 Ga0501046_0147468_886_1371 147
825 3300049581 Ga0501047_0000247 Ga0501047_0000247_3244_3729 147
826 3300049581 Ga0501047_0446572 Ga0501047_0446572_201_683 147
827 3300049582 Ga0501048_0352098 Ga0501048_0352098_298_780 147
828 3300049584 Ga0501068_0216144 Ga0501068_0216144_698_1180 147
829 3300049586 Ga0501070_0036686 Ga0501070_0036686_3284_3769 147
830 3300049742 Ga0501080_0662982 Ga0501080_0662982_365_847 147
831 3300049744 Ga0501083_0075369 Ga0501083_0075369_126_608 147
832 3300049822 Ga0501035_0000095 Ga0501035_0000095_3267_3752 147
833 3300049822 Ga0501035_0558067 Ga0501035_0558067_193_675 147
834 3300049823 Ga0501044_0000091 Ga0501044_0000091_107482_107967 147
835 3300049823 Ga0501044_0055765 Ga0501044_0055765_2315_2797 147
836 3300049823 Ga0501044_0172718 Ga0501044_0172718_775_1305 147
837 3300049823 Ga0501044_0336996 Ga0501044_0336996_843_1325 147
838 3300050489 nmdc:mga03683_265999_c1 nmdc:mga03683_265999_c1_265_747 147
839 3300050490 nmdc:mga03n38_40232_c1 nmdc:mga03n38_40232_c1_34_516 147
840 3300050491 nmdc:mga00v17_371351_c1 nmdc:mga00v17_371351_c1_406_888 147
841 3300050492 nmdc:mga0yw44_492503_c1 nmdc:mga0yw44_492503_c1_44_526 147
842 3300050516 nmdc:mga0sz30_88995_c1 nmdc:mga0sz30_88995_c1_575_1057 147
843 3300053119 Ga0500595_115477 Ga0500595_115477_84_566 147
844 3300053151 Ga0500604_0062408 Ga0500604_0062408_532_1014 147
845 3300053155 Ga0500620_000145 Ga0500620_000145_3934_4416 147
846 3300053158 Ga0500627_0018583 Ga0500627_0018583_1033_1515 147
847 3300053158 Ga0500627_0155179 Ga0500627_0155179_503_1003 147
848 3300053727 Ga0500611_004297 Ga0500611_004297_862_1344 147
849 iso_pu_bacteria 2970143518 2970144372 147
850 3300003323 rootH1_10308392 rootH1_103083923 148
851 3300005548 Ga0070665_100017478 Ga0070665_10001747811 148
852 3300028379 Ga0268266_10055195 Ga0268266_100551954 148
853 3300031731 Ga0307405_10484934 Ga0307405_104849342 148
854 3300031852 Ga0307410_10760979 Ga0307410_107609791 148
855 3300042006 Ga0439432_175970 Ga0439432_175970_107_592 148
856 3300053727 Ga0500611_057268 Ga0500611_057268_369_854 148
857 2162886012 MBSR1b_contig_5973844 MBSR1b_0581.00002600 154
858 3300005293 Ga0065715_10119301 Ga0065715_101193012 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

27

150

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.9022 3 140
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.9021 4 136
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8977 3 140
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8646 3 140
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8606 3 140
ID Description Score Start End Superfamily
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8632 7 140 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8571 5 136 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8542 3 136 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8525 2 133 3.30.530.20
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8407 3 137 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2T9K1L0-F1-model_v4 deleted 0.9794 2 142
AF-A0A1Q3JP40-F1-model_v4 ATPase 0.9714 1 143
AF-A0A7T9FY88-F1-model_v4 deleted 0.9632 1 144
AF-A0A3D3HZX3-F1-model_v4 ATPase 0.9624 2 145
AF-A0A085ER11-F1-model_v4 Activator of Hsp90 ATPase 1-like protein 0.9596 1 144

Feature Viewer

pLDDT pTM Quality
87.93 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map