F483753

General Info

Members Datasets Scaffolds Average Seq Length
858 359 1716 294

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0004775|Ga0501034_0004775_4879_5826
Length 315
Sequence VRPNSSFFRNSLFSFSIVTPSDFQAWAAAGQQRIETFLQHVLPQPDIAPQRLHAAMRYAVLGAGKRVRPLLAYAAGELSQADPERVTVAGAAVEIIHAYSLVHDDLPCMDDDVLRRGKPTCHVEFDEPTALLVGDALQSLSFQLLGEYRLADDAGAQLEMVKLLAAAAGSRGMAGGQAIDLAAVGKTLSVPELEFMHIHKTGALIRAAAVLGARCGSGLNESEFAHVDTFAKAVGLAFQVVDDVLDAEAPTATLGKTAGKDAEQGKPTYVSAMGITRARTLAGELREEALKAIAPFGARGARLAQLADFIVLRKF

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
193 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
219 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
220 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
221 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
232 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
244 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
245 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
246 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
347 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
350 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
351 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
352 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
353 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
354 2547132512 Azospira oryzae 6a3 Isolate Unclassified
355 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
356 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
357 2857558681 Duganella sp. R-74565 Isolate Unclassified
358 2904424332 Duganella sp. 1411 Isolate Rhizosphere
359 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 3.38
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0004775 3300049571 Bacteria 15000
2 Ga0055529_1001152 3300003763 Bacteria 11088
3 Ga0065712_10078545 3300005290 Bacteria 3332
4 Ga0070658_10006078 3300005327 Bacteria 9790
5 Ga0070658_10014263 3300005327 Bacteria 6376
6 Ga0070658_10292253 3300005327 Bacteria 1389
7 Ga0070676_10083905 3300005328 Bacteria 1939
8 Ga0070683_100001788 3300005329 Bacteria 16752
9 Ga0070683_100086367 3300005329 Bacteria 2941
10 Ga0070683_100408010 3300005329 Bacteria 1296
11 Ga0070690_100004680 3300005330 Bacteria 7626
12 Ga0070690_100021086 3300005330 Bacteria 3975
13 Ga0070690_100047414 3300005330 Bacteria 2734
14 Ga0070670_100000732 3300005331 Bacteria 25485
15 Ga0070670_100019332 3300005331 Bacteria 5844
16 Ga0070670_100025573 3300005331 Bacteria 5078
17 Ga0070670_100328728 3300005331 Bacteria 1340
18 Ga0070677_10057910 3300005333 Bacteria 1589
19 Ga0068869_100005486 3300005334 Bacteria 7981
20 Ga0068869_100075504 3300005334 Bacteria 2504
21 Ga0068869_100076604 3300005334 Bacteria 2486
22 Ga0070666_10020043 3300005335 Bacteria 4320
23 Ga0070680_100077278 3300005336 Bacteria 2742
24 Ga0070682_100012218 3300005337 Bacteria 4917
25 Ga0068868_100000144 3300005338 Bacteria 46092
26 Ga0068868_100009584 3300005338 Bacteria 6981
27 Ga0068868_100036103 3300005338 Bacteria 3824
28 Ga0068868_100061532 3300005338 Bacteria 2974
29 Ga0070660_100124427 3300005339 Bacteria 2060
30 Ga0070689_100003377 3300005340 Bacteria 10612
31 Ga0070689_100034210 3300005340 Bacteria 3877
32 Ga0070689_100146638 3300005340 Bacteria 1901
33 Ga0070689_100178636 3300005340 Bacteria 1723
34 Ga0070691_10014877 3300005341 Bacteria 3572
35 Ga0070687_100025518 3300005343 Bacteria 2836
36 Ga0070687_100069063 3300005343 Bacteria 1891
37 Ga0070687_100115196 3300005343 Bacteria 1528
38 Ga0070661_100000601 3300005344 Bacteria 26884
39 Ga0070661_100019649 3300005344 Bacteria 4813
40 Ga0070692_10060371 3300005345 Bacteria 1996
41 Ga0070668_100001724 3300005347 Bacteria 15891
42 Ga0070668_100068947 3300005347 Bacteria 2750
43 Ga0070668_100119513 3300005347 Bacteria 2105
44 Ga0070669_100011126 3300005353 Bacteria 6386
45 Ga0070675_100003810 3300005354 Bacteria 11450
46 Ga0070675_100026322 3300005354 Bacteria 4669
47 Ga0070675_100121920 3300005354 Bacteria 2215
48 Ga0070671_100001156 3300005355 Bacteria 19640
49 Ga0070671_100018208 3300005355 Bacteria 5702
50 Ga0070671_100368300 3300005355 Bacteria 1227
51 Ga0070674_100029925 3300005356 Bacteria 3595
52 Ga0070674_100067969 3300005356 Bacteria 2508
53 Ga0070673_100001260 3300005364 Bacteria 14710
54 Ga0070673_100001686 3300005364 Bacteria 13103
55 Ga0070673_100008218 3300005364 Bacteria 6929
56 Ga0070673_100037390 3300005364 Bacteria 3698
57 Ga0070688_100000431 3300005365 Bacteria 21145
58 Ga0070688_100106161 3300005365 Bacteria 1860
59 Ga0070659_100074768 3300005366 Bacteria 2700
60 Ga0070667_100032338 3300005367 Bacteria 4363
61 Ga0070667_100182385 3300005367 Bacteria 1857
62 Ga0070703_10018923 3300005406 Bacteria 1995
63 Ga0070703_10044178 3300005406 Bacteria 1400
64 Ga0070709_10057937 3300005434 Bacteria 2455
65 Ga0070709_10112717 3300005434 Bacteria 1830
66 Ga0070709_10201226 3300005434 Bacteria 1410
67 Ga0070714_100015547 3300005435 Bacteria 6122
68 Ga0070714_100050194 3300005435 Bacteria 3553
69 Ga0070714_100238897 3300005435 Bacteria 1676
70 Ga0070714_100264979 3300005435 Bacteria 1592
71 Ga0070713_100002492 3300005436 Bacteria 12025
72 Ga0070713_100087771 3300005436 Bacteria 2668
73 Ga0070701_10094082 3300005438 Bacteria 1648
74 Ga0070711_100002587 3300005439 Bacteria 10362
75 Ga0070705_100025920 3300005440 Bacteria 3186
76 Ga0070705_100173673 3300005440 Bacteria 1453
77 Ga0070700_100056967 3300005441 Bacteria 2451
78 Ga0070700_100185410 3300005441 Bacteria 1451
79 Ga0070700_100255082 3300005441 Bacteria 1260
80 Ga0070700_100380031 3300005441 Unclassified 1056
81 Ga0070694_100053962 3300005444 Bacteria 2722
82 Ga0070708_100020748 3300005445 Bacteria 5547
83 Ga0070663_100207376 3300005455 Bacteria 1533
84 Ga0070663_100238042 3300005455 Bacteria 1436
85 Ga0070678_100000019 3300005456 Bacteria 51607
86 Ga0070678_100079745 3300005456 Bacteria 2477
87 Ga0070678_100092645 3300005456 Bacteria 2322
88 Ga0070678_100196457 3300005456 Bacteria 1662
89 Ga0070662_100044204 3300005457 Bacteria 3190
90 Ga0070662_100138785 3300005457 Bacteria 1882
91 Ga0070681_10006660 3300005458 Bacteria 11245
92 Ga0070681_10075482 3300005458 Bacteria 3331
93 Ga0068867_100007906 3300005459 Bacteria 7514
94 Ga0068867_100026778 3300005459 Bacteria 4142
95 Ga0068867_100142867 3300005459 Bacteria 1872
96 Ga0070685_10000733 3300005466 Bacteria 17900
97 Ga0070685_10048220 3300005466 Bacteria 2452
98 Ga0070685_10136900 3300005466 Bacteria 1537
99 Ga0070706_100028196 3300005467 Bacteria 5168
100 Ga0070706_100037830 3300005467 Bacteria 4455
101 Ga0070706_100091409 3300005467 Bacteria 2823
102 Ga0070707_100012077 3300005468 Bacteria 8063
103 Ga0070707_100034979 3300005468 Bacteria 4790
104 Ga0070707_100145097 3300005468 Bacteria 2310
105 Ga0070698_100175897 3300005471 Bacteria 2080
106 Ga0070699_100006062 3300005518 Bacteria 10568
107 Ga0070699_100050568 3300005518 Bacteria 3598
108 Ga0070699_100071219 3300005518 Bacteria 3023
109 Ga0070679_100010085 3300005530 Bacteria 8952
110 Ga0070679_100015526 3300005530 Bacteria 7317
111 Ga0070679_100092317 3300005530 Bacteria 3015
112 Ga0070679_100509638 3300005530 Bacteria 1147
113 Ga0070684_100034952 3300005535 Bacteria 4299
114 Ga0070684_100057055 3300005535 Bacteria 3409
115 Ga0070684_100117514 3300005535 Bacteria 2390
116 Ga0070697_100030915 3300005536 Bacteria 4303
117 Ga0070697_100036887 3300005536 Bacteria 3948
118 Ga0068853_100074850 3300005539 Bacteria 2955
119 Ga0068853_100105607 3300005539 Bacteria 2495
120 Ga0068853_100116004 3300005539 Bacteria 2384
121 Ga0070672_100000151 3300005543 Bacteria 38113
122 Ga0070672_100028153 3300005543 Bacteria 4199
123 Ga0070672_100054868 3300005543 Bacteria 3120
124 Ga0070672_100154670 3300005543 Bacteria 1899
125 Ga0070672_100207337 3300005543 Bacteria 1641
126 Ga0070686_100025941 3300005544 Bacteria 3531
127 Ga0070686_100402778 3300005544 Bacteria 1041
128 Ga0070695_100018618 3300005545 Bacteria 4217
129 Ga0070695_100108342 3300005545 Bacteria 1881
130 Ga0070695_100112029 3300005545 Bacteria 1853
131 Ga0070696_100028401 3300005546 Bacteria 3818
132 Ga0070696_100156059 3300005546 Bacteria 1679
133 Ga0070696_100393929 3300005546 Bacteria 1082
134 Ga0070693_100045002 3300005547 Bacteria 2499
135 Ga0070693_100216139 3300005547 Bacteria 1253
136 Ga0070665_100072597 3300005548 Bacteria 3449
137 Ga0070665_100248437 3300005548 Bacteria 1779
138 Ga0070665_100397300 3300005548 Bacteria 1386
139 Ga0070704_100018546 3300005549 Bacteria 4452
140 Ga0070704_100158031 3300005549 Bacteria 1790
141 Ga0070704_100209581 3300005549 Bacteria 1578
142 Ga0070704_100226861 3300005549 Bacteria 1521
143 Ga0068855_100017466 3300005563 Bacteria 8629
144 Ga0068855_100043110 3300005563 Bacteria 5346
145 Ga0070664_100000957 3300005564 Bacteria 22562
146 Ga0070664_100083343 3300005564 Bacteria 2758
147 Ga0070664_100121536 3300005564 Bacteria 2287
148 Ga0068857_100021734 3300005577 Bacteria 5646
149 Ga0068854_100003057 3300005578 Bacteria 10409
150 Ga0068854_100003907 3300005578 Bacteria 9337
151 Ga0068854_100032222 3300005578 Bacteria 3644
152 Ga0068854_100122142 3300005578 Bacteria 1979
153 Ga0070702_100018030 3300005615 Bacteria 3653
154 Ga0070702_100023295 3300005615 Bacteria 3288
155 Ga0070702_100102043 3300005615 Bacteria 1762
156 Ga0068852_100000486 3300005616 Bacteria 25959
157 Ga0068852_100001134 3300005616 Bacteria 17618
158 Ga0068852_100014226 3300005616 Bacteria 6114
159 Ga0068852_100019290 3300005616 Bacteria 5394
160 Ga0068852_100084408 3300005616 Bacteria 2826
161 Ga0068852_100193310 3300005616 Bacteria 1921
162 Ga0068852_100195347 3300005616 Bacteria 1912
163 Ga0068852_100294908 3300005616 Bacteria 1568
164 Ga0068859_100007757 3300005617 Bacteria 10897
165 Ga0068859_100056838 3300005617 Bacteria 3940
166 Ga0068859_100060072 3300005617 Bacteria 3831
167 Ga0068859_100144063 3300005617 Bacteria 2457
168 Ga0068859_100149509 3300005617 Bacteria 2411
169 Ga0068864_100002543 3300005618 Bacteria 15058
170 Ga0068864_100007067 3300005618 Bacteria 9217
171 Ga0068864_100019099 3300005618 Bacteria 5729
172 Ga0068864_100020001 3300005618 Bacteria 5598
173 Ga0068864_100270224 3300005618 Bacteria 1584
174 Ga0068864_100275892 3300005618 Bacteria 1568
175 Ga0068861_100132928 3300005719 Bacteria 2021
176 Ga0068861_100281772 3300005719 Bacteria 1432
177 Ga0068851_10003401 3300005834 Bacteria 7083
178 Ga0068851_10012253 3300005834 Bacteria 4038
179 Ga0068870_10025360 3300005840 Bacteria 2942
180 Ga0068863_100004686 3300005841 Bacteria 13475
181 Ga0068863_100031587 3300005841 Bacteria 5052
182 Ga0068863_100138274 3300005841 Bacteria 2327
183 Ga0068863_100338383 3300005841 Bacteria 1464
184 Ga0068863_100438035 3300005841 Bacteria 1281
185 Ga0068858_100011845 3300005842 Bacteria 8221
186 Ga0068858_100026879 3300005842 Bacteria 5345
187 Ga0068858_100080458 3300005842 Bacteria 3027
188 Ga0068860_100070165 3300005843 Bacteria 3331
189 Ga0068860_100134448 3300005843 Bacteria 2375
190 Ga0068862_100004088 3300005844 Bacteria 12372
191 Ga0068862_100084972 3300005844 Bacteria 2749
192 Ga0070716_100113934 3300006173 Bacteria 1680
193 Ga0070712_100020319 3300006175 Bacteria 4345
194 Ga0075366_10007379 3300006195 Bacteria 6069
195 Ga0097621_100000274 3300006237 Bacteria 34921
196 Ga0097621_100010760 3300006237 Bacteria 6710
197 Ga0097621_100043537 3300006237 Bacteria 3619
198 Ga0097621_100051122 3300006237 Bacteria 3362
199 Ga0097621_100059537 3300006237 Bacteria 3127
200 Ga0097621_100166053 3300006237 Bacteria 1900
201 Ga0097621_100173157 3300006237 Bacteria 1861
202 Ga0075370_10059534 3300006353 Bacteria 2174
203 Ga0068871_100000325 3300006358 Bacteria 33222
204 Ga0068871_100009363 3300006358 Bacteria 7092
205 Ga0068871_100015986 3300006358 Bacteria 5637
206 Ga0068871_100067718 3300006358 Bacteria 2930
207 Ga0068871_100176340 3300006358 Bacteria 1835
208 Ga0068871_100247518 3300006358 Bacteria 1552
209 Ga0068871_100272829 3300006358 Bacteria 1478
210 Ga0068871_100306716 3300006358 Bacteria 1395
211 Ga0075428_100001689 3300006844 Bacteria 23548
212 Ga0075428_100011896 3300006844 Bacteria 9678
213 Ga0075430_100005251 3300006846 Bacteria 10922
214 Ga0075431_100008882 3300006847 Bacteria 10068
215 Ga0075433_10012283 3300006852 Bacteria 6908
216 Ga0075434_100073969 3300006871 Bacteria 3401
217 Ga0075434_100206615 3300006871 Bacteria 1984
218 Ga0075434_100635771 3300006871 Bacteria 1086
219 Ga0068865_100070682 3300006881 Bacteria 2473
220 Ga0068865_100084358 3300006881 Bacteria 2289
221 Ga0075436_100039459 3300006914 Bacteria 3259
222 Ga0075436_100070222 3300006914 Bacteria 2421
223 Ga0097620_100007756 3300006931 Bacteria 10897
224 Ga0097620_100056838 3300006931 Bacteria 3940
225 Ga0097620_100060072 3300006931 Bacteria 3831
226 Ga0097620_100144066 3300006931 Bacteria 2457
227 Ga0097620_100149502 3300006931 Bacteria 2411
228 Ga0075435_100027884 3300007076 Bacteria 4422
229 Ga0099795_10036243 3300007788 Bacteria 1730
230 Ga0105240_10006302 3300009093 Bacteria 17457
231 Ga0105240_10032013 3300009093 Bacteria 6811
232 Ga0105240_10043257 3300009093 Bacteria 5732
233 Ga0105240_10089300 3300009093 Bacteria 3770
234 Ga0105240_10103453 3300009093 Bacteria 3460
235 Ga0111539_10000486 3300009094 Bacteria 50337
236 Ga0111539_10001478 3300009094 Bacteria 31398
237 Ga0111539_10009420 3300009094 Bacteria 12324
238 Ga0111539_10009829 3300009094 Bacteria 12075
239 Ga0111539_10116543 3300009094 Bacteria 3132
240 Ga0105245_10174926 3300009098 Bacteria 2047
241 Ga0105245_10178699 3300009098 Bacteria 2026
242 Ga0105245_10328993 3300009098 Bacteria 1507
243 Ga0105245_10538542 3300009098 Bacteria 1188
244 Ga0105247_10050490 3300009101 Bacteria 2560
245 Ga0105247_10079192 3300009101 Bacteria 2067
246 Ga0105243_10136517 3300009148 Bacteria 2087
247 Ga0105241_10397108 3300009174 Bacteria 1208
248 Ga0105242_10014784 3300009176 Bacteria 6044
249 Ga0105242_10071578 3300009176 Bacteria 2878
250 Ga0105242_10203075 3300009176 Bacteria 1761
251 Ga0105242_10350381 3300009176 Bacteria 1363
252 Ga0105248_10006203 3300009177 Bacteria 13106
253 Ga0105248_10016620 3300009177 Bacteria 8101
254 Ga0105248_10036313 3300009177 Bacteria 5511
255 Ga0105248_10048319 3300009177 Bacteria 4773
256 Ga0105248_10063274 3300009177 Bacteria 4153
257 Ga0105248_10277813 3300009177 Bacteria 1886
258 Ga0105237_10049334 3300009545 Bacteria 4232
259 Ga0105238_10037056 3300009551 Bacteria 4959
260 Ga0105238_10054670 3300009551 Bacteria 4009
261 Ga0105238_10140287 3300009551 Bacteria 2394
262 Ga0105249_10065135 3300009553 Bacteria 3352
263 Ga0105239_10015480 3300010375 Bacteria 8449
264 Ga0105239_10098071 3300010375 Bacteria 3239
265 Ga0105239_10594107 3300010375 Bacteria 1262
266 Ga0105246_10069737 3300011119 Bacteria 2470
267 Ga0105246_10237224 3300011119 Bacteria 1440
268 Ga0157373_10047508 3300013100 Bacteria 3062
269 Ga0157373_10112473 3300013100 Bacteria 1914
270 Ga0157370_10016464 3300013104 Bacteria 7484
271 Ga0157370_10041460 3300013104 Bacteria 4440
272 Ga0157370_10099838 3300013104 Bacteria 2720
273 Ga0157369_10132941 3300013105 Bacteria 2636
274 Ga0157369_10155058 3300013105 Bacteria 2419
275 Ga0157369_10334410 3300013105 Bacteria 1573
276 Ga0157374_10001008 3300013296 Bacteria 24403
277 Ga0157374_10002621 3300013296 Bacteria 15179
278 Ga0157374_10010065 3300013296 Bacteria 8118
279 Ga0157374_10018896 3300013296 Bacteria 6093
280 Ga0157374_10077224 3300013296 Bacteria 3151
281 Ga0157378_10015920 3300013297 Bacteria 6585
282 Ga0157378_10087733 3300013297 Bacteria 2822
283 Ga0157378_10117611 3300013297 Bacteria 2445
284 Ga0163162_10008899 3300013306 Bacteria 9764
285 Ga0163162_10010907 3300013306 Bacteria 8846
286 Ga0163162_10020276 3300013306 Bacteria 6528
287 Ga0163162_10074273 3300013306 Bacteria 3458
288 Ga0163162_10108759 3300013306 Bacteria 2869
289 Ga0163162_10302948 3300013306 Bacteria 1730
290 Ga0163162_10528184 3300013306 Bacteria 1309
291 Ga0163162_10891621 3300013306 Bacteria 1003
292 Ga0157372_10042431 3300013307 Bacteria 5032
293 Ga0157372_10157907 3300013307 Bacteria 2620
294 Ga0157375_10018912 3300013308 Bacteria 6255
295 Ga0157375_10021322 3300013308 Bacteria 5938
296 Ga0163163_10002111 3300014325 Bacteria 16771
297 Ga0163163_10051936 3300014325 Bacteria 4043
298 Ga0163163_10539677 3300014325 Bacteria 1229
299 Ga0157380_10237716 3300014326 Bacteria 1640
300 Ga0157377_10005227 3300014745 Bacteria 6078
301 Ga0157377_10009052 3300014745 Bacteria 4878
302 Ga0157377_10101180 3300014745 Bacteria 1717
303 Ga0157379_10001661 3300014968 Bacteria 18379
304 Ga0157379_10014692 3300014968 Bacteria 6868
305 Ga0157379_10062548 3300014968 Bacteria 3329
306 Ga0157379_10065199 3300014968 Bacteria 3256
307 Ga0157376_10005143 3300014969 Bacteria 9119
308 Ga0157376_10006156 3300014969 Bacteria 8451
309 Ga0157376_10013080 3300014969 Bacteria 6180
310 Ga0157376_10040128 3300014969 Bacteria 3824
311 Ga0157376_10041375 3300014969 Bacteria 3772
312 Ga0157376_10045764 3300014969 Bacteria 3605
313 Ga0157376_10148201 3300014969 Bacteria 2113
314 Ga0157376_10390925 3300014969 Bacteria 1342
315 Ga0163161_10045551 3300017792 Bacteria 3164
316 Ga0163161_10052118 3300017792 Bacteria 2966
317 Ga0213872_10016591 3300021361 Bacteria 3416
318 Ga0213872_10078618 3300021361 Bacteria 1482
319 Ga0213876_10050524 3300021384 Bacteria 2197
320 Ga0209455_1001983 3300025272 Bacteria 8388
321 Ga0207697_10030079 3300025315 Bacteria 2223
322 Ga0207656_10012110 3300025321 Bacteria 3274
323 Ga0207656_10147619 3300025321 Bacteria 1112
324 Ga0207682_10001428 3300025893 Bacteria 11026
325 Ga0207642_10001908 3300025899 Bacteria 6431
326 Ga0207642_10202532 3300025899 Bacteria 1097
327 Ga0207710_10029122 3300025900 Bacteria 2401
328 Ga0207710_10042736 3300025900 Bacteria 2014
329 Ga0207688_10013311 3300025901 Bacteria 4469
330 Ga0207680_10002256 3300025903 Bacteria 8999
331 Ga0207685_10038595 3300025905 Bacteria 1767
332 Ga0207699_10024411 3300025906 Bacteria 3306
333 Ga0207699_10116162 3300025906 Bacteria 1723
334 Ga0207645_10016330 3300025907 Bacteria 4916
335 Ga0207645_10030020 3300025907 Bacteria 3503
336 Ga0207645_10041538 3300025907 Bacteria 2943
337 Ga0207643_10030604 3300025908 Bacteria 2997
338 Ga0207643_10069315 3300025908 Bacteria 2027
339 Ga0207643_10124399 3300025908 Bacteria 1530
340 Ga0207705_10002838 3300025909 Bacteria 13260
341 Ga0207705_10003073 3300025909 Bacteria 12725
342 Ga0207705_10039414 3300025909 Bacteria 3386
343 Ga0207654_10053558 3300025911 Bacteria 2330
344 Ga0207707_10069650 3300025912 Bacteria 3066
345 Ga0207707_10134109 3300025912 Bacteria 2166
346 Ga0207695_10003096 3300025913 Bacteria 23815
347 Ga0207695_10117907 3300025913 Bacteria 2626
348 Ga0207695_10260111 3300025913 Bacteria 1633
349 Ga0207671_10437040 3300025914 Bacteria 1042
350 Ga0207693_10000913 3300025915 Bacteria 26504
351 Ga0207693_10005677 3300025915 Bacteria 10374
352 Ga0207693_10079621 3300025915 Bacteria 2564
353 Ga0207663_10001114 3300025916 Bacteria 12351
354 Ga0207663_10031320 3300025916 Bacteria 3147
355 Ga0207662_10007103 3300025918 Bacteria 6083
356 Ga0207657_10002519 3300025919 Bacteria 19811
357 Ga0207657_10055107 3300025919 Bacteria 3436
358 Ga0207649_10001372 3300025920 Bacteria 14441
359 Ga0207652_10003246 3300025921 Bacteria 13489
360 Ga0207652_10025960 3300025921 Bacteria 4875
361 Ga0207652_10369513 3300025921 Bacteria 1295
362 Ga0207646_10067690 3300025922 Bacteria 3188
363 Ga0207646_10164173 3300025922 Bacteria 2005
364 Ga0207681_10034573 3300025923 Bacteria 3324
365 Ga0207694_10012151 3300025924 Bacteria 6493
366 Ga0207694_10096625 3300025924 Bacteria 2336
367 Ga0207694_10129498 3300025924 Bacteria 2022
368 Ga0207650_10000798 3300025925 Bacteria 24176
369 Ga0207650_10024454 3300025925 Bacteria 4294
370 Ga0207650_10116296 3300025925 Bacteria 2076
371 Ga0207650_10221988 3300025925 Bacteria 1521
372 Ga0207650_10375647 3300025925 Bacteria 1173
373 Ga0207659_10001152 3300025926 Bacteria 15749
374 Ga0207659_10031686 3300025926 Bacteria 3623
375 Ga0207659_10038240 3300025926 Bacteria 3336
376 Ga0207659_10147321 3300025926 Bacteria 1834
377 Ga0207659_10220635 3300025926 Bacteria 1524
378 Ga0207687_10055734 3300025927 Bacteria 2771
379 Ga0207687_10098267 3300025927 Bacteria 2149
380 Ga0207687_10215867 3300025927 Bacteria 1507
381 Ga0207687_10243282 3300025927 Bacteria 1427
382 Ga0207700_10021244 3300025928 Bacteria 4428
383 Ga0207700_10156590 3300025928 Bacteria 1888
384 Ga0207664_10007111 3300025929 Bacteria 7758
385 Ga0207664_10055940 3300025929 Bacteria 3132
386 Ga0207644_10000221 3300025931 Bacteria 39277
387 Ga0207644_10014132 3300025931 Bacteria 5340
388 Ga0207644_10208437 3300025931 Bacteria 1544
389 Ga0207690_10071339 3300025932 Bacteria 2395
390 Ga0207706_10010176 3300025933 Bacteria 8608
391 Ga0207706_10038888 3300025933 Bacteria 4219
392 Ga0207706_10038966 3300025933 Bacteria 4215
393 Ga0207706_10062387 3300025933 Bacteria 3282
394 Ga0207686_10000911 3300025934 Bacteria 17729
395 Ga0207686_10025030 3300025934 Bacteria 3466
396 Ga0207686_10064741 3300025934 Unclassified 2328
397 Ga0207709_10031534 3300025935 Bacteria 3097
398 Ga0207709_10038494 3300025935 Bacteria 2849
399 Ga0207670_10117154 3300025936 Bacteria 1930
400 Ga0207670_10130807 3300025936 Bacteria 1838
401 Ga0207670_10143980 3300025936 Bacteria 1760
402 Ga0207669_10015446 3300025937 Bacteria 3851
403 Ga0207669_10122394 3300025937 Bacteria 1769
404 Ga0207704_10079819 3300025938 Bacteria 2110
405 Ga0207704_10284929 3300025938 Bacteria 1258
406 Ga0207665_10006871 3300025939 Bacteria 7532
407 Ga0207691_10000413 3300025940 Bacteria 42800
408 Ga0207691_10002611 3300025940 Bacteria 17592
409 Ga0207691_10040216 3300025940 Bacteria 4322
410 Ga0207691_10066884 3300025940 Bacteria 3250
411 Ga0207691_10099368 3300025940 Bacteria 2598
412 Ga0207691_10161126 3300025940 Bacteria 1968
413 Ga0207711_10002942 3300025941 Bacteria 14893
414 Ga0207711_10003072 3300025941 Bacteria 14581
415 Ga0207711_10211394 3300025941 Bacteria 1772
416 Ga0207689_10000354 3300025942 Bacteria 42996
417 Ga0207689_10006538 3300025942 Bacteria 10286
418 Ga0207689_10022727 3300025942 Bacteria 5269
419 Ga0207689_10278613 3300025942 Bacteria 1385
420 Ga0207661_10010056 3300025944 Bacteria 6798
421 Ga0207679_10004829 3300025945 Bacteria 8405
422 Ga0207667_10004383 3300025949 Bacteria 17283
423 Ga0207667_10017027 3300025949 Bacteria 8198
424 Ga0207651_10000142 3300025960 Bacteria 31331
425 Ga0207651_10000415 3300025960 Bacteria 18156
426 Ga0207651_10111828 3300025960 Bacteria 2052
427 Ga0207712_10193422 3300025961 Bacteria 1607
428 Ga0207668_10020947 3300025972 Bacteria 4163
429 Ga0207658_10064525 3300025986 Bacteria 2747
430 Ga0207658_10159129 3300025986 Bacteria 1849
431 Ga0207658_10238836 3300025986 Bacteria 1538
432 Ga0207677_10000329 3300026023 Bacteria 34285
433 Ga0207677_10002938 3300026023 Bacteria 9003
434 Ga0207677_10023805 3300026023 Bacteria 3790
435 Ga0207677_10032144 3300026023 Bacteria 3370
436 Ga0207677_10044752 3300026023 Bacteria 2951
437 Ga0207677_10121867 3300026023 Bacteria 1963
438 Ga0207677_10289018 3300026023 Bacteria 1349
439 Ga0207677_10365403 3300026023 Bacteria 1214
440 Ga0207703_10000505 3300026035 Bacteria 40406
441 Ga0207703_10000804 3300026035 Bacteria 30944
442 Ga0207703_10010532 3300026035 Bacteria 7230
443 Ga0207703_10020477 3300026035 Bacteria 5173
444 Ga0207703_10085431 3300026035 Bacteria 2641
445 Ga0207703_10552185 3300026035 Bacteria 1086
446 Ga0207639_10181406 3300026041 Bacteria 1791
447 Ga0207639_10281928 3300026041 Bacteria 1462
448 Ga0207708_10004528 3300026075 Bacteria 10227
449 Ga0207702_10087696 3300026078 Bacteria 2717
450 Ga0207702_10590090 3300026078 Bacteria 1089
451 Ga0207641_10012527 3300026088 Bacteria 6951
452 Ga0207641_10056843 3300026088 Bacteria 3326
453 Ga0207641_10063307 3300026088 Bacteria 3159
454 Ga0207641_10079952 3300026088 Bacteria 2835
455 Ga0207648_10004748 3300026089 Bacteria 13886
456 Ga0207648_10051621 3300026089 Bacteria 3594
457 Ga0207648_10066771 3300026089 Bacteria 3136
458 Ga0207648_10107411 3300026089 Bacteria 2450
459 Ga0207648_10223181 3300026089 Bacteria 1675
460 Ga0207676_10000369 3300026095 Bacteria 38481
461 Ga0207676_10010718 3300026095 Bacteria 6535
462 Ga0207676_10058014 3300026095 Bacteria 3051
463 Ga0207676_10216446 3300026095 Bacteria 1703
464 Ga0207676_10222181 3300026095 Bacteria 1683
465 Ga0207676_10390951 3300026095 Bacteria 1297
466 Ga0207674_10016162 3300026116 Bacteria 8176
467 Ga0207674_10032922 3300026116 Bacteria 5432
468 Ga0207674_10106526 3300026116 Bacteria 2781
469 Ga0207675_100003866 3300026118 Bacteria 14554
470 Ga0207675_100065116 3300026118 Bacteria 3407
471 Ga0207675_100087438 3300026118 Bacteria 2927
472 Ga0207675_100110868 3300026118 Bacteria 2589
473 Ga0207683_10000588 3300026121 Bacteria 33464
474 Ga0207683_10048815 3300026121 Bacteria 3704
475 Ga0207683_10051470 3300026121 Bacteria 3608
476 Ga0207683_10087980 3300026121 Bacteria 2763
477 Ga0207683_10097008 3300026121 Bacteria 2628
478 Ga0207683_10107331 3300026121 Bacteria 2498
479 Ga0207698_10000233 3300026142 Bacteria 34707
480 Ga0207698_10018160 3300026142 Bacteria 4787
481 Ga0207698_10034617 3300026142 Bacteria 3684
482 Ga0207698_10168062 3300026142 Bacteria 1928
483 Ga0209969_1000127 3300027360 Bacteria 9734
484 Ga0209984_1006607 3300027424 Bacteria 1426
485 Ga0209995_1000640 3300027471 Bacteria 5405
486 Ga0209588_1033936 3300027671 Bacteria 1637
487 Ga0209974_10001161 3300027876 Bacteria 9381
488 Ga0209974_10009054 3300027876 Bacteria 3384
489 Ga0207428_10002833 3300027907 Bacteria 17208
490 Ga0207428_10008728 3300027907 Bacteria 9144
491 Ga0207428_10013863 3300027907 Bacteria 7021
492 Ga0207428_10070732 3300027907 Bacteria 2742
493 Ga0207428_10092880 3300027907 Bacteria 2341
494 Ga0207428_10148371 3300027907 Bacteria 1786
495 Ga0268266_10272528 3300028379 Bacteria 1571
496 Ga0268265_10004875 3300028380 Bacteria 9248
497 Ga0268265_10262605 3300028380 Bacteria 1536
498 Ga0268264_10000627 3300028381 Bacteria 42022
499 Ga0268264_10004988 3300028381 Bacteria 11239
500 Ga0268264_10107933 3300028381 Bacteria 2433
501 Ga0265318_10009581 3300028577 Bacteria 4252
502 Ga0265323_10013505 3300028653 Bacteria 3255
503 Ga0265324_10000448 3300029957 Bacteria 29201
504 Ga0265330_10001258 3300031235 Bacteria 14845
505 Ga0265330_10012033 3300031235 Bacteria 4047
506 Ga0265330_10087583 3300031235 Bacteria 1338
507 Ga0265332_10000004 3300031238 Bacteria 426592
508 Ga0265332_10001479 3300031238 Bacteria 13111
509 Ga0265332_10082478 3300031238 Bacteria 1363
510 Ga0265328_10000785 3300031239 Bacteria 14687
511 Ga0265325_10015721 3300031241 Bacteria 4248
512 Ga0265325_10016943 3300031241 Bacteria 4062
513 Ga0265325_10086768 3300031241 Bacteria 1548
514 Ga0265329_10001661 3300031242 Bacteria 10655
515 Ga0265329_10008649 3300031242 Bacteria 3844
516 Ga0265331_10000714 3300031250 Bacteria 28280
517 Ga0265331_10001273 3300031250 Bacteria 18843
518 Ga0265331_10024355 3300031250 Bacteria 3062
519 Ga0265331_10028288 3300031250 Bacteria 2804
520 Ga0265331_10030158 3300031250 Bacteria 2701
521 Ga0265331_10101560 3300031250 Bacteria 1323
522 Ga0265327_10000739 3300031251 Bacteria 51006
523 Ga0265327_10002771 3300031251 Bacteria 17740
524 Ga0265327_10109605 3300031251 Bacteria 1321
525 Ga0265316_10018429 3300031344 Bacteria 5999
526 Ga0265316_10034622 3300031344 Bacteria 4101
527 Ga0265316_10086607 3300031344 Bacteria 2394
528 Ga0265316_10138180 3300031344 Bacteria 1832
529 Ga0265316_10336986 3300031344 Bacteria 1093
530 Ga0307509_10000072 3300031507 Bacteria 140566
531 Ga0307509_10340957 3300031507 Unclassified 1226
532 Ga0307508_10012325 3300031616 Bacteria 7818
533 Ga0316575_10000043 3300031665 Bacteria 31191
534 Ga0265314_10000166 3300031711 Bacteria 99589
535 Ga0265314_10091625 3300031711 Bacteria 1978
536 Ga0265314_10165093 3300031711 Bacteria 1343
537 Ga0316576_10151587 3300031727 Bacteria 1747
538 Ga0307405_10008204 3300031731 Bacteria 5280
539 Ga0307413_10039164 3300031824 Bacteria 2754
540 Ga0307410_10039295 3300031852 Bacteria 3106
541 Ga0307406_10012386 3300031901 Bacteria 4864
542 Ga0307407_10005722 3300031903 Bacteria 5430
543 Ga0307412_10002503 3300031911 Bacteria 10213
544 Ga0307412_10088915 3300031911 Bacteria 2156
545 Ga0307412_10335205 3300031911 Bacteria 1209
546 Ga0307412_10487569 3300031911 Bacteria 1023
547 Ga0307409_100002429 3300031995 Bacteria 9733
548 Ga0307409_100328629 3300031995 Bacteria 1434
549 Ga0307416_100005286 3300032002 Bacteria 7909
550 Ga0307416_100052937 3300032002 Bacteria 3253
551 Ga0307416_100241840 3300032002 Bacteria 1750
552 Ga0307416_100277061 3300032002 Bacteria 1651
553 Ga0307416_100380303 3300032002 Bacteria 1442
554 Ga0307411_10031480 3300032005 Bacteria 3265
555 Ga0307411_10280585 3300032005 Bacteria 1326
556 Ga0307411_10437320 3300032005 Bacteria 1091
557 Ga0307415_100003060 3300032126 Bacteria 8439
558 Ga0307415_100125275 3300032126 Bacteria 1935
559 Ga0373930_0020118 3300034816 Bacteria 1298
560 Ga0373928_0004977 3300035084 Bacteria 2533
561 Ga0373934_0000938 3300035086 Bacteria 10559
562 Ga0373934_0001707 3300035086 Bacteria 8069
563 Ga0373934_0042852 3300035086 Bacteria 1788
564 Ga0373952_0000139 3300035092 Bacteria 10580
565 Ga0373923_0004026 3300035111 Bacteria 4818
566 Ga0373923_0040491 3300035111 Bacteria 1918
567 Ga0373936_0011580 3300035113 Bacteria 3342
568 Ga0373953_0033692 3300035117 Bacteria 2004
569 Ga0373954_0001297 3300035118 Bacteria 10054
570 Ga0373954_0003680 3300035118 Bacteria 6530
571 Ga0373954_0007369 3300035118 Bacteria 4813
572 Ga0373956_0000094 3300035119 Bacteria 29858
573 Ga0373957_0001720 3300035120 Bacteria 6015
574 Ga0373957_0005576 3300035120 Bacteria 3908
575 Ga0373960_0025903 3300035121 Bacteria 1598
576 Ga0373943_0029243 3300035170 Bacteria 2603
577 Ga0373955_0003882 3300035172 Bacteria 6591
578 Ga0373955_0031385 3300035172 Bacteria 2782
579 Ga0373955_0041706 3300035172 Bacteria 2461
580 Ga0373962_0020448 3300035242 Bacteria 1739
581 Ga0373924_0001044 3300035410 Bacteria 8805
582 Ga0373924_0034572 3300035410 Bacteria 2046
583 Ga0373935_0061898 3300035692 Bacteria 2396
584 Ga0373935_0075376 3300035692 Bacteria 2182
585 Ga0373935_0100545 3300035692 Bacteria 1905
586 Ga0373927_0028588 3300035695 Bacteria 3637
587 Ga0373927_0030186 3300035695 Bacteria 3537
588 Ga0373927_0262003 3300035695 Bacteria 1137
589 Ga0373933_0000432 3300035724 Bacteria 26397
590 Ga0373933_0091706 3300035724 Bacteria 1875
591 Ga0373933_0115504 3300035724 Bacteria 1677
592 Ga0373933_0401608 3300035724 Bacteria 894
593 Ga0373947_0006348 3300035725 Bacteria 6871
594 Ga0373947_0139285 3300035725 Bacteria 1555
595 Ga0373937_0000255 3300036401 Bacteria 51770
596 Ga0373937_0002035 3300036401 Bacteria 16886
597 Ga0373937_0323700 3300036401 Bacteria 1459
598 Ga0373925_0020083 3300037068 Bacteria 4861
599 Ga0373925_0027214 3300037068 Bacteria 4187
600 Ga0373925_0048045 3300037068 Bacteria 3178
601 Ga0373925_0066275 3300037068 Bacteria 2722
602 Ga0373925_0073651 3300037068 Bacteria 2585
603 Ga0373925_0571939 3300037068 Bacteria 930
604 Ga0395900_0019530 3300037418 Bacteria 6909
605 Ga0395900_0121553 3300037418 Bacteria 2679
606 Ga0395905_0005002 3300037471 Bacteria 13656
607 Ga0395905_0381770 3300037471 Bacteria 1303
608 Ga0436365_0249810 3300039437 Bacteria 2469
609 Ga0436365_0619540 3300039437 Bacteria 2604
610 Ga0436361_0562316 3300039447 Bacteria 3550
611 Ga0436361_0613315 3300039447 Bacteria 1723
612 Ga0451807_2326244 3300041486 Bacteria 1305
613 Ga0451853_1720496 3300041512 Bacteria 2497
614 Ga0451853_3251761 3300041512 Bacteria 1215
615 Ga0439441_002369 3300042001 Bacteria 2649
616 Ga0439435_0035526 3300042436 Bacteria 1374
617 Ga0439435_0054433 3300042436 Bacteria 1152
618 Ga0451577_0000013 3300042876 Bacteria 550689
619 Ga0451577_0000519 3300042876 Bacteria 64350
620 Ga0451577_0003649 3300042876 Bacteria 16882
621 Ga0451577_0016075 3300042876 Bacteria 6941
622 Ga0451577_0024692 3300042876 Bacteria 5464
623 Ga0451577_0081617 3300042876 Bacteria 2884
624 Ga0451577_0118530 3300042876 Bacteria 2371
625 Ga0451577_0212806 3300042876 Bacteria 1746
626 Ga0451577_0295745 3300042876 Bacteria 1467
627 Ga0453683_0000033 3300044673 Bacteria 241479
628 Ga0453683_0023695 3300044673 Bacteria 3911
629 Ga0453683_0052160 3300044673 Bacteria 2561
630 Ga0453683_0089631 3300044673 Bacteria 1928
631 Ga0466966_0081878 3300044684 Bacteria 2009
632 Ga0453684_0000005 3300044712 Bacteria 1431632
633 Ga0453684_0000040 3300044712 Bacteria 690210
634 Ga0453684_0000085 3300044712 Bacteria 397817
635 Ga0453684_0000114 3300044712 Bacteria 356610
636 Ga0453684_0000296 3300044712 Bacteria 211075
637 Ga0453684_0000623 3300044712 Bacteria 129254
638 Ga0453684_0007483 3300044712 Bacteria 20045
639 Ga0453684_0011178 3300044712 Bacteria 15114
640 Ga0453684_0018530 3300044712 Bacteria 10675
641 Ga0453684_0059341 3300044712 Bacteria 4933
642 Ga0453684_0061324 3300044712 Bacteria 4828
643 Ga0453684_0210474 3300044712 Bacteria 2260
644 Ga0453684_0336014 3300044712 Bacteria 1707
645 Ga0453684_0373437 3300044712 Bacteria 1603
646 Ga0466957_0022668 3300044842 Bacteria 3706
647 Ga0451576_0000018 3300045051 Bacteria 550689
648 Ga0451576_0000166 3300045051 Bacteria 166647
649 Ga0451576_0000761 3300045051 Bacteria 63684
650 Ga0451576_0005878 3300045051 Bacteria 15242
651 Ga0451576_0006357 3300045051 Bacteria 14505
652 Ga0451576_0007439 3300045051 Bacteria 13087
653 Ga0451576_0007667 3300045051 Bacteria 12830
654 Ga0451576_0010951 3300045051 Bacteria 10363
655 Ga0451576_0023472 3300045051 Bacteria 6678
656 Ga0451576_0024433 3300045051 Bacteria 6527
657 Ga0451576_0028815 3300045051 Bacteria 5946
658 Ga0451576_0037277 3300045051 Bacteria 5151
659 Ga0451576_0040275 3300045051 Bacteria 4947
660 Ga0466958_0027553 3300045836 Bacteria 3363
661 Ga0495592_0003670 3300046454 Bacteria 11055
662 Ga0495592_0096393 3300046454 Bacteria 2114
663 Ga0495592_0224618 3300046454 Bacteria 1253
664 Ga0495641_0014558 3300046461 Bacteria 4249
665 Ga0495651_0004185 3300046462 Bacteria 11050
666 Ga0495651_0005023 3300046462 Bacteria 10108
667 Ga0495651_0216682 3300046462 Bacteria 1328
668 Ga0495653_0018287 3300046463 Bacteria 5695
669 Ga0495653_0186830 3300046463 Bacteria 1417
670 Ga0495580_0006751 3300046472 Bacteria 9310
671 Ga0495580_0056713 3300046472 Bacteria 2758
672 Ga0495580_0144689 3300046472 Bacteria 1647
673 Ga0495582_0023520 3300046473 Bacteria 3371
674 Ga0495582_0065749 3300046473 Bacteria 2003
675 Ga0495639_0004383 3300046475 Bacteria 6048
676 Ga0495662_0002793 3300046476 Bacteria 8827
677 Ga0495662_0052939 3300046476 Bacteria 1960
678 Ga0495664_0077716 3300046477 Bacteria 1988
679 Ga0495606_0077236 3300046507 Bacteria 2079
680 Ga0495608_0041909 3300046511 Bacteria 3062
681 Ga0495608_0109322 3300046511 Bacteria 1778
682 Ga0495628_0005544 3300046516 Bacteria 11049
683 Ga0495628_0007978 3300046516 Bacteria 9124
684 Ga0495628_0018540 3300046516 Bacteria 5762
685 Ga0495628_0155463 3300046516 Bacteria 1740
686 Ga0495630_0178326 3300046517 Bacteria 1620
687 Ga0495663_0033232 3300046525 Bacteria 1540
688 Ga0495666_0003327 3300046526 Bacteria 8117
689 Ga0495642_0047329 3300046528 Bacteria 1761
690 Ga0495642_0075718 3300046528 Bacteria 1412
691 Ga0495652_0001765 3300046529 Bacteria 23187
692 Ga0495652_0078644 3300046529 Bacteria 2729
693 Ga0495586_0044906 3300046535 Bacteria 2380
694 Ga0495587_0019634 3300046536 Bacteria 4180
695 Ga0495587_0093234 3300046536 Bacteria 1739
696 Ga0495598_0020872 3300046537 Bacteria 1735
697 Ga0495598_0052575 3300046537 Bacteria 1231
698 Ga0495609_0114537 3300046538 Bacteria 1162
699 Ga0495621_0009589 3300046539 Bacteria 2945
700 Ga0495621_0074352 3300046539 Bacteria 1257
701 Ga0495645_0000566 3300046543 Bacteria 25312
702 Ga0495645_0057531 3300046543 Bacteria 2821
703 Ga0495645_0138739 3300046543 Bacteria 1698
704 Ga0495622_0044842 3300046557 Bacteria 2055
705 Ga0495667_0058629 3300046559 Bacteria 2529
706 Ga0495667_0063205 3300046559 Bacteria 2424
707 Ga0495635_0010206 3300046663 Bacteria 6566
708 Ga0495635_0029976 3300046663 Bacteria 3782
709 Ga0495635_0091773 3300046663 Bacteria 2077
710 Ga0495659_0150139 3300046664 Bacteria 935
711 Ga0495588_0091251 3300046674 Bacteria 1596
712 Ga0495657_0007804 3300046675 Bacteria 8217
713 Ga0495599_0000649 3300046678 Bacteria 19700
714 Ga0495599_0001603 3300046678 Bacteria 13048
715 Ga0495599_0007793 3300046678 Bacteria 6499
716 Ga0495658_0076652 3300046683 Bacteria 1954
717 Ga0495669_0013709 3300046684 Bacteria 3460
718 Ga0495613_0009375 3300046689 Bacteria 7263
719 Ga0495613_0043995 3300046689 Bacteria 3304
720 Ga0495660_0063056 3300046810 Bacteria 1985
721 Ga0495581_0000555 3300047315 Bacteria 19346
722 Ga0495604_0141006 3300047317 Bacteria 1722
723 Ga0495636_0071410 3300047318 Bacteria 1482
724 Ga0495674_0025865 3300047319 Bacteria 5373
725 Ga0495674_0363928 3300047319 Bacteria 1172
726 Ga0495680_0294183 3300047322 Bacteria 1141
727 Ga0495675_0007862 3300047444 Bacteria 6589
728 Ga0495675_0122082 3300047444 Bacteria 1622
729 Ga0495684_0014104 3300047471 Bacteria 6147
730 Ga0495684_0055761 3300047471 Bacteria 3014
731 Ga0495686_0059834 3300047472 Bacteria 2369
732 Ga0495602_0184493 3300048088 Bacteria 1606
733 Ga0495614_0019619 3300048089 Bacteria 2926
734 Ga0496100_0079635 3300048903 Bacteria 2208
735 Ga0496100_0152030 3300048903 Bacteria 1652
736 Ga0496101_0173036 3300048904 Bacteria 1660
737 Ga0496101_0221092 3300048904 Bacteria 1470
738 Ga0496102_0322445 3300048905 Bacteria 1455
739 Ga0496103_0078094 3300048906 Bacteria 2079
740 Ga0496104_0001965 3300048907 Bacteria 17807
741 Ga0496104_0012365 3300048907 Bacteria 7672
742 Ga0496104_0241154 3300048907 Bacteria 1720
743 Ga0496104_0554497 3300048907 Bacteria 1060
744 Ga0496105_0005754 3300048908 Bacteria 9445
745 Ga0496107_0160133 3300048910 Bacteria 1668
746 Ga0496108_0005919 3300048911 Bacteria 9911
747 Ga0496108_0027226 3300048911 Bacteria 4718
748 Ga0496108_0309983 3300048911 Bacteria 1375
749 Ga0496109_0012100 3300048912 Bacteria 7438
750 Ga0496109_0063121 3300048912 Bacteria 3388
751 Ga0496109_0141337 3300048912 Bacteria 2251
752 Ga0496110_0002718 3300048913 Bacteria 13361
753 Ga0496110_0265795 3300048913 Bacteria 1562
754 Ga0496110_0795055 3300048913 Bacteria 850
755 Ga0496112_0006687 3300048915 Bacteria 10152
756 Ga0496112_0177882 3300048915 Bacteria 2092
757 Ga0496113_0015267 3300048916 Bacteria 5273
758 Ga0496114_0005749 3300048917 Bacteria 9734
759 Ga0496114_0010696 3300048917 Bacteria 7302
760 Ga0496114_0304428 3300048917 Bacteria 1407
761 Ga0496115_0069557 3300048918 Bacteria 2852
762 Ga0501031_0002174 3300049568 Bacteria 12379
763 Ga0501031_0005161 3300049568 Bacteria 8510
764 Ga0501031_0112465 3300049568 Bacteria 1778
765 Ga0501031_0222448 3300049568 Bacteria 1229
766 Ga0501032_0003661 3300049569 Bacteria 11685
767 Ga0501033_0005554 3300049570 Bacteria 9970
768 Ga0501033_0009133 3300049570 Bacteria 7644
769 Ga0501033_0011745 3300049570 Bacteria 6697
770 Ga0501034_0009146 3300049571 Bacteria 10397
771 Ga0501036_0018327 3300049572 Bacteria 5862
772 Ga0501036_0033402 3300049572 Bacteria 4351
773 Ga0501036_0111332 3300049572 Bacteria 2313
774 Ga0501037_0004141 3300049573 Bacteria 10525
775 Ga0501037_0060307 3300049573 Bacteria 2767
776 Ga0501038_0004863 3300049574 Bacteria 12478
777 Ga0501038_0004918 3300049574 Bacteria 12410
778 Ga0501038_0006265 3300049574 Bacteria 10997
779 Ga0501038_0008709 3300049574 Bacteria 9313
780 Ga0501038_0300304 3300049574 Bacteria 1260
781 Ga0501038_0300943 3300049574 Bacteria 1259
782 Ga0501038_0430038 3300049574 Bacteria 1017
783 Ga0501039_0017522 3300049575 Bacteria 5494
784 Ga0501040_0001889 3300049576 Bacteria 13451
785 Ga0501041_0059554 3300049577 Bacteria 2337
786 Ga0501042_0001673 3300049578 Bacteria 13219
787 Ga0501043_0009685 3300049579 Bacteria 7550
788 Ga0501043_0076663 3300049579 Bacteria 2627
789 Ga0501043_0211778 3300049579 Bacteria 1502
790 Ga0501043_0335646 3300049579 Bacteria 1150
791 Ga0501046_0003282 3300049580 Bacteria 14859
792 Ga0501046_0029693 3300049580 Bacteria 4444
793 Ga0501047_0031198 3300049581 Bacteria 5140
794 Ga0501047_0317882 3300049581 Bacteria 1397
795 Ga0501048_0005615 3300049582 Bacteria 9540
796 Ga0501068_0001418 3300049584 Bacteria 12736
797 Ga0501071_0003792 3300049587 Bacteria 9499
798 Ga0501072_0247656 3300049588 Bacteria 1419
799 Ga0501075_0033905 3300049591 Bacteria 3799
800 Ga0501075_0097371 3300049591 Bacteria 2233
801 Ga0501076_0000441 3300049592 Bacteria 26293
802 Ga0501080_0098834 3300049742 Bacteria 2708
803 Ga0501081_0067272 3300049743 Bacteria 2493
804 Ga0501035_0003875 3300049822 Bacteria 14276
805 Ga0501035_0011429 3300049822 Bacteria 8231
806 Ga0501035_0013582 3300049822 Bacteria 7514
807 Ga0501035_0018997 3300049822 Bacteria 6327
808 Ga0501035_0024993 3300049822 Bacteria 5477
809 Ga0501035_0333918 3300049822 Bacteria 1271
810 Ga0501035_0544842 3300049822 Bacteria 951
811 Ga0501044_0000126 3300049823 Bacteria 92879
812 Ga0501044_0006304 3300049823 Bacteria 13112
813 Ga0501044_0007300 3300049823 Bacteria 12143
814 Ga0501044_0059187 3300049823 Bacteria 3926
815 Ga0501044_0155656 3300049823 Bacteria 2265
816 Ga0501045_0123264 3300049824 Bacteria 1924
817 Ga0501045_0149589 3300049824 Bacteria 1737
818 nmdc:mga07m45_114720_c1 3300050496 Bacteria 1553
819 nmdc:mga09592_56284_c1 3300050508 Bacteria 3323
820 nmdc:mga0qj67_73707_c1 3300050509 Bacteria 2727
821 nmdc:mga06r32_24270_c1 3300050510 Bacteria 5624
822 nmdc:mga08y16_16326_c1 3300050511 Bacteria 7806
823 nmdc:mga08y16_252870_c1 3300050511 Bacteria 1821
824 nmdc:mga08y16_31378_c1 3300050511 Bacteria 5588
825 nmdc:mga08y16_45483_c1 3300050511 Bacteria 4599
826 nmdc:mga08y16_6277_c1 3300050511 Bacteria 12462
827 nmdc:mga08y16_769809_c1 3300050511 Bacteria 957
828 nmdc:mga08y16_78634_c1 3300050511 Bacteria 3438
829 nmdc:mga0n895_159861_c1 3300050512 Bacteria 2284
830 nmdc:mga0n895_521502_c1 3300050512 Bacteria 1196
831 nmdc:mga0n895_540903_c1 3300050512 Bacteria 1171
832 nmdc:mga0n895_9412_c1 3300050512 Bacteria 8547
833 nmdc:mga0rr50_377283_c1 3300050513 Bacteria 1195
834 nmdc:mga0rr50_83470_c1 3300050513 Bacteria 2470
835 nmdc:mga08x19_4020_c1 3300050514 Bacteria 8752
836 nmdc:mga08x19_45541_c1 3300050514 Bacteria 2803
837 nmdc:mga08x19_62148_c1 3300050514 Bacteria 2421
838 nmdc:mga0a205_23653_c2 3300050515 Bacteria 5110
839 nmdc:mga0a205_284100_c1 3300050515 Bacteria 1530
840 Ga0495601_0002848 3300053077 Bacteria 9825
841 Ga0495601_0060165 3300053077 Bacteria 2410
842 Ga0495601_0080004 3300053077 Bacteria 2096
843 Ga0495601_0117921 3300053077 Bacteria 1722
844 Ga0495612_0009151 3300053078 Bacteria 4019
845 Ga0495595_0001451 3300053084 Bacteria 9250
846 Ga0495619_0006417 3300053085 Bacteria 7452
847 Ga0495619_0020619 3300053085 Bacteria 4201
848 Ga0500607_016555 3300053121 Bacteria 4225
849 Ga0500636_0000064 3300053177 Bacteria 51986
850 Ga0500637_0031332 3300053178 Bacteria 2962
851 Ga0530510_0087246 3300061734 Bacteria 2274
852 2526212271 2526164512 Bacteria 4025691
853 2548849317 2547132512 Bacteria 3416496
854 2843692431 2843690924 Bacteria 5169057
855 2846042365 2846037992 Bacteria 4526407
856 2857561933 2857558681 Bacteria 6617694
857 2904429565 2904424332 Bacteria 7633521
858 2998347647 2998344455 Bacteria 4222996
859 Ga0501034_0004775
860 Ga0055529_1001152
861 Ga0065712_10078545
862 Ga0070658_10006078
863 Ga0070658_10014263
864 Ga0070658_10292253
865 Ga0070676_10083905
866 Ga0070683_100001788
867 Ga0070683_100086367
868 Ga0070683_100408010
869 Ga0070690_100004680
870 Ga0070690_100021086
871 Ga0070690_100047414
872 Ga0070670_100000732
873 Ga0070670_100019332
874 Ga0070670_100025573
875 Ga0070670_100328728
876 Ga0070677_10057910
877 Ga0068869_100005486
878 Ga0068869_100075504
879 Ga0068869_100076604
880 Ga0070666_10020043
881 Ga0070680_100077278
882 Ga0070682_100012218
883 Ga0068868_100000144
884 Ga0068868_100009584
885 Ga0068868_100036103
886 Ga0068868_100061532
887 Ga0070660_100124427
888 Ga0070689_100003377
889 Ga0070689_100034210
890 Ga0070689_100146638
891 Ga0070689_100178636
892 Ga0070691_10014877
893 Ga0070687_100025518
894 Ga0070687_100069063
895 Ga0070687_100115196
896 Ga0070661_100000601
897 Ga0070661_100019649
898 Ga0070692_10060371
899 Ga0070668_100001724
900 Ga0070668_100068947
901 Ga0070668_100119513
902 Ga0070669_100011126
903 Ga0070675_100003810
904 Ga0070675_100026322
905 Ga0070675_100121920
906 Ga0070671_100001156
907 Ga0070671_100018208
908 Ga0070671_100368300
909 Ga0070674_100029925
910 Ga0070674_100067969
911 Ga0070673_100001260
912 Ga0070673_100001686
913 Ga0070673_100008218
914 Ga0070673_100037390
915 Ga0070688_100000431
916 Ga0070688_100106161
917 Ga0070659_100074768
918 Ga0070667_100032338
919 Ga0070667_100182385
920 Ga0070703_10018923
921 Ga0070703_10044178
922 Ga0070709_10057937
923 Ga0070709_10112717
924 Ga0070709_10201226
925 Ga0070714_100015547
926 Ga0070714_100050194
927 Ga0070714_100238897
928 Ga0070714_100264979
929 Ga0070713_100002492
930 Ga0070713_100087771
931 Ga0070701_10094082
932 Ga0070711_100002587
933 Ga0070705_100025920
934 Ga0070705_100173673
935 Ga0070700_100056967
936 Ga0070700_100185410
937 Ga0070700_100255082
938 Ga0070700_100380031
939 Ga0070694_100053962
940 Ga0070708_100020748
941 Ga0070663_100207376
942 Ga0070663_100238042
943 Ga0070678_100000019
944 Ga0070678_100079745
945 Ga0070678_100092645
946 Ga0070678_100196457
947 Ga0070662_100044204
948 Ga0070662_100138785
949 Ga0070681_10006660
950 Ga0070681_10075482
951 Ga0068867_100007906
952 Ga0068867_100026778
953 Ga0068867_100142867
954 Ga0070685_10000733
955 Ga0070685_10048220
956 Ga0070685_10136900
957 Ga0070706_100028196
958 Ga0070706_100037830
959 Ga0070706_100091409
960 Ga0070707_100012077
961 Ga0070707_100034979
962 Ga0070707_100145097
963 Ga0070698_100175897
964 Ga0070699_100006062
965 Ga0070699_100050568
966 Ga0070699_100071219
967 Ga0070679_100010085
968 Ga0070679_100015526
969 Ga0070679_100092317
970 Ga0070679_100509638
971 Ga0070684_100034952
972 Ga0070684_100057055
973 Ga0070684_100117514
974 Ga0070697_100030915
975 Ga0070697_100036887
976 Ga0068853_100074850
977 Ga0068853_100105607
978 Ga0068853_100116004
979 Ga0070672_100000151
980 Ga0070672_100028153
981 Ga0070672_100054868
982 Ga0070672_100154670
983 Ga0070672_100207337
984 Ga0070686_100025941
985 Ga0070686_100402778
986 Ga0070695_100018618
987 Ga0070695_100108342
988 Ga0070695_100112029
989 Ga0070696_100028401
990 Ga0070696_100156059
991 Ga0070696_100393929
992 Ga0070693_100045002
993 Ga0070693_100216139
994 Ga0070665_100072597
995 Ga0070665_100248437
996 Ga0070665_100397300
997 Ga0070704_100018546
998 Ga0070704_100158031
999 Ga0070704_100209581
1000 Ga0070704_100226861
1001 Ga0068855_100017466
1002 Ga0068855_100043110
1003 Ga0070664_100000957
1004 Ga0070664_100083343
1005 Ga0070664_100121536
1006 Ga0068857_100021734
1007 Ga0068854_100003057
1008 Ga0068854_100003907
1009 Ga0068854_100032222
1010 Ga0068854_100122142
1011 Ga0070702_100018030
1012 Ga0070702_100023295
1013 Ga0070702_100102043
1014 Ga0068852_100000486
1015 Ga0068852_100001134
1016 Ga0068852_100014226
1017 Ga0068852_100019290
1018 Ga0068852_100084408
1019 Ga0068852_100193310
1020 Ga0068852_100195347
1021 Ga0068852_100294908
1022 Ga0068859_100007757
1023 Ga0068859_100056838
1024 Ga0068859_100060072
1025 Ga0068859_100144063
1026 Ga0068859_100149509
1027 Ga0068864_100002543
1028 Ga0068864_100007067
1029 Ga0068864_100019099
1030 Ga0068864_100020001
1031 Ga0068864_100270224
1032 Ga0068864_100275892
1033 Ga0068861_100132928
1034 Ga0068861_100281772
1035 Ga0068851_10003401
1036 Ga0068851_10012253
1037 Ga0068870_10025360
1038 Ga0068863_100004686
1039 Ga0068863_100031587
1040 Ga0068863_100138274
1041 Ga0068863_100338383
1042 Ga0068863_100438035
1043 Ga0068858_100011845
1044 Ga0068858_100026879
1045 Ga0068858_100080458
1046 Ga0068860_100070165
1047 Ga0068860_100134448
1048 Ga0068862_100004088
1049 Ga0068862_100084972
1050 Ga0070716_100113934
1051 Ga0070712_100020319
1052 Ga0075366_10007379
1053 Ga0097621_100000274
1054 Ga0097621_100010760
1055 Ga0097621_100043537
1056 Ga0097621_100051122
1057 Ga0097621_100059537
1058 Ga0097621_100166053
1059 Ga0097621_100173157
1060 Ga0075370_10059534
1061 Ga0068871_100000325
1062 Ga0068871_100009363
1063 Ga0068871_100015986
1064 Ga0068871_100067718
1065 Ga0068871_100176340
1066 Ga0068871_100247518
1067 Ga0068871_100272829
1068 Ga0068871_100306716
1069 Ga0075428_100001689
1070 Ga0075428_100011896
1071 Ga0075430_100005251
1072 Ga0075431_100008882
1073 Ga0075433_10012283
1074 Ga0075434_100073969
1075 Ga0075434_100206615
1076 Ga0075434_100635771
1077 Ga0068865_100070682
1078 Ga0068865_100084358
1079 Ga0075436_100039459
1080 Ga0075436_100070222
1081 Ga0097620_100007756
1082 Ga0097620_100056838
1083 Ga0097620_100060072
1084 Ga0097620_100144066
1085 Ga0097620_100149502
1086 Ga0075435_100027884
1087 Ga0099795_10036243
1088 Ga0105240_10006302
1089 Ga0105240_10032013
1090 Ga0105240_10043257
1091 Ga0105240_10089300
1092 Ga0105240_10103453
1093 Ga0111539_10000486
1094 Ga0111539_10001478
1095 Ga0111539_10009420
1096 Ga0111539_10009829
1097 Ga0111539_10116543
1098 Ga0105245_10174926
1099 Ga0105245_10178699
1100 Ga0105245_10328993
1101 Ga0105245_10538542
1102 Ga0105247_10050490
1103 Ga0105247_10079192
1104 Ga0105243_10136517
1105 Ga0105241_10397108
1106 Ga0105242_10014784
1107 Ga0105242_10071578
1108 Ga0105242_10203075
1109 Ga0105242_10350381
1110 Ga0105248_10006203
1111 Ga0105248_10016620
1112 Ga0105248_10036313
1113 Ga0105248_10048319
1114 Ga0105248_10063274
1115 Ga0105248_10277813
1116 Ga0105237_10049334
1117 Ga0105238_10037056
1118 Ga0105238_10054670
1119 Ga0105238_10140287
1120 Ga0105249_10065135
1121 Ga0105239_10015480
1122 Ga0105239_10098071
1123 Ga0105239_10594107
1124 Ga0105246_10069737
1125 Ga0105246_10237224
1126 Ga0157373_10047508
1127 Ga0157373_10112473
1128 Ga0157370_10016464
1129 Ga0157370_10041460
1130 Ga0157370_10099838
1131 Ga0157369_10132941
1132 Ga0157369_10155058
1133 Ga0157369_10334410
1134 Ga0157374_10001008
1135 Ga0157374_10002621
1136 Ga0157374_10010065
1137 Ga0157374_10018896
1138 Ga0157374_10077224
1139 Ga0157378_10015920
1140 Ga0157378_10087733
1141 Ga0157378_10117611
1142 Ga0163162_10008899
1143 Ga0163162_10010907
1144 Ga0163162_10020276
1145 Ga0163162_10074273
1146 Ga0163162_10108759
1147 Ga0163162_10302948
1148 Ga0163162_10528184
1149 Ga0163162_10891621
1150 Ga0157372_10042431
1151 Ga0157372_10157907
1152 Ga0157375_10018912
1153 Ga0157375_10021322
1154 Ga0163163_10002111
1155 Ga0163163_10051936
1156 Ga0163163_10539677
1157 Ga0157380_10237716
1158 Ga0157377_10005227
1159 Ga0157377_10009052
1160 Ga0157377_10101180
1161 Ga0157379_10001661
1162 Ga0157379_10014692
1163 Ga0157379_10062548
1164 Ga0157379_10065199
1165 Ga0157376_10005143
1166 Ga0157376_10006156
1167 Ga0157376_10013080
1168 Ga0157376_10040128
1169 Ga0157376_10041375
1170 Ga0157376_10045764
1171 Ga0157376_10148201
1172 Ga0157376_10390925
1173 Ga0163161_10045551
1174 Ga0163161_10052118
1175 Ga0213872_10016591
1176 Ga0213872_10078618
1177 Ga0213876_10050524
1178 Ga0209455_1001983
1179 Ga0207697_10030079
1180 Ga0207656_10012110
1181 Ga0207656_10147619
1182 Ga0207682_10001428
1183 Ga0207642_10001908
1184 Ga0207642_10202532
1185 Ga0207710_10029122
1186 Ga0207710_10042736
1187 Ga0207688_10013311
1188 Ga0207680_10002256
1189 Ga0207685_10038595
1190 Ga0207699_10024411
1191 Ga0207699_10116162
1192 Ga0207645_10016330
1193 Ga0207645_10030020
1194 Ga0207645_10041538
1195 Ga0207643_10030604
1196 Ga0207643_10069315
1197 Ga0207643_10124399
1198 Ga0207705_10002838
1199 Ga0207705_10003073
1200 Ga0207705_10039414
1201 Ga0207654_10053558
1202 Ga0207707_10069650
1203 Ga0207707_10134109
1204 Ga0207695_10003096
1205 Ga0207695_10117907
1206 Ga0207695_10260111
1207 Ga0207671_10437040
1208 Ga0207693_10000913
1209 Ga0207693_10005677
1210 Ga0207693_10079621
1211 Ga0207663_10001114
1212 Ga0207663_10031320
1213 Ga0207662_10007103
1214 Ga0207657_10002519
1215 Ga0207657_10055107
1216 Ga0207649_10001372
1217 Ga0207652_10003246
1218 Ga0207652_10025960
1219 Ga0207652_10369513
1220 Ga0207646_10067690
1221 Ga0207646_10164173
1222 Ga0207681_10034573
1223 Ga0207694_10012151
1224 Ga0207694_10096625
1225 Ga0207694_10129498
1226 Ga0207650_10000798
1227 Ga0207650_10024454
1228 Ga0207650_10116296
1229 Ga0207650_10221988
1230 Ga0207650_10375647
1231 Ga0207659_10001152
1232 Ga0207659_10031686
1233 Ga0207659_10038240
1234 Ga0207659_10147321
1235 Ga0207659_10220635
1236 Ga0207687_10055734
1237 Ga0207687_10098267
1238 Ga0207687_10215867
1239 Ga0207687_10243282
1240 Ga0207700_10021244
1241 Ga0207700_10156590
1242 Ga0207664_10007111
1243 Ga0207664_10055940
1244 Ga0207644_10000221
1245 Ga0207644_10014132
1246 Ga0207644_10208437
1247 Ga0207690_10071339
1248 Ga0207706_10010176
1249 Ga0207706_10038888
1250 Ga0207706_10038966
1251 Ga0207706_10062387
1252 Ga0207686_10000911
1253 Ga0207686_10025030
1254 Ga0207686_10064741
1255 Ga0207709_10031534
1256 Ga0207709_10038494
1257 Ga0207670_10117154
1258 Ga0207670_10130807
1259 Ga0207670_10143980
1260 Ga0207669_10015446
1261 Ga0207669_10122394
1262 Ga0207704_10079819
1263 Ga0207704_10284929
1264 Ga0207665_10006871
1265 Ga0207691_10000413
1266 Ga0207691_10002611
1267 Ga0207691_10040216
1268 Ga0207691_10066884
1269 Ga0207691_10099368
1270 Ga0207691_10161126
1271 Ga0207711_10002942
1272 Ga0207711_10003072
1273 Ga0207711_10211394
1274 Ga0207689_10000354
1275 Ga0207689_10006538
1276 Ga0207689_10022727
1277 Ga0207689_10278613
1278 Ga0207661_10010056
1279 Ga0207679_10004829
1280 Ga0207667_10004383
1281 Ga0207667_10017027
1282 Ga0207651_10000142
1283 Ga0207651_10000415
1284 Ga0207651_10111828
1285 Ga0207712_10193422
1286 Ga0207668_10020947
1287 Ga0207658_10064525
1288 Ga0207658_10159129
1289 Ga0207658_10238836
1290 Ga0207677_10000329
1291 Ga0207677_10002938
1292 Ga0207677_10023805
1293 Ga0207677_10032144
1294 Ga0207677_10044752
1295 Ga0207677_10121867
1296 Ga0207677_10289018
1297 Ga0207677_10365403
1298 Ga0207703_10000505
1299 Ga0207703_10000804
1300 Ga0207703_10010532
1301 Ga0207703_10020477
1302 Ga0207703_10085431
1303 Ga0207703_10552185
1304 Ga0207639_10181406
1305 Ga0207639_10281928
1306 Ga0207708_10004528
1307 Ga0207702_10087696
1308 Ga0207702_10590090
1309 Ga0207641_10012527
1310 Ga0207641_10056843
1311 Ga0207641_10063307
1312 Ga0207641_10079952
1313 Ga0207648_10004748
1314 Ga0207648_10051621
1315 Ga0207648_10066771
1316 Ga0207648_10107411
1317 Ga0207648_10223181
1318 Ga0207676_10000369
1319 Ga0207676_10010718
1320 Ga0207676_10058014
1321 Ga0207676_10216446
1322 Ga0207676_10222181
1323 Ga0207676_10390951
1324 Ga0207674_10016162
1325 Ga0207674_10032922
1326 Ga0207674_10106526
1327 Ga0207675_100003866
1328 Ga0207675_100065116
1329 Ga0207675_100087438
1330 Ga0207675_100110868
1331 Ga0207683_10000588
1332 Ga0207683_10048815
1333 Ga0207683_10051470
1334 Ga0207683_10087980
1335 Ga0207683_10097008
1336 Ga0207683_10107331
1337 Ga0207698_10000233
1338 Ga0207698_10018160
1339 Ga0207698_10034617
1340 Ga0207698_10168062
1341 Ga0209969_1000127
1342 Ga0209984_1006607
1343 Ga0209995_1000640
1344 Ga0209588_1033936
1345 Ga0209974_10001161
1346 Ga0209974_10009054
1347 Ga0207428_10002833
1348 Ga0207428_10008728
1349 Ga0207428_10013863
1350 Ga0207428_10070732
1351 Ga0207428_10092880
1352 Ga0207428_10148371
1353 Ga0268266_10272528
1354 Ga0268265_10004875
1355 Ga0268265_10262605
1356 Ga0268264_10000627
1357 Ga0268264_10004988
1358 Ga0268264_10107933
1359 Ga0265318_10009581
1360 Ga0265323_10013505
1361 Ga0265324_10000448
1362 Ga0265330_10001258
1363 Ga0265330_10012033
1364 Ga0265330_10087583
1365 Ga0265332_10000004
1366 Ga0265332_10001479
1367 Ga0265332_10082478
1368 Ga0265328_10000785
1369 Ga0265325_10015721
1370 Ga0265325_10016943
1371 Ga0265325_10086768
1372 Ga0265329_10001661
1373 Ga0265329_10008649
1374 Ga0265331_10000714
1375 Ga0265331_10001273
1376 Ga0265331_10024355
1377 Ga0265331_10028288
1378 Ga0265331_10030158
1379 Ga0265331_10101560
1380 Ga0265327_10000739
1381 Ga0265327_10002771
1382 Ga0265327_10109605
1383 Ga0265316_10018429
1384 Ga0265316_10034622
1385 Ga0265316_10086607
1386 Ga0265316_10138180
1387 Ga0265316_10336986
1388 Ga0307509_10000072
1389 Ga0307509_10340957
1390 Ga0307508_10012325
1391 Ga0316575_10000043
1392 Ga0265314_10000166
1393 Ga0265314_10091625
1394 Ga0265314_10165093
1395 Ga0316576_10151587
1396 Ga0307405_10008204
1397 Ga0307413_10039164
1398 Ga0307410_10039295
1399 Ga0307406_10012386
1400 Ga0307407_10005722
1401 Ga0307412_10002503
1402 Ga0307412_10088915
1403 Ga0307412_10335205
1404 Ga0307412_10487569
1405 Ga0307409_100002429
1406 Ga0307409_100328629
1407 Ga0307416_100005286
1408 Ga0307416_100052937
1409 Ga0307416_100241840
1410 Ga0307416_100277061
1411 Ga0307416_100380303
1412 Ga0307411_10031480
1413 Ga0307411_10280585
1414 Ga0307411_10437320
1415 Ga0307415_100003060
1416 Ga0307415_100125275
1417 Ga0373930_0020118
1418 Ga0373928_0004977
1419 Ga0373934_0000938
1420 Ga0373934_0001707
1421 Ga0373934_0042852
1422 Ga0373952_0000139
1423 Ga0373923_0004026
1424 Ga0373923_0040491
1425 Ga0373936_0011580
1426 Ga0373953_0033692
1427 Ga0373954_0001297
1428 Ga0373954_0003680
1429 Ga0373954_0007369
1430 Ga0373956_0000094
1431 Ga0373957_0001720
1432 Ga0373957_0005576
1433 Ga0373960_0025903
1434 Ga0373943_0029243
1435 Ga0373955_0003882
1436 Ga0373955_0031385
1437 Ga0373955_0041706
1438 Ga0373962_0020448
1439 Ga0373924_0001044
1440 Ga0373924_0034572
1441 Ga0373935_0061898
1442 Ga0373935_0075376
1443 Ga0373935_0100545
1444 Ga0373927_0028588
1445 Ga0373927_0030186
1446 Ga0373927_0262003
1447 Ga0373933_0000432
1448 Ga0373933_0091706
1449 Ga0373933_0115504
1450 Ga0373933_0401608
1451 Ga0373947_0006348
1452 Ga0373947_0139285
1453 Ga0373937_0000255
1454 Ga0373937_0002035
1455 Ga0373937_0323700
1456 Ga0373925_0020083
1457 Ga0373925_0027214
1458 Ga0373925_0048045
1459 Ga0373925_0066275
1460 Ga0373925_0073651
1461 Ga0373925_0571939
1462 Ga0395900_0019530
1463 Ga0395900_0121553
1464 Ga0395905_0005002
1465 Ga0395905_0381770
1466 Ga0436365_0249810
1467 Ga0436365_0619540
1468 Ga0436361_0562316
1469 Ga0436361_0613315
1470 Ga0451807_2326244
1471 Ga0451853_1720496
1472 Ga0451853_3251761
1473 Ga0439441_002369
1474 Ga0439435_0035526
1475 Ga0439435_0054433
1476 Ga0451577_0000013
1477 Ga0451577_0000519
1478 Ga0451577_0003649
1479 Ga0451577_0016075
1480 Ga0451577_0024692
1481 Ga0451577_0081617
1482 Ga0451577_0118530
1483 Ga0451577_0212806
1484 Ga0451577_0295745
1485 Ga0453683_0000033
1486 Ga0453683_0023695
1487 Ga0453683_0052160
1488 Ga0453683_0089631
1489 Ga0466966_0081878
1490 Ga0453684_0000005
1491 Ga0453684_0000040
1492 Ga0453684_0000085
1493 Ga0453684_0000114
1494 Ga0453684_0000296
1495 Ga0453684_0000623
1496 Ga0453684_0007483
1497 Ga0453684_0011178
1498 Ga0453684_0018530
1499 Ga0453684_0059341
1500 Ga0453684_0061324
1501 Ga0453684_0210474
1502 Ga0453684_0336014
1503 Ga0453684_0373437
1504 Ga0466957_0022668
1505 Ga0451576_0000018
1506 Ga0451576_0000166
1507 Ga0451576_0000761
1508 Ga0451576_0005878
1509 Ga0451576_0006357
1510 Ga0451576_0007439
1511 Ga0451576_0007667
1512 Ga0451576_0010951
1513 Ga0451576_0023472
1514 Ga0451576_0024433
1515 Ga0451576_0028815
1516 Ga0451576_0037277
1517 Ga0451576_0040275
1518 Ga0466958_0027553
1519 Ga0495592_0003670
1520 Ga0495592_0096393
1521 Ga0495592_0224618
1522 Ga0495641_0014558
1523 Ga0495651_0004185
1524 Ga0495651_0005023
1525 Ga0495651_0216682
1526 Ga0495653_0018287
1527 Ga0495653_0186830
1528 Ga0495580_0006751
1529 Ga0495580_0056713
1530 Ga0495580_0144689
1531 Ga0495582_0023520
1532 Ga0495582_0065749
1533 Ga0495639_0004383
1534 Ga0495662_0002793
1535 Ga0495662_0052939
1536 Ga0495664_0077716
1537 Ga0495606_0077236
1538 Ga0495608_0041909
1539 Ga0495608_0109322
1540 Ga0495628_0005544
1541 Ga0495628_0007978
1542 Ga0495628_0018540
1543 Ga0495628_0155463
1544 Ga0495630_0178326
1545 Ga0495663_0033232
1546 Ga0495666_0003327
1547 Ga0495642_0047329
1548 Ga0495642_0075718
1549 Ga0495652_0001765
1550 Ga0495652_0078644
1551 Ga0495586_0044906
1552 Ga0495587_0019634
1553 Ga0495587_0093234
1554 Ga0495598_0020872
1555 Ga0495598_0052575
1556 Ga0495609_0114537
1557 Ga0495621_0009589
1558 Ga0495621_0074352
1559 Ga0495645_0000566
1560 Ga0495645_0057531
1561 Ga0495645_0138739
1562 Ga0495622_0044842
1563 Ga0495667_0058629
1564 Ga0495667_0063205
1565 Ga0495635_0010206
1566 Ga0495635_0029976
1567 Ga0495635_0091773
1568 Ga0495659_0150139
1569 Ga0495588_0091251
1570 Ga0495657_0007804
1571 Ga0495599_0000649
1572 Ga0495599_0001603
1573 Ga0495599_0007793
1574 Ga0495658_0076652
1575 Ga0495669_0013709
1576 Ga0495613_0009375
1577 Ga0495613_0043995
1578 Ga0495660_0063056
1579 Ga0495581_0000555
1580 Ga0495604_0141006
1581 Ga0495636_0071410
1582 Ga0495674_0025865
1583 Ga0495674_0363928
1584 Ga0495680_0294183
1585 Ga0495675_0007862
1586 Ga0495675_0122082
1587 Ga0495684_0014104
1588 Ga0495684_0055761
1589 Ga0495686_0059834
1590 Ga0495602_0184493
1591 Ga0495614_0019619
1592 Ga0496100_0079635
1593 Ga0496100_0152030
1594 Ga0496101_0173036
1595 Ga0496101_0221092
1596 Ga0496102_0322445
1597 Ga0496103_0078094
1598 Ga0496104_0001965
1599 Ga0496104_0012365
1600 Ga0496104_0241154
1601 Ga0496104_0554497
1602 Ga0496105_0005754
1603 Ga0496107_0160133
1604 Ga0496108_0005919
1605 Ga0496108_0027226
1606 Ga0496108_0309983
1607 Ga0496109_0012100
1608 Ga0496109_0063121
1609 Ga0496109_0141337
1610 Ga0496110_0002718
1611 Ga0496110_0265795
1612 Ga0496110_0795055
1613 Ga0496112_0006687
1614 Ga0496112_0177882
1615 Ga0496113_0015267
1616 Ga0496114_0005749
1617 Ga0496114_0010696
1618 Ga0496114_0304428
1619 Ga0496115_0069557
1620 Ga0501031_0002174
1621 Ga0501031_0005161
1622 Ga0501031_0112465
1623 Ga0501031_0222448
1624 Ga0501032_0003661
1625 Ga0501033_0005554
1626 Ga0501033_0009133
1627 Ga0501033_0011745
1628 Ga0501034_0009146
1629 Ga0501036_0018327
1630 Ga0501036_0033402
1631 Ga0501036_0111332
1632 Ga0501037_0004141
1633 Ga0501037_0060307
1634 Ga0501038_0004863
1635 Ga0501038_0004918
1636 Ga0501038_0006265
1637 Ga0501038_0008709
1638 Ga0501038_0300304
1639 Ga0501038_0300943
1640 Ga0501038_0430038
1641 Ga0501039_0017522
1642 Ga0501040_0001889
1643 Ga0501041_0059554
1644 Ga0501042_0001673
1645 Ga0501043_0009685
1646 Ga0501043_0076663
1647 Ga0501043_0211778
1648 Ga0501043_0335646
1649 Ga0501046_0003282
1650 Ga0501046_0029693
1651 Ga0501047_0031198
1652 Ga0501047_0317882
1653 Ga0501048_0005615
1654 Ga0501068_0001418
1655 Ga0501071_0003792
1656 Ga0501072_0247656
1657 Ga0501075_0033905
1658 Ga0501075_0097371
1659 Ga0501076_0000441
1660 Ga0501080_0098834
1661 Ga0501081_0067272
1662 Ga0501035_0003875
1663 Ga0501035_0011429
1664 Ga0501035_0013582
1665 Ga0501035_0018997
1666 Ga0501035_0024993
1667 Ga0501035_0333918
1668 Ga0501035_0544842
1669 Ga0501044_0000126
1670 Ga0501044_0006304
1671 Ga0501044_0007300
1672 Ga0501044_0059187
1673 Ga0501044_0155656
1674 Ga0501045_0123264
1675 Ga0501045_0149589
1676 nmdc:mga07m45_114720_c1
1677 nmdc:mga09592_56284_c1
1678 nmdc:mga0qj67_73707_c1
1679 nmdc:mga06r32_24270_c1
1680 nmdc:mga08y16_16326_c1
1681 nmdc:mga08y16_252870_c1
1682 nmdc:mga08y16_31378_c1
1683 nmdc:mga08y16_45483_c1
1684 nmdc:mga08y16_6277_c1
1685 nmdc:mga08y16_769809_c1
1686 nmdc:mga08y16_78634_c1
1687 nmdc:mga0n895_159861_c1
1688 nmdc:mga0n895_521502_c1
1689 nmdc:mga0n895_540903_c1
1690 nmdc:mga0n895_9412_c1
1691 nmdc:mga0rr50_377283_c1
1692 nmdc:mga0rr50_83470_c1
1693 nmdc:mga08x19_4020_c1
1694 nmdc:mga08x19_45541_c1
1695 nmdc:mga08x19_62148_c1
1696 nmdc:mga0a205_23653_c2
1697 nmdc:mga0a205_284100_c1
1698 Ga0495601_0002848
1699 Ga0495601_0060165
1700 Ga0495601_0080004
1701 Ga0495601_0117921
1702 Ga0495612_0009151
1703 Ga0495595_0001451
1704 Ga0495619_0006417
1705 Ga0495619_0020619
1706 Ga0500607_016555
1707 Ga0500636_0000064
1708 Ga0500637_0031332
1709 Ga0530510_0087246
1710 2526212271
1711 2548849317
1712 2843692431
1713 2846042365
1714 2857561933
1715 2904429565
1716 2998347647

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00348

polyprenyl_synt

Polyprenyl synthetase

49

294

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lbj-assembly1.cif.gz_B crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia 0.9723 12 306
7lbj-assembly1.cif.gz_B crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia 0.9619 12 306
7lbj-assembly1.cif.gz_A crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia 0.9607 10 306
7my7-assembly2.cif.gz_CCC se-crte n-term his-tag structure 0.9579 12 230
7lbj-assembly1.cif.gz_A crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia 0.9573 10 306
ID Description Score Start End Superfamily
5aypA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9521 12 304 1.10.600.10
3zcdA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9435 13 304 1.10.600.10
5aypA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9413 12 304 1.10.600.10
4kkmB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9377 13 301 1.10.600.10
af_A0A0P0V0B7_118_416_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9326 9 306 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A3E0MXZ8-F1-model_v4 Polyprenyl synthetase family protein 0.989 119 306 GO:0004659
GO:0008299
AF-A0A353NCF4-F1-model_v4 Farnesyl-diphosphate synthase 0.9887 86 306 GO:0004659
GO:0005737
GO:0008299
AF-A0A3C1XTI3-F1-model_v4 Geranyl transferase 0.988 72 306 GO:0004659
GO:0005737
GO:0008299
AF-A0A357NMF4-F1-model_v4 deleted 0.9862 11 265
AF-A0A5N0KNE7-F1-model_v4 deleted 0.9851 11 306

Map