F483753
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 858 | 359 | 1716 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0004775|Ga0501034_0004775_4879_5826 |
| Length | 315 |
| Sequence | VRPNSSFFRNSLFSFSIVTPSDFQAWAAAGQQRIETFLQHVLPQPDIAPQRLHAAMRYAVLGAGKRVRPLLAYAAGELSQADPERVTVAGAAVEIIHAYSLVHDDLPCMDDDVLRRGKPTCHVEFDEPTALLVGDALQSLSFQLLGEYRLADDAGAQLEMVKLLAAAAGSRGMAGGQAIDLAAVGKTLSVPELEFMHIHKTGALIRAAAVLGARCGSGLNESEFAHVDTFAKAVGLAFQVVDDVLDAEAPTATLGKTAGKDAEQGKPTYVSAMGITRARTLAGELREEALKAIAPFGARGARLAQLADFIVLRKF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 222 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 228 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 232 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 243 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 245 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 246 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 301 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 302 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 303 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 304 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 309 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 312 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 350 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 352 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 353 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 354 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 355 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 356 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 357 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 358 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 359 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.18 |
| Metatranscriptomes | 0 |
| Isolates | 0.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.93 |
| Nodule | 0 |
| Rhizoplane | 3.38 |
| Rhizosphere | 94.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0004775 | 3300049571 | Bacteria | 15000 |
| 2 | Ga0055529_1001152 | 3300003763 | Bacteria | 11088 |
| 3 | Ga0065712_10078545 | 3300005290 | Bacteria | 3332 |
| 4 | Ga0070658_10006078 | 3300005327 | Bacteria | 9790 |
| 5 | Ga0070658_10014263 | 3300005327 | Bacteria | 6376 |
| 6 | Ga0070658_10292253 | 3300005327 | Bacteria | 1389 |
| 7 | Ga0070676_10083905 | 3300005328 | Bacteria | 1939 |
| 8 | Ga0070683_100001788 | 3300005329 | Bacteria | 16752 |
| 9 | Ga0070683_100086367 | 3300005329 | Bacteria | 2941 |
| 10 | Ga0070683_100408010 | 3300005329 | Bacteria | 1296 |
| 11 | Ga0070690_100004680 | 3300005330 | Bacteria | 7626 |
| 12 | Ga0070690_100021086 | 3300005330 | Bacteria | 3975 |
| 13 | Ga0070690_100047414 | 3300005330 | Bacteria | 2734 |
| 14 | Ga0070670_100000732 | 3300005331 | Bacteria | 25485 |
| 15 | Ga0070670_100019332 | 3300005331 | Bacteria | 5844 |
| 16 | Ga0070670_100025573 | 3300005331 | Bacteria | 5078 |
| 17 | Ga0070670_100328728 | 3300005331 | Bacteria | 1340 |
| 18 | Ga0070677_10057910 | 3300005333 | Bacteria | 1589 |
| 19 | Ga0068869_100005486 | 3300005334 | Bacteria | 7981 |
| 20 | Ga0068869_100075504 | 3300005334 | Bacteria | 2504 |
| 21 | Ga0068869_100076604 | 3300005334 | Bacteria | 2486 |
| 22 | Ga0070666_10020043 | 3300005335 | Bacteria | 4320 |
| 23 | Ga0070680_100077278 | 3300005336 | Bacteria | 2742 |
| 24 | Ga0070682_100012218 | 3300005337 | Bacteria | 4917 |
| 25 | Ga0068868_100000144 | 3300005338 | Bacteria | 46092 |
| 26 | Ga0068868_100009584 | 3300005338 | Bacteria | 6981 |
| 27 | Ga0068868_100036103 | 3300005338 | Bacteria | 3824 |
| 28 | Ga0068868_100061532 | 3300005338 | Bacteria | 2974 |
| 29 | Ga0070660_100124427 | 3300005339 | Bacteria | 2060 |
| 30 | Ga0070689_100003377 | 3300005340 | Bacteria | 10612 |
| 31 | Ga0070689_100034210 | 3300005340 | Bacteria | 3877 |
| 32 | Ga0070689_100146638 | 3300005340 | Bacteria | 1901 |
| 33 | Ga0070689_100178636 | 3300005340 | Bacteria | 1723 |
| 34 | Ga0070691_10014877 | 3300005341 | Bacteria | 3572 |
| 35 | Ga0070687_100025518 | 3300005343 | Bacteria | 2836 |
| 36 | Ga0070687_100069063 | 3300005343 | Bacteria | 1891 |
| 37 | Ga0070687_100115196 | 3300005343 | Bacteria | 1528 |
| 38 | Ga0070661_100000601 | 3300005344 | Bacteria | 26884 |
| 39 | Ga0070661_100019649 | 3300005344 | Bacteria | 4813 |
| 40 | Ga0070692_10060371 | 3300005345 | Bacteria | 1996 |
| 41 | Ga0070668_100001724 | 3300005347 | Bacteria | 15891 |
| 42 | Ga0070668_100068947 | 3300005347 | Bacteria | 2750 |
| 43 | Ga0070668_100119513 | 3300005347 | Bacteria | 2105 |
| 44 | Ga0070669_100011126 | 3300005353 | Bacteria | 6386 |
| 45 | Ga0070675_100003810 | 3300005354 | Bacteria | 11450 |
| 46 | Ga0070675_100026322 | 3300005354 | Bacteria | 4669 |
| 47 | Ga0070675_100121920 | 3300005354 | Bacteria | 2215 |
| 48 | Ga0070671_100001156 | 3300005355 | Bacteria | 19640 |
| 49 | Ga0070671_100018208 | 3300005355 | Bacteria | 5702 |
| 50 | Ga0070671_100368300 | 3300005355 | Bacteria | 1227 |
| 51 | Ga0070674_100029925 | 3300005356 | Bacteria | 3595 |
| 52 | Ga0070674_100067969 | 3300005356 | Bacteria | 2508 |
| 53 | Ga0070673_100001260 | 3300005364 | Bacteria | 14710 |
| 54 | Ga0070673_100001686 | 3300005364 | Bacteria | 13103 |
| 55 | Ga0070673_100008218 | 3300005364 | Bacteria | 6929 |
| 56 | Ga0070673_100037390 | 3300005364 | Bacteria | 3698 |
| 57 | Ga0070688_100000431 | 3300005365 | Bacteria | 21145 |
| 58 | Ga0070688_100106161 | 3300005365 | Bacteria | 1860 |
| 59 | Ga0070659_100074768 | 3300005366 | Bacteria | 2700 |
| 60 | Ga0070667_100032338 | 3300005367 | Bacteria | 4363 |
| 61 | Ga0070667_100182385 | 3300005367 | Bacteria | 1857 |
| 62 | Ga0070703_10018923 | 3300005406 | Bacteria | 1995 |
| 63 | Ga0070703_10044178 | 3300005406 | Bacteria | 1400 |
| 64 | Ga0070709_10057937 | 3300005434 | Bacteria | 2455 |
| 65 | Ga0070709_10112717 | 3300005434 | Bacteria | 1830 |
| 66 | Ga0070709_10201226 | 3300005434 | Bacteria | 1410 |
| 67 | Ga0070714_100015547 | 3300005435 | Bacteria | 6122 |
| 68 | Ga0070714_100050194 | 3300005435 | Bacteria | 3553 |
| 69 | Ga0070714_100238897 | 3300005435 | Bacteria | 1676 |
| 70 | Ga0070714_100264979 | 3300005435 | Bacteria | 1592 |
| 71 | Ga0070713_100002492 | 3300005436 | Bacteria | 12025 |
| 72 | Ga0070713_100087771 | 3300005436 | Bacteria | 2668 |
| 73 | Ga0070701_10094082 | 3300005438 | Bacteria | 1648 |
| 74 | Ga0070711_100002587 | 3300005439 | Bacteria | 10362 |
| 75 | Ga0070705_100025920 | 3300005440 | Bacteria | 3186 |
| 76 | Ga0070705_100173673 | 3300005440 | Bacteria | 1453 |
| 77 | Ga0070700_100056967 | 3300005441 | Bacteria | 2451 |
| 78 | Ga0070700_100185410 | 3300005441 | Bacteria | 1451 |
| 79 | Ga0070700_100255082 | 3300005441 | Bacteria | 1260 |
| 80 | Ga0070700_100380031 | 3300005441 | Unclassified | 1056 |
| 81 | Ga0070694_100053962 | 3300005444 | Bacteria | 2722 |
| 82 | Ga0070708_100020748 | 3300005445 | Bacteria | 5547 |
| 83 | Ga0070663_100207376 | 3300005455 | Bacteria | 1533 |
| 84 | Ga0070663_100238042 | 3300005455 | Bacteria | 1436 |
| 85 | Ga0070678_100000019 | 3300005456 | Bacteria | 51607 |
| 86 | Ga0070678_100079745 | 3300005456 | Bacteria | 2477 |
| 87 | Ga0070678_100092645 | 3300005456 | Bacteria | 2322 |
| 88 | Ga0070678_100196457 | 3300005456 | Bacteria | 1662 |
| 89 | Ga0070662_100044204 | 3300005457 | Bacteria | 3190 |
| 90 | Ga0070662_100138785 | 3300005457 | Bacteria | 1882 |
| 91 | Ga0070681_10006660 | 3300005458 | Bacteria | 11245 |
| 92 | Ga0070681_10075482 | 3300005458 | Bacteria | 3331 |
| 93 | Ga0068867_100007906 | 3300005459 | Bacteria | 7514 |
| 94 | Ga0068867_100026778 | 3300005459 | Bacteria | 4142 |
| 95 | Ga0068867_100142867 | 3300005459 | Bacteria | 1872 |
| 96 | Ga0070685_10000733 | 3300005466 | Bacteria | 17900 |
| 97 | Ga0070685_10048220 | 3300005466 | Bacteria | 2452 |
| 98 | Ga0070685_10136900 | 3300005466 | Bacteria | 1537 |
| 99 | Ga0070706_100028196 | 3300005467 | Bacteria | 5168 |
| 100 | Ga0070706_100037830 | 3300005467 | Bacteria | 4455 |
| 101 | Ga0070706_100091409 | 3300005467 | Bacteria | 2823 |
| 102 | Ga0070707_100012077 | 3300005468 | Bacteria | 8063 |
| 103 | Ga0070707_100034979 | 3300005468 | Bacteria | 4790 |
| 104 | Ga0070707_100145097 | 3300005468 | Bacteria | 2310 |
| 105 | Ga0070698_100175897 | 3300005471 | Bacteria | 2080 |
| 106 | Ga0070699_100006062 | 3300005518 | Bacteria | 10568 |
| 107 | Ga0070699_100050568 | 3300005518 | Bacteria | 3598 |
| 108 | Ga0070699_100071219 | 3300005518 | Bacteria | 3023 |
| 109 | Ga0070679_100010085 | 3300005530 | Bacteria | 8952 |
| 110 | Ga0070679_100015526 | 3300005530 | Bacteria | 7317 |
| 111 | Ga0070679_100092317 | 3300005530 | Bacteria | 3015 |
| 112 | Ga0070679_100509638 | 3300005530 | Bacteria | 1147 |
| 113 | Ga0070684_100034952 | 3300005535 | Bacteria | 4299 |
| 114 | Ga0070684_100057055 | 3300005535 | Bacteria | 3409 |
| 115 | Ga0070684_100117514 | 3300005535 | Bacteria | 2390 |
| 116 | Ga0070697_100030915 | 3300005536 | Bacteria | 4303 |
| 117 | Ga0070697_100036887 | 3300005536 | Bacteria | 3948 |
| 118 | Ga0068853_100074850 | 3300005539 | Bacteria | 2955 |
| 119 | Ga0068853_100105607 | 3300005539 | Bacteria | 2495 |
| 120 | Ga0068853_100116004 | 3300005539 | Bacteria | 2384 |
| 121 | Ga0070672_100000151 | 3300005543 | Bacteria | 38113 |
| 122 | Ga0070672_100028153 | 3300005543 | Bacteria | 4199 |
| 123 | Ga0070672_100054868 | 3300005543 | Bacteria | 3120 |
| 124 | Ga0070672_100154670 | 3300005543 | Bacteria | 1899 |
| 125 | Ga0070672_100207337 | 3300005543 | Bacteria | 1641 |
| 126 | Ga0070686_100025941 | 3300005544 | Bacteria | 3531 |
| 127 | Ga0070686_100402778 | 3300005544 | Bacteria | 1041 |
| 128 | Ga0070695_100018618 | 3300005545 | Bacteria | 4217 |
| 129 | Ga0070695_100108342 | 3300005545 | Bacteria | 1881 |
| 130 | Ga0070695_100112029 | 3300005545 | Bacteria | 1853 |
| 131 | Ga0070696_100028401 | 3300005546 | Bacteria | 3818 |
| 132 | Ga0070696_100156059 | 3300005546 | Bacteria | 1679 |
| 133 | Ga0070696_100393929 | 3300005546 | Bacteria | 1082 |
| 134 | Ga0070693_100045002 | 3300005547 | Bacteria | 2499 |
| 135 | Ga0070693_100216139 | 3300005547 | Bacteria | 1253 |
| 136 | Ga0070665_100072597 | 3300005548 | Bacteria | 3449 |
| 137 | Ga0070665_100248437 | 3300005548 | Bacteria | 1779 |
| 138 | Ga0070665_100397300 | 3300005548 | Bacteria | 1386 |
| 139 | Ga0070704_100018546 | 3300005549 | Bacteria | 4452 |
| 140 | Ga0070704_100158031 | 3300005549 | Bacteria | 1790 |
| 141 | Ga0070704_100209581 | 3300005549 | Bacteria | 1578 |
| 142 | Ga0070704_100226861 | 3300005549 | Bacteria | 1521 |
| 143 | Ga0068855_100017466 | 3300005563 | Bacteria | 8629 |
| 144 | Ga0068855_100043110 | 3300005563 | Bacteria | 5346 |
| 145 | Ga0070664_100000957 | 3300005564 | Bacteria | 22562 |
| 146 | Ga0070664_100083343 | 3300005564 | Bacteria | 2758 |
| 147 | Ga0070664_100121536 | 3300005564 | Bacteria | 2287 |
| 148 | Ga0068857_100021734 | 3300005577 | Bacteria | 5646 |
| 149 | Ga0068854_100003057 | 3300005578 | Bacteria | 10409 |
| 150 | Ga0068854_100003907 | 3300005578 | Bacteria | 9337 |
| 151 | Ga0068854_100032222 | 3300005578 | Bacteria | 3644 |
| 152 | Ga0068854_100122142 | 3300005578 | Bacteria | 1979 |
| 153 | Ga0070702_100018030 | 3300005615 | Bacteria | 3653 |
| 154 | Ga0070702_100023295 | 3300005615 | Bacteria | 3288 |
| 155 | Ga0070702_100102043 | 3300005615 | Bacteria | 1762 |
| 156 | Ga0068852_100000486 | 3300005616 | Bacteria | 25959 |
| 157 | Ga0068852_100001134 | 3300005616 | Bacteria | 17618 |
| 158 | Ga0068852_100014226 | 3300005616 | Bacteria | 6114 |
| 159 | Ga0068852_100019290 | 3300005616 | Bacteria | 5394 |
| 160 | Ga0068852_100084408 | 3300005616 | Bacteria | 2826 |
| 161 | Ga0068852_100193310 | 3300005616 | Bacteria | 1921 |
| 162 | Ga0068852_100195347 | 3300005616 | Bacteria | 1912 |
| 163 | Ga0068852_100294908 | 3300005616 | Bacteria | 1568 |
| 164 | Ga0068859_100007757 | 3300005617 | Bacteria | 10897 |
| 165 | Ga0068859_100056838 | 3300005617 | Bacteria | 3940 |
| 166 | Ga0068859_100060072 | 3300005617 | Bacteria | 3831 |
| 167 | Ga0068859_100144063 | 3300005617 | Bacteria | 2457 |
| 168 | Ga0068859_100149509 | 3300005617 | Bacteria | 2411 |
| 169 | Ga0068864_100002543 | 3300005618 | Bacteria | 15058 |
| 170 | Ga0068864_100007067 | 3300005618 | Bacteria | 9217 |
| 171 | Ga0068864_100019099 | 3300005618 | Bacteria | 5729 |
| 172 | Ga0068864_100020001 | 3300005618 | Bacteria | 5598 |
| 173 | Ga0068864_100270224 | 3300005618 | Bacteria | 1584 |
| 174 | Ga0068864_100275892 | 3300005618 | Bacteria | 1568 |
| 175 | Ga0068861_100132928 | 3300005719 | Bacteria | 2021 |
| 176 | Ga0068861_100281772 | 3300005719 | Bacteria | 1432 |
| 177 | Ga0068851_10003401 | 3300005834 | Bacteria | 7083 |
| 178 | Ga0068851_10012253 | 3300005834 | Bacteria | 4038 |
| 179 | Ga0068870_10025360 | 3300005840 | Bacteria | 2942 |
| 180 | Ga0068863_100004686 | 3300005841 | Bacteria | 13475 |
| 181 | Ga0068863_100031587 | 3300005841 | Bacteria | 5052 |
| 182 | Ga0068863_100138274 | 3300005841 | Bacteria | 2327 |
| 183 | Ga0068863_100338383 | 3300005841 | Bacteria | 1464 |
| 184 | Ga0068863_100438035 | 3300005841 | Bacteria | 1281 |
| 185 | Ga0068858_100011845 | 3300005842 | Bacteria | 8221 |
| 186 | Ga0068858_100026879 | 3300005842 | Bacteria | 5345 |
| 187 | Ga0068858_100080458 | 3300005842 | Bacteria | 3027 |
| 188 | Ga0068860_100070165 | 3300005843 | Bacteria | 3331 |
| 189 | Ga0068860_100134448 | 3300005843 | Bacteria | 2375 |
| 190 | Ga0068862_100004088 | 3300005844 | Bacteria | 12372 |
| 191 | Ga0068862_100084972 | 3300005844 | Bacteria | 2749 |
| 192 | Ga0070716_100113934 | 3300006173 | Bacteria | 1680 |
| 193 | Ga0070712_100020319 | 3300006175 | Bacteria | 4345 |
| 194 | Ga0075366_10007379 | 3300006195 | Bacteria | 6069 |
| 195 | Ga0097621_100000274 | 3300006237 | Bacteria | 34921 |
| 196 | Ga0097621_100010760 | 3300006237 | Bacteria | 6710 |
| 197 | Ga0097621_100043537 | 3300006237 | Bacteria | 3619 |
| 198 | Ga0097621_100051122 | 3300006237 | Bacteria | 3362 |
| 199 | Ga0097621_100059537 | 3300006237 | Bacteria | 3127 |
| 200 | Ga0097621_100166053 | 3300006237 | Bacteria | 1900 |
| 201 | Ga0097621_100173157 | 3300006237 | Bacteria | 1861 |
| 202 | Ga0075370_10059534 | 3300006353 | Bacteria | 2174 |
| 203 | Ga0068871_100000325 | 3300006358 | Bacteria | 33222 |
| 204 | Ga0068871_100009363 | 3300006358 | Bacteria | 7092 |
| 205 | Ga0068871_100015986 | 3300006358 | Bacteria | 5637 |
| 206 | Ga0068871_100067718 | 3300006358 | Bacteria | 2930 |
| 207 | Ga0068871_100176340 | 3300006358 | Bacteria | 1835 |
| 208 | Ga0068871_100247518 | 3300006358 | Bacteria | 1552 |
| 209 | Ga0068871_100272829 | 3300006358 | Bacteria | 1478 |
| 210 | Ga0068871_100306716 | 3300006358 | Bacteria | 1395 |
| 211 | Ga0075428_100001689 | 3300006844 | Bacteria | 23548 |
| 212 | Ga0075428_100011896 | 3300006844 | Bacteria | 9678 |
| 213 | Ga0075430_100005251 | 3300006846 | Bacteria | 10922 |
| 214 | Ga0075431_100008882 | 3300006847 | Bacteria | 10068 |
| 215 | Ga0075433_10012283 | 3300006852 | Bacteria | 6908 |
| 216 | Ga0075434_100073969 | 3300006871 | Bacteria | 3401 |
| 217 | Ga0075434_100206615 | 3300006871 | Bacteria | 1984 |
| 218 | Ga0075434_100635771 | 3300006871 | Bacteria | 1086 |
| 219 | Ga0068865_100070682 | 3300006881 | Bacteria | 2473 |
| 220 | Ga0068865_100084358 | 3300006881 | Bacteria | 2289 |
| 221 | Ga0075436_100039459 | 3300006914 | Bacteria | 3259 |
| 222 | Ga0075436_100070222 | 3300006914 | Bacteria | 2421 |
| 223 | Ga0097620_100007756 | 3300006931 | Bacteria | 10897 |
| 224 | Ga0097620_100056838 | 3300006931 | Bacteria | 3940 |
| 225 | Ga0097620_100060072 | 3300006931 | Bacteria | 3831 |
| 226 | Ga0097620_100144066 | 3300006931 | Bacteria | 2457 |
| 227 | Ga0097620_100149502 | 3300006931 | Bacteria | 2411 |
| 228 | Ga0075435_100027884 | 3300007076 | Bacteria | 4422 |
| 229 | Ga0099795_10036243 | 3300007788 | Bacteria | 1730 |
| 230 | Ga0105240_10006302 | 3300009093 | Bacteria | 17457 |
| 231 | Ga0105240_10032013 | 3300009093 | Bacteria | 6811 |
| 232 | Ga0105240_10043257 | 3300009093 | Bacteria | 5732 |
| 233 | Ga0105240_10089300 | 3300009093 | Bacteria | 3770 |
| 234 | Ga0105240_10103453 | 3300009093 | Bacteria | 3460 |
| 235 | Ga0111539_10000486 | 3300009094 | Bacteria | 50337 |
| 236 | Ga0111539_10001478 | 3300009094 | Bacteria | 31398 |
| 237 | Ga0111539_10009420 | 3300009094 | Bacteria | 12324 |
| 238 | Ga0111539_10009829 | 3300009094 | Bacteria | 12075 |
| 239 | Ga0111539_10116543 | 3300009094 | Bacteria | 3132 |
| 240 | Ga0105245_10174926 | 3300009098 | Bacteria | 2047 |
| 241 | Ga0105245_10178699 | 3300009098 | Bacteria | 2026 |
| 242 | Ga0105245_10328993 | 3300009098 | Bacteria | 1507 |
| 243 | Ga0105245_10538542 | 3300009098 | Bacteria | 1188 |
| 244 | Ga0105247_10050490 | 3300009101 | Bacteria | 2560 |
| 245 | Ga0105247_10079192 | 3300009101 | Bacteria | 2067 |
| 246 | Ga0105243_10136517 | 3300009148 | Bacteria | 2087 |
| 247 | Ga0105241_10397108 | 3300009174 | Bacteria | 1208 |
| 248 | Ga0105242_10014784 | 3300009176 | Bacteria | 6044 |
| 249 | Ga0105242_10071578 | 3300009176 | Bacteria | 2878 |
| 250 | Ga0105242_10203075 | 3300009176 | Bacteria | 1761 |
| 251 | Ga0105242_10350381 | 3300009176 | Bacteria | 1363 |
| 252 | Ga0105248_10006203 | 3300009177 | Bacteria | 13106 |
| 253 | Ga0105248_10016620 | 3300009177 | Bacteria | 8101 |
| 254 | Ga0105248_10036313 | 3300009177 | Bacteria | 5511 |
| 255 | Ga0105248_10048319 | 3300009177 | Bacteria | 4773 |
| 256 | Ga0105248_10063274 | 3300009177 | Bacteria | 4153 |
| 257 | Ga0105248_10277813 | 3300009177 | Bacteria | 1886 |
| 258 | Ga0105237_10049334 | 3300009545 | Bacteria | 4232 |
| 259 | Ga0105238_10037056 | 3300009551 | Bacteria | 4959 |
| 260 | Ga0105238_10054670 | 3300009551 | Bacteria | 4009 |
| 261 | Ga0105238_10140287 | 3300009551 | Bacteria | 2394 |
| 262 | Ga0105249_10065135 | 3300009553 | Bacteria | 3352 |
| 263 | Ga0105239_10015480 | 3300010375 | Bacteria | 8449 |
| 264 | Ga0105239_10098071 | 3300010375 | Bacteria | 3239 |
| 265 | Ga0105239_10594107 | 3300010375 | Bacteria | 1262 |
| 266 | Ga0105246_10069737 | 3300011119 | Bacteria | 2470 |
| 267 | Ga0105246_10237224 | 3300011119 | Bacteria | 1440 |
| 268 | Ga0157373_10047508 | 3300013100 | Bacteria | 3062 |
| 269 | Ga0157373_10112473 | 3300013100 | Bacteria | 1914 |
| 270 | Ga0157370_10016464 | 3300013104 | Bacteria | 7484 |
| 271 | Ga0157370_10041460 | 3300013104 | Bacteria | 4440 |
| 272 | Ga0157370_10099838 | 3300013104 | Bacteria | 2720 |
| 273 | Ga0157369_10132941 | 3300013105 | Bacteria | 2636 |
| 274 | Ga0157369_10155058 | 3300013105 | Bacteria | 2419 |
| 275 | Ga0157369_10334410 | 3300013105 | Bacteria | 1573 |
| 276 | Ga0157374_10001008 | 3300013296 | Bacteria | 24403 |
| 277 | Ga0157374_10002621 | 3300013296 | Bacteria | 15179 |
| 278 | Ga0157374_10010065 | 3300013296 | Bacteria | 8118 |
| 279 | Ga0157374_10018896 | 3300013296 | Bacteria | 6093 |
| 280 | Ga0157374_10077224 | 3300013296 | Bacteria | 3151 |
| 281 | Ga0157378_10015920 | 3300013297 | Bacteria | 6585 |
| 282 | Ga0157378_10087733 | 3300013297 | Bacteria | 2822 |
| 283 | Ga0157378_10117611 | 3300013297 | Bacteria | 2445 |
| 284 | Ga0163162_10008899 | 3300013306 | Bacteria | 9764 |
| 285 | Ga0163162_10010907 | 3300013306 | Bacteria | 8846 |
| 286 | Ga0163162_10020276 | 3300013306 | Bacteria | 6528 |
| 287 | Ga0163162_10074273 | 3300013306 | Bacteria | 3458 |
| 288 | Ga0163162_10108759 | 3300013306 | Bacteria | 2869 |
| 289 | Ga0163162_10302948 | 3300013306 | Bacteria | 1730 |
| 290 | Ga0163162_10528184 | 3300013306 | Bacteria | 1309 |
| 291 | Ga0163162_10891621 | 3300013306 | Bacteria | 1003 |
| 292 | Ga0157372_10042431 | 3300013307 | Bacteria | 5032 |
| 293 | Ga0157372_10157907 | 3300013307 | Bacteria | 2620 |
| 294 | Ga0157375_10018912 | 3300013308 | Bacteria | 6255 |
| 295 | Ga0157375_10021322 | 3300013308 | Bacteria | 5938 |
| 296 | Ga0163163_10002111 | 3300014325 | Bacteria | 16771 |
| 297 | Ga0163163_10051936 | 3300014325 | Bacteria | 4043 |
| 298 | Ga0163163_10539677 | 3300014325 | Bacteria | 1229 |
| 299 | Ga0157380_10237716 | 3300014326 | Bacteria | 1640 |
| 300 | Ga0157377_10005227 | 3300014745 | Bacteria | 6078 |
| 301 | Ga0157377_10009052 | 3300014745 | Bacteria | 4878 |
| 302 | Ga0157377_10101180 | 3300014745 | Bacteria | 1717 |
| 303 | Ga0157379_10001661 | 3300014968 | Bacteria | 18379 |
| 304 | Ga0157379_10014692 | 3300014968 | Bacteria | 6868 |
| 305 | Ga0157379_10062548 | 3300014968 | Bacteria | 3329 |
| 306 | Ga0157379_10065199 | 3300014968 | Bacteria | 3256 |
| 307 | Ga0157376_10005143 | 3300014969 | Bacteria | 9119 |
| 308 | Ga0157376_10006156 | 3300014969 | Bacteria | 8451 |
| 309 | Ga0157376_10013080 | 3300014969 | Bacteria | 6180 |
| 310 | Ga0157376_10040128 | 3300014969 | Bacteria | 3824 |
| 311 | Ga0157376_10041375 | 3300014969 | Bacteria | 3772 |
| 312 | Ga0157376_10045764 | 3300014969 | Bacteria | 3605 |
| 313 | Ga0157376_10148201 | 3300014969 | Bacteria | 2113 |
| 314 | Ga0157376_10390925 | 3300014969 | Bacteria | 1342 |
| 315 | Ga0163161_10045551 | 3300017792 | Bacteria | 3164 |
| 316 | Ga0163161_10052118 | 3300017792 | Bacteria | 2966 |
| 317 | Ga0213872_10016591 | 3300021361 | Bacteria | 3416 |
| 318 | Ga0213872_10078618 | 3300021361 | Bacteria | 1482 |
| 319 | Ga0213876_10050524 | 3300021384 | Bacteria | 2197 |
| 320 | Ga0209455_1001983 | 3300025272 | Bacteria | 8388 |
| 321 | Ga0207697_10030079 | 3300025315 | Bacteria | 2223 |
| 322 | Ga0207656_10012110 | 3300025321 | Bacteria | 3274 |
| 323 | Ga0207656_10147619 | 3300025321 | Bacteria | 1112 |
| 324 | Ga0207682_10001428 | 3300025893 | Bacteria | 11026 |
| 325 | Ga0207642_10001908 | 3300025899 | Bacteria | 6431 |
| 326 | Ga0207642_10202532 | 3300025899 | Bacteria | 1097 |
| 327 | Ga0207710_10029122 | 3300025900 | Bacteria | 2401 |
| 328 | Ga0207710_10042736 | 3300025900 | Bacteria | 2014 |
| 329 | Ga0207688_10013311 | 3300025901 | Bacteria | 4469 |
| 330 | Ga0207680_10002256 | 3300025903 | Bacteria | 8999 |
| 331 | Ga0207685_10038595 | 3300025905 | Bacteria | 1767 |
| 332 | Ga0207699_10024411 | 3300025906 | Bacteria | 3306 |
| 333 | Ga0207699_10116162 | 3300025906 | Bacteria | 1723 |
| 334 | Ga0207645_10016330 | 3300025907 | Bacteria | 4916 |
| 335 | Ga0207645_10030020 | 3300025907 | Bacteria | 3503 |
| 336 | Ga0207645_10041538 | 3300025907 | Bacteria | 2943 |
| 337 | Ga0207643_10030604 | 3300025908 | Bacteria | 2997 |
| 338 | Ga0207643_10069315 | 3300025908 | Bacteria | 2027 |
| 339 | Ga0207643_10124399 | 3300025908 | Bacteria | 1530 |
| 340 | Ga0207705_10002838 | 3300025909 | Bacteria | 13260 |
| 341 | Ga0207705_10003073 | 3300025909 | Bacteria | 12725 |
| 342 | Ga0207705_10039414 | 3300025909 | Bacteria | 3386 |
| 343 | Ga0207654_10053558 | 3300025911 | Bacteria | 2330 |
| 344 | Ga0207707_10069650 | 3300025912 | Bacteria | 3066 |
| 345 | Ga0207707_10134109 | 3300025912 | Bacteria | 2166 |
| 346 | Ga0207695_10003096 | 3300025913 | Bacteria | 23815 |
| 347 | Ga0207695_10117907 | 3300025913 | Bacteria | 2626 |
| 348 | Ga0207695_10260111 | 3300025913 | Bacteria | 1633 |
| 349 | Ga0207671_10437040 | 3300025914 | Bacteria | 1042 |
| 350 | Ga0207693_10000913 | 3300025915 | Bacteria | 26504 |
| 351 | Ga0207693_10005677 | 3300025915 | Bacteria | 10374 |
| 352 | Ga0207693_10079621 | 3300025915 | Bacteria | 2564 |
| 353 | Ga0207663_10001114 | 3300025916 | Bacteria | 12351 |
| 354 | Ga0207663_10031320 | 3300025916 | Bacteria | 3147 |
| 355 | Ga0207662_10007103 | 3300025918 | Bacteria | 6083 |
| 356 | Ga0207657_10002519 | 3300025919 | Bacteria | 19811 |
| 357 | Ga0207657_10055107 | 3300025919 | Bacteria | 3436 |
| 358 | Ga0207649_10001372 | 3300025920 | Bacteria | 14441 |
| 359 | Ga0207652_10003246 | 3300025921 | Bacteria | 13489 |
| 360 | Ga0207652_10025960 | 3300025921 | Bacteria | 4875 |
| 361 | Ga0207652_10369513 | 3300025921 | Bacteria | 1295 |
| 362 | Ga0207646_10067690 | 3300025922 | Bacteria | 3188 |
| 363 | Ga0207646_10164173 | 3300025922 | Bacteria | 2005 |
| 364 | Ga0207681_10034573 | 3300025923 | Bacteria | 3324 |
| 365 | Ga0207694_10012151 | 3300025924 | Bacteria | 6493 |
| 366 | Ga0207694_10096625 | 3300025924 | Bacteria | 2336 |
| 367 | Ga0207694_10129498 | 3300025924 | Bacteria | 2022 |
| 368 | Ga0207650_10000798 | 3300025925 | Bacteria | 24176 |
| 369 | Ga0207650_10024454 | 3300025925 | Bacteria | 4294 |
| 370 | Ga0207650_10116296 | 3300025925 | Bacteria | 2076 |
| 371 | Ga0207650_10221988 | 3300025925 | Bacteria | 1521 |
| 372 | Ga0207650_10375647 | 3300025925 | Bacteria | 1173 |
| 373 | Ga0207659_10001152 | 3300025926 | Bacteria | 15749 |
| 374 | Ga0207659_10031686 | 3300025926 | Bacteria | 3623 |
| 375 | Ga0207659_10038240 | 3300025926 | Bacteria | 3336 |
| 376 | Ga0207659_10147321 | 3300025926 | Bacteria | 1834 |
| 377 | Ga0207659_10220635 | 3300025926 | Bacteria | 1524 |
| 378 | Ga0207687_10055734 | 3300025927 | Bacteria | 2771 |
| 379 | Ga0207687_10098267 | 3300025927 | Bacteria | 2149 |
| 380 | Ga0207687_10215867 | 3300025927 | Bacteria | 1507 |
| 381 | Ga0207687_10243282 | 3300025927 | Bacteria | 1427 |
| 382 | Ga0207700_10021244 | 3300025928 | Bacteria | 4428 |
| 383 | Ga0207700_10156590 | 3300025928 | Bacteria | 1888 |
| 384 | Ga0207664_10007111 | 3300025929 | Bacteria | 7758 |
| 385 | Ga0207664_10055940 | 3300025929 | Bacteria | 3132 |
| 386 | Ga0207644_10000221 | 3300025931 | Bacteria | 39277 |
| 387 | Ga0207644_10014132 | 3300025931 | Bacteria | 5340 |
| 388 | Ga0207644_10208437 | 3300025931 | Bacteria | 1544 |
| 389 | Ga0207690_10071339 | 3300025932 | Bacteria | 2395 |
| 390 | Ga0207706_10010176 | 3300025933 | Bacteria | 8608 |
| 391 | Ga0207706_10038888 | 3300025933 | Bacteria | 4219 |
| 392 | Ga0207706_10038966 | 3300025933 | Bacteria | 4215 |
| 393 | Ga0207706_10062387 | 3300025933 | Bacteria | 3282 |
| 394 | Ga0207686_10000911 | 3300025934 | Bacteria | 17729 |
| 395 | Ga0207686_10025030 | 3300025934 | Bacteria | 3466 |
| 396 | Ga0207686_10064741 | 3300025934 | Unclassified | 2328 |
| 397 | Ga0207709_10031534 | 3300025935 | Bacteria | 3097 |
| 398 | Ga0207709_10038494 | 3300025935 | Bacteria | 2849 |
| 399 | Ga0207670_10117154 | 3300025936 | Bacteria | 1930 |
| 400 | Ga0207670_10130807 | 3300025936 | Bacteria | 1838 |
| 401 | Ga0207670_10143980 | 3300025936 | Bacteria | 1760 |
| 402 | Ga0207669_10015446 | 3300025937 | Bacteria | 3851 |
| 403 | Ga0207669_10122394 | 3300025937 | Bacteria | 1769 |
| 404 | Ga0207704_10079819 | 3300025938 | Bacteria | 2110 |
| 405 | Ga0207704_10284929 | 3300025938 | Bacteria | 1258 |
| 406 | Ga0207665_10006871 | 3300025939 | Bacteria | 7532 |
| 407 | Ga0207691_10000413 | 3300025940 | Bacteria | 42800 |
| 408 | Ga0207691_10002611 | 3300025940 | Bacteria | 17592 |
| 409 | Ga0207691_10040216 | 3300025940 | Bacteria | 4322 |
| 410 | Ga0207691_10066884 | 3300025940 | Bacteria | 3250 |
| 411 | Ga0207691_10099368 | 3300025940 | Bacteria | 2598 |
| 412 | Ga0207691_10161126 | 3300025940 | Bacteria | 1968 |
| 413 | Ga0207711_10002942 | 3300025941 | Bacteria | 14893 |
| 414 | Ga0207711_10003072 | 3300025941 | Bacteria | 14581 |
| 415 | Ga0207711_10211394 | 3300025941 | Bacteria | 1772 |
| 416 | Ga0207689_10000354 | 3300025942 | Bacteria | 42996 |
| 417 | Ga0207689_10006538 | 3300025942 | Bacteria | 10286 |
| 418 | Ga0207689_10022727 | 3300025942 | Bacteria | 5269 |
| 419 | Ga0207689_10278613 | 3300025942 | Bacteria | 1385 |
| 420 | Ga0207661_10010056 | 3300025944 | Bacteria | 6798 |
| 421 | Ga0207679_10004829 | 3300025945 | Bacteria | 8405 |
| 422 | Ga0207667_10004383 | 3300025949 | Bacteria | 17283 |
| 423 | Ga0207667_10017027 | 3300025949 | Bacteria | 8198 |
| 424 | Ga0207651_10000142 | 3300025960 | Bacteria | 31331 |
| 425 | Ga0207651_10000415 | 3300025960 | Bacteria | 18156 |
| 426 | Ga0207651_10111828 | 3300025960 | Bacteria | 2052 |
| 427 | Ga0207712_10193422 | 3300025961 | Bacteria | 1607 |
| 428 | Ga0207668_10020947 | 3300025972 | Bacteria | 4163 |
| 429 | Ga0207658_10064525 | 3300025986 | Bacteria | 2747 |
| 430 | Ga0207658_10159129 | 3300025986 | Bacteria | 1849 |
| 431 | Ga0207658_10238836 | 3300025986 | Bacteria | 1538 |
| 432 | Ga0207677_10000329 | 3300026023 | Bacteria | 34285 |
| 433 | Ga0207677_10002938 | 3300026023 | Bacteria | 9003 |
| 434 | Ga0207677_10023805 | 3300026023 | Bacteria | 3790 |
| 435 | Ga0207677_10032144 | 3300026023 | Bacteria | 3370 |
| 436 | Ga0207677_10044752 | 3300026023 | Bacteria | 2951 |
| 437 | Ga0207677_10121867 | 3300026023 | Bacteria | 1963 |
| 438 | Ga0207677_10289018 | 3300026023 | Bacteria | 1349 |
| 439 | Ga0207677_10365403 | 3300026023 | Bacteria | 1214 |
| 440 | Ga0207703_10000505 | 3300026035 | Bacteria | 40406 |
| 441 | Ga0207703_10000804 | 3300026035 | Bacteria | 30944 |
| 442 | Ga0207703_10010532 | 3300026035 | Bacteria | 7230 |
| 443 | Ga0207703_10020477 | 3300026035 | Bacteria | 5173 |
| 444 | Ga0207703_10085431 | 3300026035 | Bacteria | 2641 |
| 445 | Ga0207703_10552185 | 3300026035 | Bacteria | 1086 |
| 446 | Ga0207639_10181406 | 3300026041 | Bacteria | 1791 |
| 447 | Ga0207639_10281928 | 3300026041 | Bacteria | 1462 |
| 448 | Ga0207708_10004528 | 3300026075 | Bacteria | 10227 |
| 449 | Ga0207702_10087696 | 3300026078 | Bacteria | 2717 |
| 450 | Ga0207702_10590090 | 3300026078 | Bacteria | 1089 |
| 451 | Ga0207641_10012527 | 3300026088 | Bacteria | 6951 |
| 452 | Ga0207641_10056843 | 3300026088 | Bacteria | 3326 |
| 453 | Ga0207641_10063307 | 3300026088 | Bacteria | 3159 |
| 454 | Ga0207641_10079952 | 3300026088 | Bacteria | 2835 |
| 455 | Ga0207648_10004748 | 3300026089 | Bacteria | 13886 |
| 456 | Ga0207648_10051621 | 3300026089 | Bacteria | 3594 |
| 457 | Ga0207648_10066771 | 3300026089 | Bacteria | 3136 |
| 458 | Ga0207648_10107411 | 3300026089 | Bacteria | 2450 |
| 459 | Ga0207648_10223181 | 3300026089 | Bacteria | 1675 |
| 460 | Ga0207676_10000369 | 3300026095 | Bacteria | 38481 |
| 461 | Ga0207676_10010718 | 3300026095 | Bacteria | 6535 |
| 462 | Ga0207676_10058014 | 3300026095 | Bacteria | 3051 |
| 463 | Ga0207676_10216446 | 3300026095 | Bacteria | 1703 |
| 464 | Ga0207676_10222181 | 3300026095 | Bacteria | 1683 |
| 465 | Ga0207676_10390951 | 3300026095 | Bacteria | 1297 |
| 466 | Ga0207674_10016162 | 3300026116 | Bacteria | 8176 |
| 467 | Ga0207674_10032922 | 3300026116 | Bacteria | 5432 |
| 468 | Ga0207674_10106526 | 3300026116 | Bacteria | 2781 |
| 469 | Ga0207675_100003866 | 3300026118 | Bacteria | 14554 |
| 470 | Ga0207675_100065116 | 3300026118 | Bacteria | 3407 |
| 471 | Ga0207675_100087438 | 3300026118 | Bacteria | 2927 |
| 472 | Ga0207675_100110868 | 3300026118 | Bacteria | 2589 |
| 473 | Ga0207683_10000588 | 3300026121 | Bacteria | 33464 |
| 474 | Ga0207683_10048815 | 3300026121 | Bacteria | 3704 |
| 475 | Ga0207683_10051470 | 3300026121 | Bacteria | 3608 |
| 476 | Ga0207683_10087980 | 3300026121 | Bacteria | 2763 |
| 477 | Ga0207683_10097008 | 3300026121 | Bacteria | 2628 |
| 478 | Ga0207683_10107331 | 3300026121 | Bacteria | 2498 |
| 479 | Ga0207698_10000233 | 3300026142 | Bacteria | 34707 |
| 480 | Ga0207698_10018160 | 3300026142 | Bacteria | 4787 |
| 481 | Ga0207698_10034617 | 3300026142 | Bacteria | 3684 |
| 482 | Ga0207698_10168062 | 3300026142 | Bacteria | 1928 |
| 483 | Ga0209969_1000127 | 3300027360 | Bacteria | 9734 |
| 484 | Ga0209984_1006607 | 3300027424 | Bacteria | 1426 |
| 485 | Ga0209995_1000640 | 3300027471 | Bacteria | 5405 |
| 486 | Ga0209588_1033936 | 3300027671 | Bacteria | 1637 |
| 487 | Ga0209974_10001161 | 3300027876 | Bacteria | 9381 |
| 488 | Ga0209974_10009054 | 3300027876 | Bacteria | 3384 |
| 489 | Ga0207428_10002833 | 3300027907 | Bacteria | 17208 |
| 490 | Ga0207428_10008728 | 3300027907 | Bacteria | 9144 |
| 491 | Ga0207428_10013863 | 3300027907 | Bacteria | 7021 |
| 492 | Ga0207428_10070732 | 3300027907 | Bacteria | 2742 |
| 493 | Ga0207428_10092880 | 3300027907 | Bacteria | 2341 |
| 494 | Ga0207428_10148371 | 3300027907 | Bacteria | 1786 |
| 495 | Ga0268266_10272528 | 3300028379 | Bacteria | 1571 |
| 496 | Ga0268265_10004875 | 3300028380 | Bacteria | 9248 |
| 497 | Ga0268265_10262605 | 3300028380 | Bacteria | 1536 |
| 498 | Ga0268264_10000627 | 3300028381 | Bacteria | 42022 |
| 499 | Ga0268264_10004988 | 3300028381 | Bacteria | 11239 |
| 500 | Ga0268264_10107933 | 3300028381 | Bacteria | 2433 |
| 501 | Ga0265318_10009581 | 3300028577 | Bacteria | 4252 |
| 502 | Ga0265323_10013505 | 3300028653 | Bacteria | 3255 |
| 503 | Ga0265324_10000448 | 3300029957 | Bacteria | 29201 |
| 504 | Ga0265330_10001258 | 3300031235 | Bacteria | 14845 |
| 505 | Ga0265330_10012033 | 3300031235 | Bacteria | 4047 |
| 506 | Ga0265330_10087583 | 3300031235 | Bacteria | 1338 |
| 507 | Ga0265332_10000004 | 3300031238 | Bacteria | 426592 |
| 508 | Ga0265332_10001479 | 3300031238 | Bacteria | 13111 |
| 509 | Ga0265332_10082478 | 3300031238 | Bacteria | 1363 |
| 510 | Ga0265328_10000785 | 3300031239 | Bacteria | 14687 |
| 511 | Ga0265325_10015721 | 3300031241 | Bacteria | 4248 |
| 512 | Ga0265325_10016943 | 3300031241 | Bacteria | 4062 |
| 513 | Ga0265325_10086768 | 3300031241 | Bacteria | 1548 |
| 514 | Ga0265329_10001661 | 3300031242 | Bacteria | 10655 |
| 515 | Ga0265329_10008649 | 3300031242 | Bacteria | 3844 |
| 516 | Ga0265331_10000714 | 3300031250 | Bacteria | 28280 |
| 517 | Ga0265331_10001273 | 3300031250 | Bacteria | 18843 |
| 518 | Ga0265331_10024355 | 3300031250 | Bacteria | 3062 |
| 519 | Ga0265331_10028288 | 3300031250 | Bacteria | 2804 |
| 520 | Ga0265331_10030158 | 3300031250 | Bacteria | 2701 |
| 521 | Ga0265331_10101560 | 3300031250 | Bacteria | 1323 |
| 522 | Ga0265327_10000739 | 3300031251 | Bacteria | 51006 |
| 523 | Ga0265327_10002771 | 3300031251 | Bacteria | 17740 |
| 524 | Ga0265327_10109605 | 3300031251 | Bacteria | 1321 |
| 525 | Ga0265316_10018429 | 3300031344 | Bacteria | 5999 |
| 526 | Ga0265316_10034622 | 3300031344 | Bacteria | 4101 |
| 527 | Ga0265316_10086607 | 3300031344 | Bacteria | 2394 |
| 528 | Ga0265316_10138180 | 3300031344 | Bacteria | 1832 |
| 529 | Ga0265316_10336986 | 3300031344 | Bacteria | 1093 |
| 530 | Ga0307509_10000072 | 3300031507 | Bacteria | 140566 |
| 531 | Ga0307509_10340957 | 3300031507 | Unclassified | 1226 |
| 532 | Ga0307508_10012325 | 3300031616 | Bacteria | 7818 |
| 533 | Ga0316575_10000043 | 3300031665 | Bacteria | 31191 |
| 534 | Ga0265314_10000166 | 3300031711 | Bacteria | 99589 |
| 535 | Ga0265314_10091625 | 3300031711 | Bacteria | 1978 |
| 536 | Ga0265314_10165093 | 3300031711 | Bacteria | 1343 |
| 537 | Ga0316576_10151587 | 3300031727 | Bacteria | 1747 |
| 538 | Ga0307405_10008204 | 3300031731 | Bacteria | 5280 |
| 539 | Ga0307413_10039164 | 3300031824 | Bacteria | 2754 |
| 540 | Ga0307410_10039295 | 3300031852 | Bacteria | 3106 |
| 541 | Ga0307406_10012386 | 3300031901 | Bacteria | 4864 |
| 542 | Ga0307407_10005722 | 3300031903 | Bacteria | 5430 |
| 543 | Ga0307412_10002503 | 3300031911 | Bacteria | 10213 |
| 544 | Ga0307412_10088915 | 3300031911 | Bacteria | 2156 |
| 545 | Ga0307412_10335205 | 3300031911 | Bacteria | 1209 |
| 546 | Ga0307412_10487569 | 3300031911 | Bacteria | 1023 |
| 547 | Ga0307409_100002429 | 3300031995 | Bacteria | 9733 |
| 548 | Ga0307409_100328629 | 3300031995 | Bacteria | 1434 |
| 549 | Ga0307416_100005286 | 3300032002 | Bacteria | 7909 |
| 550 | Ga0307416_100052937 | 3300032002 | Bacteria | 3253 |
| 551 | Ga0307416_100241840 | 3300032002 | Bacteria | 1750 |
| 552 | Ga0307416_100277061 | 3300032002 | Bacteria | 1651 |
| 553 | Ga0307416_100380303 | 3300032002 | Bacteria | 1442 |
| 554 | Ga0307411_10031480 | 3300032005 | Bacteria | 3265 |
| 555 | Ga0307411_10280585 | 3300032005 | Bacteria | 1326 |
| 556 | Ga0307411_10437320 | 3300032005 | Bacteria | 1091 |
| 557 | Ga0307415_100003060 | 3300032126 | Bacteria | 8439 |
| 558 | Ga0307415_100125275 | 3300032126 | Bacteria | 1935 |
| 559 | Ga0373930_0020118 | 3300034816 | Bacteria | 1298 |
| 560 | Ga0373928_0004977 | 3300035084 | Bacteria | 2533 |
| 561 | Ga0373934_0000938 | 3300035086 | Bacteria | 10559 |
| 562 | Ga0373934_0001707 | 3300035086 | Bacteria | 8069 |
| 563 | Ga0373934_0042852 | 3300035086 | Bacteria | 1788 |
| 564 | Ga0373952_0000139 | 3300035092 | Bacteria | 10580 |
| 565 | Ga0373923_0004026 | 3300035111 | Bacteria | 4818 |
| 566 | Ga0373923_0040491 | 3300035111 | Bacteria | 1918 |
| 567 | Ga0373936_0011580 | 3300035113 | Bacteria | 3342 |
| 568 | Ga0373953_0033692 | 3300035117 | Bacteria | 2004 |
| 569 | Ga0373954_0001297 | 3300035118 | Bacteria | 10054 |
| 570 | Ga0373954_0003680 | 3300035118 | Bacteria | 6530 |
| 571 | Ga0373954_0007369 | 3300035118 | Bacteria | 4813 |
| 572 | Ga0373956_0000094 | 3300035119 | Bacteria | 29858 |
| 573 | Ga0373957_0001720 | 3300035120 | Bacteria | 6015 |
| 574 | Ga0373957_0005576 | 3300035120 | Bacteria | 3908 |
| 575 | Ga0373960_0025903 | 3300035121 | Bacteria | 1598 |
| 576 | Ga0373943_0029243 | 3300035170 | Bacteria | 2603 |
| 577 | Ga0373955_0003882 | 3300035172 | Bacteria | 6591 |
| 578 | Ga0373955_0031385 | 3300035172 | Bacteria | 2782 |
| 579 | Ga0373955_0041706 | 3300035172 | Bacteria | 2461 |
| 580 | Ga0373962_0020448 | 3300035242 | Bacteria | 1739 |
| 581 | Ga0373924_0001044 | 3300035410 | Bacteria | 8805 |
| 582 | Ga0373924_0034572 | 3300035410 | Bacteria | 2046 |
| 583 | Ga0373935_0061898 | 3300035692 | Bacteria | 2396 |
| 584 | Ga0373935_0075376 | 3300035692 | Bacteria | 2182 |
| 585 | Ga0373935_0100545 | 3300035692 | Bacteria | 1905 |
| 586 | Ga0373927_0028588 | 3300035695 | Bacteria | 3637 |
| 587 | Ga0373927_0030186 | 3300035695 | Bacteria | 3537 |
| 588 | Ga0373927_0262003 | 3300035695 | Bacteria | 1137 |
| 589 | Ga0373933_0000432 | 3300035724 | Bacteria | 26397 |
| 590 | Ga0373933_0091706 | 3300035724 | Bacteria | 1875 |
| 591 | Ga0373933_0115504 | 3300035724 | Bacteria | 1677 |
| 592 | Ga0373933_0401608 | 3300035724 | Bacteria | 894 |
| 593 | Ga0373947_0006348 | 3300035725 | Bacteria | 6871 |
| 594 | Ga0373947_0139285 | 3300035725 | Bacteria | 1555 |
| 595 | Ga0373937_0000255 | 3300036401 | Bacteria | 51770 |
| 596 | Ga0373937_0002035 | 3300036401 | Bacteria | 16886 |
| 597 | Ga0373937_0323700 | 3300036401 | Bacteria | 1459 |
| 598 | Ga0373925_0020083 | 3300037068 | Bacteria | 4861 |
| 599 | Ga0373925_0027214 | 3300037068 | Bacteria | 4187 |
| 600 | Ga0373925_0048045 | 3300037068 | Bacteria | 3178 |
| 601 | Ga0373925_0066275 | 3300037068 | Bacteria | 2722 |
| 602 | Ga0373925_0073651 | 3300037068 | Bacteria | 2585 |
| 603 | Ga0373925_0571939 | 3300037068 | Bacteria | 930 |
| 604 | Ga0395900_0019530 | 3300037418 | Bacteria | 6909 |
| 605 | Ga0395900_0121553 | 3300037418 | Bacteria | 2679 |
| 606 | Ga0395905_0005002 | 3300037471 | Bacteria | 13656 |
| 607 | Ga0395905_0381770 | 3300037471 | Bacteria | 1303 |
| 608 | Ga0436365_0249810 | 3300039437 | Bacteria | 2469 |
| 609 | Ga0436365_0619540 | 3300039437 | Bacteria | 2604 |
| 610 | Ga0436361_0562316 | 3300039447 | Bacteria | 3550 |
| 611 | Ga0436361_0613315 | 3300039447 | Bacteria | 1723 |
| 612 | Ga0451807_2326244 | 3300041486 | Bacteria | 1305 |
| 613 | Ga0451853_1720496 | 3300041512 | Bacteria | 2497 |
| 614 | Ga0451853_3251761 | 3300041512 | Bacteria | 1215 |
| 615 | Ga0439441_002369 | 3300042001 | Bacteria | 2649 |
| 616 | Ga0439435_0035526 | 3300042436 | Bacteria | 1374 |
| 617 | Ga0439435_0054433 | 3300042436 | Bacteria | 1152 |
| 618 | Ga0451577_0000013 | 3300042876 | Bacteria | 550689 |
| 619 | Ga0451577_0000519 | 3300042876 | Bacteria | 64350 |
| 620 | Ga0451577_0003649 | 3300042876 | Bacteria | 16882 |
| 621 | Ga0451577_0016075 | 3300042876 | Bacteria | 6941 |
| 622 | Ga0451577_0024692 | 3300042876 | Bacteria | 5464 |
| 623 | Ga0451577_0081617 | 3300042876 | Bacteria | 2884 |
| 624 | Ga0451577_0118530 | 3300042876 | Bacteria | 2371 |
| 625 | Ga0451577_0212806 | 3300042876 | Bacteria | 1746 |
| 626 | Ga0451577_0295745 | 3300042876 | Bacteria | 1467 |
| 627 | Ga0453683_0000033 | 3300044673 | Bacteria | 241479 |
| 628 | Ga0453683_0023695 | 3300044673 | Bacteria | 3911 |
| 629 | Ga0453683_0052160 | 3300044673 | Bacteria | 2561 |
| 630 | Ga0453683_0089631 | 3300044673 | Bacteria | 1928 |
| 631 | Ga0466966_0081878 | 3300044684 | Bacteria | 2009 |
| 632 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 633 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 634 | Ga0453684_0000085 | 3300044712 | Bacteria | 397817 |
| 635 | Ga0453684_0000114 | 3300044712 | Bacteria | 356610 |
| 636 | Ga0453684_0000296 | 3300044712 | Bacteria | 211075 |
| 637 | Ga0453684_0000623 | 3300044712 | Bacteria | 129254 |
| 638 | Ga0453684_0007483 | 3300044712 | Bacteria | 20045 |
| 639 | Ga0453684_0011178 | 3300044712 | Bacteria | 15114 |
| 640 | Ga0453684_0018530 | 3300044712 | Bacteria | 10675 |
| 641 | Ga0453684_0059341 | 3300044712 | Bacteria | 4933 |
| 642 | Ga0453684_0061324 | 3300044712 | Bacteria | 4828 |
| 643 | Ga0453684_0210474 | 3300044712 | Bacteria | 2260 |
| 644 | Ga0453684_0336014 | 3300044712 | Bacteria | 1707 |
| 645 | Ga0453684_0373437 | 3300044712 | Bacteria | 1603 |
| 646 | Ga0466957_0022668 | 3300044842 | Bacteria | 3706 |
| 647 | Ga0451576_0000018 | 3300045051 | Bacteria | 550689 |
| 648 | Ga0451576_0000166 | 3300045051 | Bacteria | 166647 |
| 649 | Ga0451576_0000761 | 3300045051 | Bacteria | 63684 |
| 650 | Ga0451576_0005878 | 3300045051 | Bacteria | 15242 |
| 651 | Ga0451576_0006357 | 3300045051 | Bacteria | 14505 |
| 652 | Ga0451576_0007439 | 3300045051 | Bacteria | 13087 |
| 653 | Ga0451576_0007667 | 3300045051 | Bacteria | 12830 |
| 654 | Ga0451576_0010951 | 3300045051 | Bacteria | 10363 |
| 655 | Ga0451576_0023472 | 3300045051 | Bacteria | 6678 |
| 656 | Ga0451576_0024433 | 3300045051 | Bacteria | 6527 |
| 657 | Ga0451576_0028815 | 3300045051 | Bacteria | 5946 |
| 658 | Ga0451576_0037277 | 3300045051 | Bacteria | 5151 |
| 659 | Ga0451576_0040275 | 3300045051 | Bacteria | 4947 |
| 660 | Ga0466958_0027553 | 3300045836 | Bacteria | 3363 |
| 661 | Ga0495592_0003670 | 3300046454 | Bacteria | 11055 |
| 662 | Ga0495592_0096393 | 3300046454 | Bacteria | 2114 |
| 663 | Ga0495592_0224618 | 3300046454 | Bacteria | 1253 |
| 664 | Ga0495641_0014558 | 3300046461 | Bacteria | 4249 |
| 665 | Ga0495651_0004185 | 3300046462 | Bacteria | 11050 |
| 666 | Ga0495651_0005023 | 3300046462 | Bacteria | 10108 |
| 667 | Ga0495651_0216682 | 3300046462 | Bacteria | 1328 |
| 668 | Ga0495653_0018287 | 3300046463 | Bacteria | 5695 |
| 669 | Ga0495653_0186830 | 3300046463 | Bacteria | 1417 |
| 670 | Ga0495580_0006751 | 3300046472 | Bacteria | 9310 |
| 671 | Ga0495580_0056713 | 3300046472 | Bacteria | 2758 |
| 672 | Ga0495580_0144689 | 3300046472 | Bacteria | 1647 |
| 673 | Ga0495582_0023520 | 3300046473 | Bacteria | 3371 |
| 674 | Ga0495582_0065749 | 3300046473 | Bacteria | 2003 |
| 675 | Ga0495639_0004383 | 3300046475 | Bacteria | 6048 |
| 676 | Ga0495662_0002793 | 3300046476 | Bacteria | 8827 |
| 677 | Ga0495662_0052939 | 3300046476 | Bacteria | 1960 |
| 678 | Ga0495664_0077716 | 3300046477 | Bacteria | 1988 |
| 679 | Ga0495606_0077236 | 3300046507 | Bacteria | 2079 |
| 680 | Ga0495608_0041909 | 3300046511 | Bacteria | 3062 |
| 681 | Ga0495608_0109322 | 3300046511 | Bacteria | 1778 |
| 682 | Ga0495628_0005544 | 3300046516 | Bacteria | 11049 |
| 683 | Ga0495628_0007978 | 3300046516 | Bacteria | 9124 |
| 684 | Ga0495628_0018540 | 3300046516 | Bacteria | 5762 |
| 685 | Ga0495628_0155463 | 3300046516 | Bacteria | 1740 |
| 686 | Ga0495630_0178326 | 3300046517 | Bacteria | 1620 |
| 687 | Ga0495663_0033232 | 3300046525 | Bacteria | 1540 |
| 688 | Ga0495666_0003327 | 3300046526 | Bacteria | 8117 |
| 689 | Ga0495642_0047329 | 3300046528 | Bacteria | 1761 |
| 690 | Ga0495642_0075718 | 3300046528 | Bacteria | 1412 |
| 691 | Ga0495652_0001765 | 3300046529 | Bacteria | 23187 |
| 692 | Ga0495652_0078644 | 3300046529 | Bacteria | 2729 |
| 693 | Ga0495586_0044906 | 3300046535 | Bacteria | 2380 |
| 694 | Ga0495587_0019634 | 3300046536 | Bacteria | 4180 |
| 695 | Ga0495587_0093234 | 3300046536 | Bacteria | 1739 |
| 696 | Ga0495598_0020872 | 3300046537 | Bacteria | 1735 |
| 697 | Ga0495598_0052575 | 3300046537 | Bacteria | 1231 |
| 698 | Ga0495609_0114537 | 3300046538 | Bacteria | 1162 |
| 699 | Ga0495621_0009589 | 3300046539 | Bacteria | 2945 |
| 700 | Ga0495621_0074352 | 3300046539 | Bacteria | 1257 |
| 701 | Ga0495645_0000566 | 3300046543 | Bacteria | 25312 |
| 702 | Ga0495645_0057531 | 3300046543 | Bacteria | 2821 |
| 703 | Ga0495645_0138739 | 3300046543 | Bacteria | 1698 |
| 704 | Ga0495622_0044842 | 3300046557 | Bacteria | 2055 |
| 705 | Ga0495667_0058629 | 3300046559 | Bacteria | 2529 |
| 706 | Ga0495667_0063205 | 3300046559 | Bacteria | 2424 |
| 707 | Ga0495635_0010206 | 3300046663 | Bacteria | 6566 |
| 708 | Ga0495635_0029976 | 3300046663 | Bacteria | 3782 |
| 709 | Ga0495635_0091773 | 3300046663 | Bacteria | 2077 |
| 710 | Ga0495659_0150139 | 3300046664 | Bacteria | 935 |
| 711 | Ga0495588_0091251 | 3300046674 | Bacteria | 1596 |
| 712 | Ga0495657_0007804 | 3300046675 | Bacteria | 8217 |
| 713 | Ga0495599_0000649 | 3300046678 | Bacteria | 19700 |
| 714 | Ga0495599_0001603 | 3300046678 | Bacteria | 13048 |
| 715 | Ga0495599_0007793 | 3300046678 | Bacteria | 6499 |
| 716 | Ga0495658_0076652 | 3300046683 | Bacteria | 1954 |
| 717 | Ga0495669_0013709 | 3300046684 | Bacteria | 3460 |
| 718 | Ga0495613_0009375 | 3300046689 | Bacteria | 7263 |
| 719 | Ga0495613_0043995 | 3300046689 | Bacteria | 3304 |
| 720 | Ga0495660_0063056 | 3300046810 | Bacteria | 1985 |
| 721 | Ga0495581_0000555 | 3300047315 | Bacteria | 19346 |
| 722 | Ga0495604_0141006 | 3300047317 | Bacteria | 1722 |
| 723 | Ga0495636_0071410 | 3300047318 | Bacteria | 1482 |
| 724 | Ga0495674_0025865 | 3300047319 | Bacteria | 5373 |
| 725 | Ga0495674_0363928 | 3300047319 | Bacteria | 1172 |
| 726 | Ga0495680_0294183 | 3300047322 | Bacteria | 1141 |
| 727 | Ga0495675_0007862 | 3300047444 | Bacteria | 6589 |
| 728 | Ga0495675_0122082 | 3300047444 | Bacteria | 1622 |
| 729 | Ga0495684_0014104 | 3300047471 | Bacteria | 6147 |
| 730 | Ga0495684_0055761 | 3300047471 | Bacteria | 3014 |
| 731 | Ga0495686_0059834 | 3300047472 | Bacteria | 2369 |
| 732 | Ga0495602_0184493 | 3300048088 | Bacteria | 1606 |
| 733 | Ga0495614_0019619 | 3300048089 | Bacteria | 2926 |
| 734 | Ga0496100_0079635 | 3300048903 | Bacteria | 2208 |
| 735 | Ga0496100_0152030 | 3300048903 | Bacteria | 1652 |
| 736 | Ga0496101_0173036 | 3300048904 | Bacteria | 1660 |
| 737 | Ga0496101_0221092 | 3300048904 | Bacteria | 1470 |
| 738 | Ga0496102_0322445 | 3300048905 | Bacteria | 1455 |
| 739 | Ga0496103_0078094 | 3300048906 | Bacteria | 2079 |
| 740 | Ga0496104_0001965 | 3300048907 | Bacteria | 17807 |
| 741 | Ga0496104_0012365 | 3300048907 | Bacteria | 7672 |
| 742 | Ga0496104_0241154 | 3300048907 | Bacteria | 1720 |
| 743 | Ga0496104_0554497 | 3300048907 | Bacteria | 1060 |
| 744 | Ga0496105_0005754 | 3300048908 | Bacteria | 9445 |
| 745 | Ga0496107_0160133 | 3300048910 | Bacteria | 1668 |
| 746 | Ga0496108_0005919 | 3300048911 | Bacteria | 9911 |
| 747 | Ga0496108_0027226 | 3300048911 | Bacteria | 4718 |
| 748 | Ga0496108_0309983 | 3300048911 | Bacteria | 1375 |
| 749 | Ga0496109_0012100 | 3300048912 | Bacteria | 7438 |
| 750 | Ga0496109_0063121 | 3300048912 | Bacteria | 3388 |
| 751 | Ga0496109_0141337 | 3300048912 | Bacteria | 2251 |
| 752 | Ga0496110_0002718 | 3300048913 | Bacteria | 13361 |
| 753 | Ga0496110_0265795 | 3300048913 | Bacteria | 1562 |
| 754 | Ga0496110_0795055 | 3300048913 | Bacteria | 850 |
| 755 | Ga0496112_0006687 | 3300048915 | Bacteria | 10152 |
| 756 | Ga0496112_0177882 | 3300048915 | Bacteria | 2092 |
| 757 | Ga0496113_0015267 | 3300048916 | Bacteria | 5273 |
| 758 | Ga0496114_0005749 | 3300048917 | Bacteria | 9734 |
| 759 | Ga0496114_0010696 | 3300048917 | Bacteria | 7302 |
| 760 | Ga0496114_0304428 | 3300048917 | Bacteria | 1407 |
| 761 | Ga0496115_0069557 | 3300048918 | Bacteria | 2852 |
| 762 | Ga0501031_0002174 | 3300049568 | Bacteria | 12379 |
| 763 | Ga0501031_0005161 | 3300049568 | Bacteria | 8510 |
| 764 | Ga0501031_0112465 | 3300049568 | Bacteria | 1778 |
| 765 | Ga0501031_0222448 | 3300049568 | Bacteria | 1229 |
| 766 | Ga0501032_0003661 | 3300049569 | Bacteria | 11685 |
| 767 | Ga0501033_0005554 | 3300049570 | Bacteria | 9970 |
| 768 | Ga0501033_0009133 | 3300049570 | Bacteria | 7644 |
| 769 | Ga0501033_0011745 | 3300049570 | Bacteria | 6697 |
| 770 | Ga0501034_0009146 | 3300049571 | Bacteria | 10397 |
| 771 | Ga0501036_0018327 | 3300049572 | Bacteria | 5862 |
| 772 | Ga0501036_0033402 | 3300049572 | Bacteria | 4351 |
| 773 | Ga0501036_0111332 | 3300049572 | Bacteria | 2313 |
| 774 | Ga0501037_0004141 | 3300049573 | Bacteria | 10525 |
| 775 | Ga0501037_0060307 | 3300049573 | Bacteria | 2767 |
| 776 | Ga0501038_0004863 | 3300049574 | Bacteria | 12478 |
| 777 | Ga0501038_0004918 | 3300049574 | Bacteria | 12410 |
| 778 | Ga0501038_0006265 | 3300049574 | Bacteria | 10997 |
| 779 | Ga0501038_0008709 | 3300049574 | Bacteria | 9313 |
| 780 | Ga0501038_0300304 | 3300049574 | Bacteria | 1260 |
| 781 | Ga0501038_0300943 | 3300049574 | Bacteria | 1259 |
| 782 | Ga0501038_0430038 | 3300049574 | Bacteria | 1017 |
| 783 | Ga0501039_0017522 | 3300049575 | Bacteria | 5494 |
| 784 | Ga0501040_0001889 | 3300049576 | Bacteria | 13451 |
| 785 | Ga0501041_0059554 | 3300049577 | Bacteria | 2337 |
| 786 | Ga0501042_0001673 | 3300049578 | Bacteria | 13219 |
| 787 | Ga0501043_0009685 | 3300049579 | Bacteria | 7550 |
| 788 | Ga0501043_0076663 | 3300049579 | Bacteria | 2627 |
| 789 | Ga0501043_0211778 | 3300049579 | Bacteria | 1502 |
| 790 | Ga0501043_0335646 | 3300049579 | Bacteria | 1150 |
| 791 | Ga0501046_0003282 | 3300049580 | Bacteria | 14859 |
| 792 | Ga0501046_0029693 | 3300049580 | Bacteria | 4444 |
| 793 | Ga0501047_0031198 | 3300049581 | Bacteria | 5140 |
| 794 | Ga0501047_0317882 | 3300049581 | Bacteria | 1397 |
| 795 | Ga0501048_0005615 | 3300049582 | Bacteria | 9540 |
| 796 | Ga0501068_0001418 | 3300049584 | Bacteria | 12736 |
| 797 | Ga0501071_0003792 | 3300049587 | Bacteria | 9499 |
| 798 | Ga0501072_0247656 | 3300049588 | Bacteria | 1419 |
| 799 | Ga0501075_0033905 | 3300049591 | Bacteria | 3799 |
| 800 | Ga0501075_0097371 | 3300049591 | Bacteria | 2233 |
| 801 | Ga0501076_0000441 | 3300049592 | Bacteria | 26293 |
| 802 | Ga0501080_0098834 | 3300049742 | Bacteria | 2708 |
| 803 | Ga0501081_0067272 | 3300049743 | Bacteria | 2493 |
| 804 | Ga0501035_0003875 | 3300049822 | Bacteria | 14276 |
| 805 | Ga0501035_0011429 | 3300049822 | Bacteria | 8231 |
| 806 | Ga0501035_0013582 | 3300049822 | Bacteria | 7514 |
| 807 | Ga0501035_0018997 | 3300049822 | Bacteria | 6327 |
| 808 | Ga0501035_0024993 | 3300049822 | Bacteria | 5477 |
| 809 | Ga0501035_0333918 | 3300049822 | Bacteria | 1271 |
| 810 | Ga0501035_0544842 | 3300049822 | Bacteria | 951 |
| 811 | Ga0501044_0000126 | 3300049823 | Bacteria | 92879 |
| 812 | Ga0501044_0006304 | 3300049823 | Bacteria | 13112 |
| 813 | Ga0501044_0007300 | 3300049823 | Bacteria | 12143 |
| 814 | Ga0501044_0059187 | 3300049823 | Bacteria | 3926 |
| 815 | Ga0501044_0155656 | 3300049823 | Bacteria | 2265 |
| 816 | Ga0501045_0123264 | 3300049824 | Bacteria | 1924 |
| 817 | Ga0501045_0149589 | 3300049824 | Bacteria | 1737 |
| 818 | nmdc:mga07m45_114720_c1 | 3300050496 | Bacteria | 1553 |
| 819 | nmdc:mga09592_56284_c1 | 3300050508 | Bacteria | 3323 |
| 820 | nmdc:mga0qj67_73707_c1 | 3300050509 | Bacteria | 2727 |
| 821 | nmdc:mga06r32_24270_c1 | 3300050510 | Bacteria | 5624 |
| 822 | nmdc:mga08y16_16326_c1 | 3300050511 | Bacteria | 7806 |
| 823 | nmdc:mga08y16_252870_c1 | 3300050511 | Bacteria | 1821 |
| 824 | nmdc:mga08y16_31378_c1 | 3300050511 | Bacteria | 5588 |
| 825 | nmdc:mga08y16_45483_c1 | 3300050511 | Bacteria | 4599 |
| 826 | nmdc:mga08y16_6277_c1 | 3300050511 | Bacteria | 12462 |
| 827 | nmdc:mga08y16_769809_c1 | 3300050511 | Bacteria | 957 |
| 828 | nmdc:mga08y16_78634_c1 | 3300050511 | Bacteria | 3438 |
| 829 | nmdc:mga0n895_159861_c1 | 3300050512 | Bacteria | 2284 |
| 830 | nmdc:mga0n895_521502_c1 | 3300050512 | Bacteria | 1196 |
| 831 | nmdc:mga0n895_540903_c1 | 3300050512 | Bacteria | 1171 |
| 832 | nmdc:mga0n895_9412_c1 | 3300050512 | Bacteria | 8547 |
| 833 | nmdc:mga0rr50_377283_c1 | 3300050513 | Bacteria | 1195 |
| 834 | nmdc:mga0rr50_83470_c1 | 3300050513 | Bacteria | 2470 |
| 835 | nmdc:mga08x19_4020_c1 | 3300050514 | Bacteria | 8752 |
| 836 | nmdc:mga08x19_45541_c1 | 3300050514 | Bacteria | 2803 |
| 837 | nmdc:mga08x19_62148_c1 | 3300050514 | Bacteria | 2421 |
| 838 | nmdc:mga0a205_23653_c2 | 3300050515 | Bacteria | 5110 |
| 839 | nmdc:mga0a205_284100_c1 | 3300050515 | Bacteria | 1530 |
| 840 | Ga0495601_0002848 | 3300053077 | Bacteria | 9825 |
| 841 | Ga0495601_0060165 | 3300053077 | Bacteria | 2410 |
| 842 | Ga0495601_0080004 | 3300053077 | Bacteria | 2096 |
| 843 | Ga0495601_0117921 | 3300053077 | Bacteria | 1722 |
| 844 | Ga0495612_0009151 | 3300053078 | Bacteria | 4019 |
| 845 | Ga0495595_0001451 | 3300053084 | Bacteria | 9250 |
| 846 | Ga0495619_0006417 | 3300053085 | Bacteria | 7452 |
| 847 | Ga0495619_0020619 | 3300053085 | Bacteria | 4201 |
| 848 | Ga0500607_016555 | 3300053121 | Bacteria | 4225 |
| 849 | Ga0500636_0000064 | 3300053177 | Bacteria | 51986 |
| 850 | Ga0500637_0031332 | 3300053178 | Bacteria | 2962 |
| 851 | Ga0530510_0087246 | 3300061734 | Bacteria | 2274 |
| 852 | 2526212271 | 2526164512 | Bacteria | 4025691 |
| 853 | 2548849317 | 2547132512 | Bacteria | 3416496 |
| 854 | 2843692431 | 2843690924 | Bacteria | 5169057 |
| 855 | 2846042365 | 2846037992 | Bacteria | 4526407 |
| 856 | 2857561933 | 2857558681 | Bacteria | 6617694 |
| 857 | 2904429565 | 2904424332 | Bacteria | 7633521 |
| 858 | 2998347647 | 2998344455 | Bacteria | 4222996 |
| 859 | Ga0501034_0004775 | |||
| 860 | Ga0055529_1001152 | |||
| 861 | Ga0065712_10078545 | |||
| 862 | Ga0070658_10006078 | |||
| 863 | Ga0070658_10014263 | |||
| 864 | Ga0070658_10292253 | |||
| 865 | Ga0070676_10083905 | |||
| 866 | Ga0070683_100001788 | |||
| 867 | Ga0070683_100086367 | |||
| 868 | Ga0070683_100408010 | |||
| 869 | Ga0070690_100004680 | |||
| 870 | Ga0070690_100021086 | |||
| 871 | Ga0070690_100047414 | |||
| 872 | Ga0070670_100000732 | |||
| 873 | Ga0070670_100019332 | |||
| 874 | Ga0070670_100025573 | |||
| 875 | Ga0070670_100328728 | |||
| 876 | Ga0070677_10057910 | |||
| 877 | Ga0068869_100005486 | |||
| 878 | Ga0068869_100075504 | |||
| 879 | Ga0068869_100076604 | |||
| 880 | Ga0070666_10020043 | |||
| 881 | Ga0070680_100077278 | |||
| 882 | Ga0070682_100012218 | |||
| 883 | Ga0068868_100000144 | |||
| 884 | Ga0068868_100009584 | |||
| 885 | Ga0068868_100036103 | |||
| 886 | Ga0068868_100061532 | |||
| 887 | Ga0070660_100124427 | |||
| 888 | Ga0070689_100003377 | |||
| 889 | Ga0070689_100034210 | |||
| 890 | Ga0070689_100146638 | |||
| 891 | Ga0070689_100178636 | |||
| 892 | Ga0070691_10014877 | |||
| 893 | Ga0070687_100025518 | |||
| 894 | Ga0070687_100069063 | |||
| 895 | Ga0070687_100115196 | |||
| 896 | Ga0070661_100000601 | |||
| 897 | Ga0070661_100019649 | |||
| 898 | Ga0070692_10060371 | |||
| 899 | Ga0070668_100001724 | |||
| 900 | Ga0070668_100068947 | |||
| 901 | Ga0070668_100119513 | |||
| 902 | Ga0070669_100011126 | |||
| 903 | Ga0070675_100003810 | |||
| 904 | Ga0070675_100026322 | |||
| 905 | Ga0070675_100121920 | |||
| 906 | Ga0070671_100001156 | |||
| 907 | Ga0070671_100018208 | |||
| 908 | Ga0070671_100368300 | |||
| 909 | Ga0070674_100029925 | |||
| 910 | Ga0070674_100067969 | |||
| 911 | Ga0070673_100001260 | |||
| 912 | Ga0070673_100001686 | |||
| 913 | Ga0070673_100008218 | |||
| 914 | Ga0070673_100037390 | |||
| 915 | Ga0070688_100000431 | |||
| 916 | Ga0070688_100106161 | |||
| 917 | Ga0070659_100074768 | |||
| 918 | Ga0070667_100032338 | |||
| 919 | Ga0070667_100182385 | |||
| 920 | Ga0070703_10018923 | |||
| 921 | Ga0070703_10044178 | |||
| 922 | Ga0070709_10057937 | |||
| 923 | Ga0070709_10112717 | |||
| 924 | Ga0070709_10201226 | |||
| 925 | Ga0070714_100015547 | |||
| 926 | Ga0070714_100050194 | |||
| 927 | Ga0070714_100238897 | |||
| 928 | Ga0070714_100264979 | |||
| 929 | Ga0070713_100002492 | |||
| 930 | Ga0070713_100087771 | |||
| 931 | Ga0070701_10094082 | |||
| 932 | Ga0070711_100002587 | |||
| 933 | Ga0070705_100025920 | |||
| 934 | Ga0070705_100173673 | |||
| 935 | Ga0070700_100056967 | |||
| 936 | Ga0070700_100185410 | |||
| 937 | Ga0070700_100255082 | |||
| 938 | Ga0070700_100380031 | |||
| 939 | Ga0070694_100053962 | |||
| 940 | Ga0070708_100020748 | |||
| 941 | Ga0070663_100207376 | |||
| 942 | Ga0070663_100238042 | |||
| 943 | Ga0070678_100000019 | |||
| 944 | Ga0070678_100079745 | |||
| 945 | Ga0070678_100092645 | |||
| 946 | Ga0070678_100196457 | |||
| 947 | Ga0070662_100044204 | |||
| 948 | Ga0070662_100138785 | |||
| 949 | Ga0070681_10006660 | |||
| 950 | Ga0070681_10075482 | |||
| 951 | Ga0068867_100007906 | |||
| 952 | Ga0068867_100026778 | |||
| 953 | Ga0068867_100142867 | |||
| 954 | Ga0070685_10000733 | |||
| 955 | Ga0070685_10048220 | |||
| 956 | Ga0070685_10136900 | |||
| 957 | Ga0070706_100028196 | |||
| 958 | Ga0070706_100037830 | |||
| 959 | Ga0070706_100091409 | |||
| 960 | Ga0070707_100012077 | |||
| 961 | Ga0070707_100034979 | |||
| 962 | Ga0070707_100145097 | |||
| 963 | Ga0070698_100175897 | |||
| 964 | Ga0070699_100006062 | |||
| 965 | Ga0070699_100050568 | |||
| 966 | Ga0070699_100071219 | |||
| 967 | Ga0070679_100010085 | |||
| 968 | Ga0070679_100015526 | |||
| 969 | Ga0070679_100092317 | |||
| 970 | Ga0070679_100509638 | |||
| 971 | Ga0070684_100034952 | |||
| 972 | Ga0070684_100057055 | |||
| 973 | Ga0070684_100117514 | |||
| 974 | Ga0070697_100030915 | |||
| 975 | Ga0070697_100036887 | |||
| 976 | Ga0068853_100074850 | |||
| 977 | Ga0068853_100105607 | |||
| 978 | Ga0068853_100116004 | |||
| 979 | Ga0070672_100000151 | |||
| 980 | Ga0070672_100028153 | |||
| 981 | Ga0070672_100054868 | |||
| 982 | Ga0070672_100154670 | |||
| 983 | Ga0070672_100207337 | |||
| 984 | Ga0070686_100025941 | |||
| 985 | Ga0070686_100402778 | |||
| 986 | Ga0070695_100018618 | |||
| 987 | Ga0070695_100108342 | |||
| 988 | Ga0070695_100112029 | |||
| 989 | Ga0070696_100028401 | |||
| 990 | Ga0070696_100156059 | |||
| 991 | Ga0070696_100393929 | |||
| 992 | Ga0070693_100045002 | |||
| 993 | Ga0070693_100216139 | |||
| 994 | Ga0070665_100072597 | |||
| 995 | Ga0070665_100248437 | |||
| 996 | Ga0070665_100397300 | |||
| 997 | Ga0070704_100018546 | |||
| 998 | Ga0070704_100158031 | |||
| 999 | Ga0070704_100209581 | |||
| 1000 | Ga0070704_100226861 | |||
| 1001 | Ga0068855_100017466 | |||
| 1002 | Ga0068855_100043110 | |||
| 1003 | Ga0070664_100000957 | |||
| 1004 | Ga0070664_100083343 | |||
| 1005 | Ga0070664_100121536 | |||
| 1006 | Ga0068857_100021734 | |||
| 1007 | Ga0068854_100003057 | |||
| 1008 | Ga0068854_100003907 | |||
| 1009 | Ga0068854_100032222 | |||
| 1010 | Ga0068854_100122142 | |||
| 1011 | Ga0070702_100018030 | |||
| 1012 | Ga0070702_100023295 | |||
| 1013 | Ga0070702_100102043 | |||
| 1014 | Ga0068852_100000486 | |||
| 1015 | Ga0068852_100001134 | |||
| 1016 | Ga0068852_100014226 | |||
| 1017 | Ga0068852_100019290 | |||
| 1018 | Ga0068852_100084408 | |||
| 1019 | Ga0068852_100193310 | |||
| 1020 | Ga0068852_100195347 | |||
| 1021 | Ga0068852_100294908 | |||
| 1022 | Ga0068859_100007757 | |||
| 1023 | Ga0068859_100056838 | |||
| 1024 | Ga0068859_100060072 | |||
| 1025 | Ga0068859_100144063 | |||
| 1026 | Ga0068859_100149509 | |||
| 1027 | Ga0068864_100002543 | |||
| 1028 | Ga0068864_100007067 | |||
| 1029 | Ga0068864_100019099 | |||
| 1030 | Ga0068864_100020001 | |||
| 1031 | Ga0068864_100270224 | |||
| 1032 | Ga0068864_100275892 | |||
| 1033 | Ga0068861_100132928 | |||
| 1034 | Ga0068861_100281772 | |||
| 1035 | Ga0068851_10003401 | |||
| 1036 | Ga0068851_10012253 | |||
| 1037 | Ga0068870_10025360 | |||
| 1038 | Ga0068863_100004686 | |||
| 1039 | Ga0068863_100031587 | |||
| 1040 | Ga0068863_100138274 | |||
| 1041 | Ga0068863_100338383 | |||
| 1042 | Ga0068863_100438035 | |||
| 1043 | Ga0068858_100011845 | |||
| 1044 | Ga0068858_100026879 | |||
| 1045 | Ga0068858_100080458 | |||
| 1046 | Ga0068860_100070165 | |||
| 1047 | Ga0068860_100134448 | |||
| 1048 | Ga0068862_100004088 | |||
| 1049 | Ga0068862_100084972 | |||
| 1050 | Ga0070716_100113934 | |||
| 1051 | Ga0070712_100020319 | |||
| 1052 | Ga0075366_10007379 | |||
| 1053 | Ga0097621_100000274 | |||
| 1054 | Ga0097621_100010760 | |||
| 1055 | Ga0097621_100043537 | |||
| 1056 | Ga0097621_100051122 | |||
| 1057 | Ga0097621_100059537 | |||
| 1058 | Ga0097621_100166053 | |||
| 1059 | Ga0097621_100173157 | |||
| 1060 | Ga0075370_10059534 | |||
| 1061 | Ga0068871_100000325 | |||
| 1062 | Ga0068871_100009363 | |||
| 1063 | Ga0068871_100015986 | |||
| 1064 | Ga0068871_100067718 | |||
| 1065 | Ga0068871_100176340 | |||
| 1066 | Ga0068871_100247518 | |||
| 1067 | Ga0068871_100272829 | |||
| 1068 | Ga0068871_100306716 | |||
| 1069 | Ga0075428_100001689 | |||
| 1070 | Ga0075428_100011896 | |||
| 1071 | Ga0075430_100005251 | |||
| 1072 | Ga0075431_100008882 | |||
| 1073 | Ga0075433_10012283 | |||
| 1074 | Ga0075434_100073969 | |||
| 1075 | Ga0075434_100206615 | |||
| 1076 | Ga0075434_100635771 | |||
| 1077 | Ga0068865_100070682 | |||
| 1078 | Ga0068865_100084358 | |||
| 1079 | Ga0075436_100039459 | |||
| 1080 | Ga0075436_100070222 | |||
| 1081 | Ga0097620_100007756 | |||
| 1082 | Ga0097620_100056838 | |||
| 1083 | Ga0097620_100060072 | |||
| 1084 | Ga0097620_100144066 | |||
| 1085 | Ga0097620_100149502 | |||
| 1086 | Ga0075435_100027884 | |||
| 1087 | Ga0099795_10036243 | |||
| 1088 | Ga0105240_10006302 | |||
| 1089 | Ga0105240_10032013 | |||
| 1090 | Ga0105240_10043257 | |||
| 1091 | Ga0105240_10089300 | |||
| 1092 | Ga0105240_10103453 | |||
| 1093 | Ga0111539_10000486 | |||
| 1094 | Ga0111539_10001478 | |||
| 1095 | Ga0111539_10009420 | |||
| 1096 | Ga0111539_10009829 | |||
| 1097 | Ga0111539_10116543 | |||
| 1098 | Ga0105245_10174926 | |||
| 1099 | Ga0105245_10178699 | |||
| 1100 | Ga0105245_10328993 | |||
| 1101 | Ga0105245_10538542 | |||
| 1102 | Ga0105247_10050490 | |||
| 1103 | Ga0105247_10079192 | |||
| 1104 | Ga0105243_10136517 | |||
| 1105 | Ga0105241_10397108 | |||
| 1106 | Ga0105242_10014784 | |||
| 1107 | Ga0105242_10071578 | |||
| 1108 | Ga0105242_10203075 | |||
| 1109 | Ga0105242_10350381 | |||
| 1110 | Ga0105248_10006203 | |||
| 1111 | Ga0105248_10016620 | |||
| 1112 | Ga0105248_10036313 | |||
| 1113 | Ga0105248_10048319 | |||
| 1114 | Ga0105248_10063274 | |||
| 1115 | Ga0105248_10277813 | |||
| 1116 | Ga0105237_10049334 | |||
| 1117 | Ga0105238_10037056 | |||
| 1118 | Ga0105238_10054670 | |||
| 1119 | Ga0105238_10140287 | |||
| 1120 | Ga0105249_10065135 | |||
| 1121 | Ga0105239_10015480 | |||
| 1122 | Ga0105239_10098071 | |||
| 1123 | Ga0105239_10594107 | |||
| 1124 | Ga0105246_10069737 | |||
| 1125 | Ga0105246_10237224 | |||
| 1126 | Ga0157373_10047508 | |||
| 1127 | Ga0157373_10112473 | |||
| 1128 | Ga0157370_10016464 | |||
| 1129 | Ga0157370_10041460 | |||
| 1130 | Ga0157370_10099838 | |||
| 1131 | Ga0157369_10132941 | |||
| 1132 | Ga0157369_10155058 | |||
| 1133 | Ga0157369_10334410 | |||
| 1134 | Ga0157374_10001008 | |||
| 1135 | Ga0157374_10002621 | |||
| 1136 | Ga0157374_10010065 | |||
| 1137 | Ga0157374_10018896 | |||
| 1138 | Ga0157374_10077224 | |||
| 1139 | Ga0157378_10015920 | |||
| 1140 | Ga0157378_10087733 | |||
| 1141 | Ga0157378_10117611 | |||
| 1142 | Ga0163162_10008899 | |||
| 1143 | Ga0163162_10010907 | |||
| 1144 | Ga0163162_10020276 | |||
| 1145 | Ga0163162_10074273 | |||
| 1146 | Ga0163162_10108759 | |||
| 1147 | Ga0163162_10302948 | |||
| 1148 | Ga0163162_10528184 | |||
| 1149 | Ga0163162_10891621 | |||
| 1150 | Ga0157372_10042431 | |||
| 1151 | Ga0157372_10157907 | |||
| 1152 | Ga0157375_10018912 | |||
| 1153 | Ga0157375_10021322 | |||
| 1154 | Ga0163163_10002111 | |||
| 1155 | Ga0163163_10051936 | |||
| 1156 | Ga0163163_10539677 | |||
| 1157 | Ga0157380_10237716 | |||
| 1158 | Ga0157377_10005227 | |||
| 1159 | Ga0157377_10009052 | |||
| 1160 | Ga0157377_10101180 | |||
| 1161 | Ga0157379_10001661 | |||
| 1162 | Ga0157379_10014692 | |||
| 1163 | Ga0157379_10062548 | |||
| 1164 | Ga0157379_10065199 | |||
| 1165 | Ga0157376_10005143 | |||
| 1166 | Ga0157376_10006156 | |||
| 1167 | Ga0157376_10013080 | |||
| 1168 | Ga0157376_10040128 | |||
| 1169 | Ga0157376_10041375 | |||
| 1170 | Ga0157376_10045764 | |||
| 1171 | Ga0157376_10148201 | |||
| 1172 | Ga0157376_10390925 | |||
| 1173 | Ga0163161_10045551 | |||
| 1174 | Ga0163161_10052118 | |||
| 1175 | Ga0213872_10016591 | |||
| 1176 | Ga0213872_10078618 | |||
| 1177 | Ga0213876_10050524 | |||
| 1178 | Ga0209455_1001983 | |||
| 1179 | Ga0207697_10030079 | |||
| 1180 | Ga0207656_10012110 | |||
| 1181 | Ga0207656_10147619 | |||
| 1182 | Ga0207682_10001428 | |||
| 1183 | Ga0207642_10001908 | |||
| 1184 | Ga0207642_10202532 | |||
| 1185 | Ga0207710_10029122 | |||
| 1186 | Ga0207710_10042736 | |||
| 1187 | Ga0207688_10013311 | |||
| 1188 | Ga0207680_10002256 | |||
| 1189 | Ga0207685_10038595 | |||
| 1190 | Ga0207699_10024411 | |||
| 1191 | Ga0207699_10116162 | |||
| 1192 | Ga0207645_10016330 | |||
| 1193 | Ga0207645_10030020 | |||
| 1194 | Ga0207645_10041538 | |||
| 1195 | Ga0207643_10030604 | |||
| 1196 | Ga0207643_10069315 | |||
| 1197 | Ga0207643_10124399 | |||
| 1198 | Ga0207705_10002838 | |||
| 1199 | Ga0207705_10003073 | |||
| 1200 | Ga0207705_10039414 | |||
| 1201 | Ga0207654_10053558 | |||
| 1202 | Ga0207707_10069650 | |||
| 1203 | Ga0207707_10134109 | |||
| 1204 | Ga0207695_10003096 | |||
| 1205 | Ga0207695_10117907 | |||
| 1206 | Ga0207695_10260111 | |||
| 1207 | Ga0207671_10437040 | |||
| 1208 | Ga0207693_10000913 | |||
| 1209 | Ga0207693_10005677 | |||
| 1210 | Ga0207693_10079621 | |||
| 1211 | Ga0207663_10001114 | |||
| 1212 | Ga0207663_10031320 | |||
| 1213 | Ga0207662_10007103 | |||
| 1214 | Ga0207657_10002519 | |||
| 1215 | Ga0207657_10055107 | |||
| 1216 | Ga0207649_10001372 | |||
| 1217 | Ga0207652_10003246 | |||
| 1218 | Ga0207652_10025960 | |||
| 1219 | Ga0207652_10369513 | |||
| 1220 | Ga0207646_10067690 | |||
| 1221 | Ga0207646_10164173 | |||
| 1222 | Ga0207681_10034573 | |||
| 1223 | Ga0207694_10012151 | |||
| 1224 | Ga0207694_10096625 | |||
| 1225 | Ga0207694_10129498 | |||
| 1226 | Ga0207650_10000798 | |||
| 1227 | Ga0207650_10024454 | |||
| 1228 | Ga0207650_10116296 | |||
| 1229 | Ga0207650_10221988 | |||
| 1230 | Ga0207650_10375647 | |||
| 1231 | Ga0207659_10001152 | |||
| 1232 | Ga0207659_10031686 | |||
| 1233 | Ga0207659_10038240 | |||
| 1234 | Ga0207659_10147321 | |||
| 1235 | Ga0207659_10220635 | |||
| 1236 | Ga0207687_10055734 | |||
| 1237 | Ga0207687_10098267 | |||
| 1238 | Ga0207687_10215867 | |||
| 1239 | Ga0207687_10243282 | |||
| 1240 | Ga0207700_10021244 | |||
| 1241 | Ga0207700_10156590 | |||
| 1242 | Ga0207664_10007111 | |||
| 1243 | Ga0207664_10055940 | |||
| 1244 | Ga0207644_10000221 | |||
| 1245 | Ga0207644_10014132 | |||
| 1246 | Ga0207644_10208437 | |||
| 1247 | Ga0207690_10071339 | |||
| 1248 | Ga0207706_10010176 | |||
| 1249 | Ga0207706_10038888 | |||
| 1250 | Ga0207706_10038966 | |||
| 1251 | Ga0207706_10062387 | |||
| 1252 | Ga0207686_10000911 | |||
| 1253 | Ga0207686_10025030 | |||
| 1254 | Ga0207686_10064741 | |||
| 1255 | Ga0207709_10031534 | |||
| 1256 | Ga0207709_10038494 | |||
| 1257 | Ga0207670_10117154 | |||
| 1258 | Ga0207670_10130807 | |||
| 1259 | Ga0207670_10143980 | |||
| 1260 | Ga0207669_10015446 | |||
| 1261 | Ga0207669_10122394 | |||
| 1262 | Ga0207704_10079819 | |||
| 1263 | Ga0207704_10284929 | |||
| 1264 | Ga0207665_10006871 | |||
| 1265 | Ga0207691_10000413 | |||
| 1266 | Ga0207691_10002611 | |||
| 1267 | Ga0207691_10040216 | |||
| 1268 | Ga0207691_10066884 | |||
| 1269 | Ga0207691_10099368 | |||
| 1270 | Ga0207691_10161126 | |||
| 1271 | Ga0207711_10002942 | |||
| 1272 | Ga0207711_10003072 | |||
| 1273 | Ga0207711_10211394 | |||
| 1274 | Ga0207689_10000354 | |||
| 1275 | Ga0207689_10006538 | |||
| 1276 | Ga0207689_10022727 | |||
| 1277 | Ga0207689_10278613 | |||
| 1278 | Ga0207661_10010056 | |||
| 1279 | Ga0207679_10004829 | |||
| 1280 | Ga0207667_10004383 | |||
| 1281 | Ga0207667_10017027 | |||
| 1282 | Ga0207651_10000142 | |||
| 1283 | Ga0207651_10000415 | |||
| 1284 | Ga0207651_10111828 | |||
| 1285 | Ga0207712_10193422 | |||
| 1286 | Ga0207668_10020947 | |||
| 1287 | Ga0207658_10064525 | |||
| 1288 | Ga0207658_10159129 | |||
| 1289 | Ga0207658_10238836 | |||
| 1290 | Ga0207677_10000329 | |||
| 1291 | Ga0207677_10002938 | |||
| 1292 | Ga0207677_10023805 | |||
| 1293 | Ga0207677_10032144 | |||
| 1294 | Ga0207677_10044752 | |||
| 1295 | Ga0207677_10121867 | |||
| 1296 | Ga0207677_10289018 | |||
| 1297 | Ga0207677_10365403 | |||
| 1298 | Ga0207703_10000505 | |||
| 1299 | Ga0207703_10000804 | |||
| 1300 | Ga0207703_10010532 | |||
| 1301 | Ga0207703_10020477 | |||
| 1302 | Ga0207703_10085431 | |||
| 1303 | Ga0207703_10552185 | |||
| 1304 | Ga0207639_10181406 | |||
| 1305 | Ga0207639_10281928 | |||
| 1306 | Ga0207708_10004528 | |||
| 1307 | Ga0207702_10087696 | |||
| 1308 | Ga0207702_10590090 | |||
| 1309 | Ga0207641_10012527 | |||
| 1310 | Ga0207641_10056843 | |||
| 1311 | Ga0207641_10063307 | |||
| 1312 | Ga0207641_10079952 | |||
| 1313 | Ga0207648_10004748 | |||
| 1314 | Ga0207648_10051621 | |||
| 1315 | Ga0207648_10066771 | |||
| 1316 | Ga0207648_10107411 | |||
| 1317 | Ga0207648_10223181 | |||
| 1318 | Ga0207676_10000369 | |||
| 1319 | Ga0207676_10010718 | |||
| 1320 | Ga0207676_10058014 | |||
| 1321 | Ga0207676_10216446 | |||
| 1322 | Ga0207676_10222181 | |||
| 1323 | Ga0207676_10390951 | |||
| 1324 | Ga0207674_10016162 | |||
| 1325 | Ga0207674_10032922 | |||
| 1326 | Ga0207674_10106526 | |||
| 1327 | Ga0207675_100003866 | |||
| 1328 | Ga0207675_100065116 | |||
| 1329 | Ga0207675_100087438 | |||
| 1330 | Ga0207675_100110868 | |||
| 1331 | Ga0207683_10000588 | |||
| 1332 | Ga0207683_10048815 | |||
| 1333 | Ga0207683_10051470 | |||
| 1334 | Ga0207683_10087980 | |||
| 1335 | Ga0207683_10097008 | |||
| 1336 | Ga0207683_10107331 | |||
| 1337 | Ga0207698_10000233 | |||
| 1338 | Ga0207698_10018160 | |||
| 1339 | Ga0207698_10034617 | |||
| 1340 | Ga0207698_10168062 | |||
| 1341 | Ga0209969_1000127 | |||
| 1342 | Ga0209984_1006607 | |||
| 1343 | Ga0209995_1000640 | |||
| 1344 | Ga0209588_1033936 | |||
| 1345 | Ga0209974_10001161 | |||
| 1346 | Ga0209974_10009054 | |||
| 1347 | Ga0207428_10002833 | |||
| 1348 | Ga0207428_10008728 | |||
| 1349 | Ga0207428_10013863 | |||
| 1350 | Ga0207428_10070732 | |||
| 1351 | Ga0207428_10092880 | |||
| 1352 | Ga0207428_10148371 | |||
| 1353 | Ga0268266_10272528 | |||
| 1354 | Ga0268265_10004875 | |||
| 1355 | Ga0268265_10262605 | |||
| 1356 | Ga0268264_10000627 | |||
| 1357 | Ga0268264_10004988 | |||
| 1358 | Ga0268264_10107933 | |||
| 1359 | Ga0265318_10009581 | |||
| 1360 | Ga0265323_10013505 | |||
| 1361 | Ga0265324_10000448 | |||
| 1362 | Ga0265330_10001258 | |||
| 1363 | Ga0265330_10012033 | |||
| 1364 | Ga0265330_10087583 | |||
| 1365 | Ga0265332_10000004 | |||
| 1366 | Ga0265332_10001479 | |||
| 1367 | Ga0265332_10082478 | |||
| 1368 | Ga0265328_10000785 | |||
| 1369 | Ga0265325_10015721 | |||
| 1370 | Ga0265325_10016943 | |||
| 1371 | Ga0265325_10086768 | |||
| 1372 | Ga0265329_10001661 | |||
| 1373 | Ga0265329_10008649 | |||
| 1374 | Ga0265331_10000714 | |||
| 1375 | Ga0265331_10001273 | |||
| 1376 | Ga0265331_10024355 | |||
| 1377 | Ga0265331_10028288 | |||
| 1378 | Ga0265331_10030158 | |||
| 1379 | Ga0265331_10101560 | |||
| 1380 | Ga0265327_10000739 | |||
| 1381 | Ga0265327_10002771 | |||
| 1382 | Ga0265327_10109605 | |||
| 1383 | Ga0265316_10018429 | |||
| 1384 | Ga0265316_10034622 | |||
| 1385 | Ga0265316_10086607 | |||
| 1386 | Ga0265316_10138180 | |||
| 1387 | Ga0265316_10336986 | |||
| 1388 | Ga0307509_10000072 | |||
| 1389 | Ga0307509_10340957 | |||
| 1390 | Ga0307508_10012325 | |||
| 1391 | Ga0316575_10000043 | |||
| 1392 | Ga0265314_10000166 | |||
| 1393 | Ga0265314_10091625 | |||
| 1394 | Ga0265314_10165093 | |||
| 1395 | Ga0316576_10151587 | |||
| 1396 | Ga0307405_10008204 | |||
| 1397 | Ga0307413_10039164 | |||
| 1398 | Ga0307410_10039295 | |||
| 1399 | Ga0307406_10012386 | |||
| 1400 | Ga0307407_10005722 | |||
| 1401 | Ga0307412_10002503 | |||
| 1402 | Ga0307412_10088915 | |||
| 1403 | Ga0307412_10335205 | |||
| 1404 | Ga0307412_10487569 | |||
| 1405 | Ga0307409_100002429 | |||
| 1406 | Ga0307409_100328629 | |||
| 1407 | Ga0307416_100005286 | |||
| 1408 | Ga0307416_100052937 | |||
| 1409 | Ga0307416_100241840 | |||
| 1410 | Ga0307416_100277061 | |||
| 1411 | Ga0307416_100380303 | |||
| 1412 | Ga0307411_10031480 | |||
| 1413 | Ga0307411_10280585 | |||
| 1414 | Ga0307411_10437320 | |||
| 1415 | Ga0307415_100003060 | |||
| 1416 | Ga0307415_100125275 | |||
| 1417 | Ga0373930_0020118 | |||
| 1418 | Ga0373928_0004977 | |||
| 1419 | Ga0373934_0000938 | |||
| 1420 | Ga0373934_0001707 | |||
| 1421 | Ga0373934_0042852 | |||
| 1422 | Ga0373952_0000139 | |||
| 1423 | Ga0373923_0004026 | |||
| 1424 | Ga0373923_0040491 | |||
| 1425 | Ga0373936_0011580 | |||
| 1426 | Ga0373953_0033692 | |||
| 1427 | Ga0373954_0001297 | |||
| 1428 | Ga0373954_0003680 | |||
| 1429 | Ga0373954_0007369 | |||
| 1430 | Ga0373956_0000094 | |||
| 1431 | Ga0373957_0001720 | |||
| 1432 | Ga0373957_0005576 | |||
| 1433 | Ga0373960_0025903 | |||
| 1434 | Ga0373943_0029243 | |||
| 1435 | Ga0373955_0003882 | |||
| 1436 | Ga0373955_0031385 | |||
| 1437 | Ga0373955_0041706 | |||
| 1438 | Ga0373962_0020448 | |||
| 1439 | Ga0373924_0001044 | |||
| 1440 | Ga0373924_0034572 | |||
| 1441 | Ga0373935_0061898 | |||
| 1442 | Ga0373935_0075376 | |||
| 1443 | Ga0373935_0100545 | |||
| 1444 | Ga0373927_0028588 | |||
| 1445 | Ga0373927_0030186 | |||
| 1446 | Ga0373927_0262003 | |||
| 1447 | Ga0373933_0000432 | |||
| 1448 | Ga0373933_0091706 | |||
| 1449 | Ga0373933_0115504 | |||
| 1450 | Ga0373933_0401608 | |||
| 1451 | Ga0373947_0006348 | |||
| 1452 | Ga0373947_0139285 | |||
| 1453 | Ga0373937_0000255 | |||
| 1454 | Ga0373937_0002035 | |||
| 1455 | Ga0373937_0323700 | |||
| 1456 | Ga0373925_0020083 | |||
| 1457 | Ga0373925_0027214 | |||
| 1458 | Ga0373925_0048045 | |||
| 1459 | Ga0373925_0066275 | |||
| 1460 | Ga0373925_0073651 | |||
| 1461 | Ga0373925_0571939 | |||
| 1462 | Ga0395900_0019530 | |||
| 1463 | Ga0395900_0121553 | |||
| 1464 | Ga0395905_0005002 | |||
| 1465 | Ga0395905_0381770 | |||
| 1466 | Ga0436365_0249810 | |||
| 1467 | Ga0436365_0619540 | |||
| 1468 | Ga0436361_0562316 | |||
| 1469 | Ga0436361_0613315 | |||
| 1470 | Ga0451807_2326244 | |||
| 1471 | Ga0451853_1720496 | |||
| 1472 | Ga0451853_3251761 | |||
| 1473 | Ga0439441_002369 | |||
| 1474 | Ga0439435_0035526 | |||
| 1475 | Ga0439435_0054433 | |||
| 1476 | Ga0451577_0000013 | |||
| 1477 | Ga0451577_0000519 | |||
| 1478 | Ga0451577_0003649 | |||
| 1479 | Ga0451577_0016075 | |||
| 1480 | Ga0451577_0024692 | |||
| 1481 | Ga0451577_0081617 | |||
| 1482 | Ga0451577_0118530 | |||
| 1483 | Ga0451577_0212806 | |||
| 1484 | Ga0451577_0295745 | |||
| 1485 | Ga0453683_0000033 | |||
| 1486 | Ga0453683_0023695 | |||
| 1487 | Ga0453683_0052160 | |||
| 1488 | Ga0453683_0089631 | |||
| 1489 | Ga0466966_0081878 | |||
| 1490 | Ga0453684_0000005 | |||
| 1491 | Ga0453684_0000040 | |||
| 1492 | Ga0453684_0000085 | |||
| 1493 | Ga0453684_0000114 | |||
| 1494 | Ga0453684_0000296 | |||
| 1495 | Ga0453684_0000623 | |||
| 1496 | Ga0453684_0007483 | |||
| 1497 | Ga0453684_0011178 | |||
| 1498 | Ga0453684_0018530 | |||
| 1499 | Ga0453684_0059341 | |||
| 1500 | Ga0453684_0061324 | |||
| 1501 | Ga0453684_0210474 | |||
| 1502 | Ga0453684_0336014 | |||
| 1503 | Ga0453684_0373437 | |||
| 1504 | Ga0466957_0022668 | |||
| 1505 | Ga0451576_0000018 | |||
| 1506 | Ga0451576_0000166 | |||
| 1507 | Ga0451576_0000761 | |||
| 1508 | Ga0451576_0005878 | |||
| 1509 | Ga0451576_0006357 | |||
| 1510 | Ga0451576_0007439 | |||
| 1511 | Ga0451576_0007667 | |||
| 1512 | Ga0451576_0010951 | |||
| 1513 | Ga0451576_0023472 | |||
| 1514 | Ga0451576_0024433 | |||
| 1515 | Ga0451576_0028815 | |||
| 1516 | Ga0451576_0037277 | |||
| 1517 | Ga0451576_0040275 | |||
| 1518 | Ga0466958_0027553 | |||
| 1519 | Ga0495592_0003670 | |||
| 1520 | Ga0495592_0096393 | |||
| 1521 | Ga0495592_0224618 | |||
| 1522 | Ga0495641_0014558 | |||
| 1523 | Ga0495651_0004185 | |||
| 1524 | Ga0495651_0005023 | |||
| 1525 | Ga0495651_0216682 | |||
| 1526 | Ga0495653_0018287 | |||
| 1527 | Ga0495653_0186830 | |||
| 1528 | Ga0495580_0006751 | |||
| 1529 | Ga0495580_0056713 | |||
| 1530 | Ga0495580_0144689 | |||
| 1531 | Ga0495582_0023520 | |||
| 1532 | Ga0495582_0065749 | |||
| 1533 | Ga0495639_0004383 | |||
| 1534 | Ga0495662_0002793 | |||
| 1535 | Ga0495662_0052939 | |||
| 1536 | Ga0495664_0077716 | |||
| 1537 | Ga0495606_0077236 | |||
| 1538 | Ga0495608_0041909 | |||
| 1539 | Ga0495608_0109322 | |||
| 1540 | Ga0495628_0005544 | |||
| 1541 | Ga0495628_0007978 | |||
| 1542 | Ga0495628_0018540 | |||
| 1543 | Ga0495628_0155463 | |||
| 1544 | Ga0495630_0178326 | |||
| 1545 | Ga0495663_0033232 | |||
| 1546 | Ga0495666_0003327 | |||
| 1547 | Ga0495642_0047329 | |||
| 1548 | Ga0495642_0075718 | |||
| 1549 | Ga0495652_0001765 | |||
| 1550 | Ga0495652_0078644 | |||
| 1551 | Ga0495586_0044906 | |||
| 1552 | Ga0495587_0019634 | |||
| 1553 | Ga0495587_0093234 | |||
| 1554 | Ga0495598_0020872 | |||
| 1555 | Ga0495598_0052575 | |||
| 1556 | Ga0495609_0114537 | |||
| 1557 | Ga0495621_0009589 | |||
| 1558 | Ga0495621_0074352 | |||
| 1559 | Ga0495645_0000566 | |||
| 1560 | Ga0495645_0057531 | |||
| 1561 | Ga0495645_0138739 | |||
| 1562 | Ga0495622_0044842 | |||
| 1563 | Ga0495667_0058629 | |||
| 1564 | Ga0495667_0063205 | |||
| 1565 | Ga0495635_0010206 | |||
| 1566 | Ga0495635_0029976 | |||
| 1567 | Ga0495635_0091773 | |||
| 1568 | Ga0495659_0150139 | |||
| 1569 | Ga0495588_0091251 | |||
| 1570 | Ga0495657_0007804 | |||
| 1571 | Ga0495599_0000649 | |||
| 1572 | Ga0495599_0001603 | |||
| 1573 | Ga0495599_0007793 | |||
| 1574 | Ga0495658_0076652 | |||
| 1575 | Ga0495669_0013709 | |||
| 1576 | Ga0495613_0009375 | |||
| 1577 | Ga0495613_0043995 | |||
| 1578 | Ga0495660_0063056 | |||
| 1579 | Ga0495581_0000555 | |||
| 1580 | Ga0495604_0141006 | |||
| 1581 | Ga0495636_0071410 | |||
| 1582 | Ga0495674_0025865 | |||
| 1583 | Ga0495674_0363928 | |||
| 1584 | Ga0495680_0294183 | |||
| 1585 | Ga0495675_0007862 | |||
| 1586 | Ga0495675_0122082 | |||
| 1587 | Ga0495684_0014104 | |||
| 1588 | Ga0495684_0055761 | |||
| 1589 | Ga0495686_0059834 | |||
| 1590 | Ga0495602_0184493 | |||
| 1591 | Ga0495614_0019619 | |||
| 1592 | Ga0496100_0079635 | |||
| 1593 | Ga0496100_0152030 | |||
| 1594 | Ga0496101_0173036 | |||
| 1595 | Ga0496101_0221092 | |||
| 1596 | Ga0496102_0322445 | |||
| 1597 | Ga0496103_0078094 | |||
| 1598 | Ga0496104_0001965 | |||
| 1599 | Ga0496104_0012365 | |||
| 1600 | Ga0496104_0241154 | |||
| 1601 | Ga0496104_0554497 | |||
| 1602 | Ga0496105_0005754 | |||
| 1603 | Ga0496107_0160133 | |||
| 1604 | Ga0496108_0005919 | |||
| 1605 | Ga0496108_0027226 | |||
| 1606 | Ga0496108_0309983 | |||
| 1607 | Ga0496109_0012100 | |||
| 1608 | Ga0496109_0063121 | |||
| 1609 | Ga0496109_0141337 | |||
| 1610 | Ga0496110_0002718 | |||
| 1611 | Ga0496110_0265795 | |||
| 1612 | Ga0496110_0795055 | |||
| 1613 | Ga0496112_0006687 | |||
| 1614 | Ga0496112_0177882 | |||
| 1615 | Ga0496113_0015267 | |||
| 1616 | Ga0496114_0005749 | |||
| 1617 | Ga0496114_0010696 | |||
| 1618 | Ga0496114_0304428 | |||
| 1619 | Ga0496115_0069557 | |||
| 1620 | Ga0501031_0002174 | |||
| 1621 | Ga0501031_0005161 | |||
| 1622 | Ga0501031_0112465 | |||
| 1623 | Ga0501031_0222448 | |||
| 1624 | Ga0501032_0003661 | |||
| 1625 | Ga0501033_0005554 | |||
| 1626 | Ga0501033_0009133 | |||
| 1627 | Ga0501033_0011745 | |||
| 1628 | Ga0501034_0009146 | |||
| 1629 | Ga0501036_0018327 | |||
| 1630 | Ga0501036_0033402 | |||
| 1631 | Ga0501036_0111332 | |||
| 1632 | Ga0501037_0004141 | |||
| 1633 | Ga0501037_0060307 | |||
| 1634 | Ga0501038_0004863 | |||
| 1635 | Ga0501038_0004918 | |||
| 1636 | Ga0501038_0006265 | |||
| 1637 | Ga0501038_0008709 | |||
| 1638 | Ga0501038_0300304 | |||
| 1639 | Ga0501038_0300943 | |||
| 1640 | Ga0501038_0430038 | |||
| 1641 | Ga0501039_0017522 | |||
| 1642 | Ga0501040_0001889 | |||
| 1643 | Ga0501041_0059554 | |||
| 1644 | Ga0501042_0001673 | |||
| 1645 | Ga0501043_0009685 | |||
| 1646 | Ga0501043_0076663 | |||
| 1647 | Ga0501043_0211778 | |||
| 1648 | Ga0501043_0335646 | |||
| 1649 | Ga0501046_0003282 | |||
| 1650 | Ga0501046_0029693 | |||
| 1651 | Ga0501047_0031198 | |||
| 1652 | Ga0501047_0317882 | |||
| 1653 | Ga0501048_0005615 | |||
| 1654 | Ga0501068_0001418 | |||
| 1655 | Ga0501071_0003792 | |||
| 1656 | Ga0501072_0247656 | |||
| 1657 | Ga0501075_0033905 | |||
| 1658 | Ga0501075_0097371 | |||
| 1659 | Ga0501076_0000441 | |||
| 1660 | Ga0501080_0098834 | |||
| 1661 | Ga0501081_0067272 | |||
| 1662 | Ga0501035_0003875 | |||
| 1663 | Ga0501035_0011429 | |||
| 1664 | Ga0501035_0013582 | |||
| 1665 | Ga0501035_0018997 | |||
| 1666 | Ga0501035_0024993 | |||
| 1667 | Ga0501035_0333918 | |||
| 1668 | Ga0501035_0544842 | |||
| 1669 | Ga0501044_0000126 | |||
| 1670 | Ga0501044_0006304 | |||
| 1671 | Ga0501044_0007300 | |||
| 1672 | Ga0501044_0059187 | |||
| 1673 | Ga0501044_0155656 | |||
| 1674 | Ga0501045_0123264 | |||
| 1675 | Ga0501045_0149589 | |||
| 1676 | nmdc:mga07m45_114720_c1 | |||
| 1677 | nmdc:mga09592_56284_c1 | |||
| 1678 | nmdc:mga0qj67_73707_c1 | |||
| 1679 | nmdc:mga06r32_24270_c1 | |||
| 1680 | nmdc:mga08y16_16326_c1 | |||
| 1681 | nmdc:mga08y16_252870_c1 | |||
| 1682 | nmdc:mga08y16_31378_c1 | |||
| 1683 | nmdc:mga08y16_45483_c1 | |||
| 1684 | nmdc:mga08y16_6277_c1 | |||
| 1685 | nmdc:mga08y16_769809_c1 | |||
| 1686 | nmdc:mga08y16_78634_c1 | |||
| 1687 | nmdc:mga0n895_159861_c1 | |||
| 1688 | nmdc:mga0n895_521502_c1 | |||
| 1689 | nmdc:mga0n895_540903_c1 | |||
| 1690 | nmdc:mga0n895_9412_c1 | |||
| 1691 | nmdc:mga0rr50_377283_c1 | |||
| 1692 | nmdc:mga0rr50_83470_c1 | |||
| 1693 | nmdc:mga08x19_4020_c1 | |||
| 1694 | nmdc:mga08x19_45541_c1 | |||
| 1695 | nmdc:mga08x19_62148_c1 | |||
| 1696 | nmdc:mga0a205_23653_c2 | |||
| 1697 | nmdc:mga0a205_284100_c1 | |||
| 1698 | Ga0495601_0002848 | |||
| 1699 | Ga0495601_0060165 | |||
| 1700 | Ga0495601_0080004 | |||
| 1701 | Ga0495601_0117921 | |||
| 1702 | Ga0495612_0009151 | |||
| 1703 | Ga0495595_0001451 | |||
| 1704 | Ga0495619_0006417 | |||
| 1705 | Ga0495619_0020619 | |||
| 1706 | Ga0500607_016555 | |||
| 1707 | Ga0500636_0000064 | |||
| 1708 | Ga0500637_0031332 | |||
| 1709 | Ga0530510_0087246 | |||
| 1710 | 2526212271 | |||
| 1711 | 2548849317 | |||
| 1712 | 2843692431 | |||
| 1713 | 2846042365 | |||
| 1714 | 2857561933 | |||
| 1715 | 2904429565 | |||
| 1716 | 2998347647 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lbj-assembly1.cif.gz_B | crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia | 0.9723 | 12 | 306 |
| 7lbj-assembly1.cif.gz_B | crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia | 0.9619 | 12 | 306 |
| 7lbj-assembly1.cif.gz_A | crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia | 0.9607 | 10 | 306 |
| 7my7-assembly2.cif.gz_CCC | se-crte n-term his-tag structure | 0.9579 | 12 | 230 |
| 7lbj-assembly1.cif.gz_A | crystal structure of octaprenyl diphosphate synthase from stenotrophomonas maltophilia | 0.9573 | 10 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5aypA00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9521 | 12 | 304 | 1.10.600.10 |
| 3zcdA00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9435 | 13 | 304 | 1.10.600.10 |
| 5aypA00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9413 | 12 | 304 | 1.10.600.10 |
| 4kkmB00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9377 | 13 | 301 | 1.10.600.10 |
| af_A0A0P0V0B7_118_416_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9326 | 9 | 306 | 1.10.600.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3E0MXZ8-F1-model_v4 | Polyprenyl synthetase family protein | 0.989 | 119 | 306 |
GO:0004659
GO:0008299 |
| AF-A0A353NCF4-F1-model_v4 | Farnesyl-diphosphate synthase | 0.9887 | 86 | 306 |
GO:0004659
GO:0005737 GO:0008299 |
| AF-A0A3C1XTI3-F1-model_v4 | Geranyl transferase | 0.988 | 72 | 306 |
GO:0004659
GO:0005737 GO:0008299 |
| AF-A0A357NMF4-F1-model_v4 | deleted | 0.9862 | 11 | 265 |
|
| AF-A0A5N0KNE7-F1-model_v4 | deleted | 0.9851 | 11 | 306 |
|