F483754
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 858 | 488 | 1716 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300049573|Ga0501037_0392039|Ga0501037_0392039_337_756 |
| Length | 122 |
| Sequence | MATRHPSIASAAEGKNTVETPLSKSYTDPRDVLIKPVVSEKSYALLDENKYTFIVDPRANKTQIKEAVQAVFEVKVTGVNTINRQGKRKRTRTGFGQRAATKRAIVTLAEGDRIDIFGGPTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 87 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 88 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 89 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 109 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 116 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 170 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 171 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 172 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 174 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 175 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 195 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 210 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 211 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 212 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 215 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 216 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 225 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 226 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 227 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 228 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 229 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 230 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 231 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 232 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 233 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 234 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 235 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 249 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 333 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 334 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 335 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 336 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 337 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 338 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 339 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 385 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 394 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 405 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 406 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 407 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 410 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 411 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 412 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 413 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 414 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 415 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 416 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 417 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 418 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 419 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 420 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 422 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 423 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 425 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 426 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 427 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 428 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 429 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 430 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 431 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 432 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 435 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 436 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 437 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 439 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 440 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 470 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 471 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 472 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 473 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 474 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 475 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 476 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 477 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 478 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 479 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 480 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 481 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 482 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 483 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 484 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 485 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 486 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 487 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 488 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.73 |
| Metatranscriptomes | 13.05 |
| Isolates | 2.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.04 |
| Nodule | 0 |
| Rhizoplane | 6.99 |
| Rhizosphere | 77.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501037_0392039 | 3300049573 | Bacteria | 953 |
| 2 | JGI25160J50197_1032287 | 3300003354 | Bacteria | 1333 |
| 3 | Ga0058859_10027059 | 3300004798 | Bacteria | 810 |
| 4 | Ga0058861_12031117 | 3300004800 | Bacteria | 721 |
| 5 | Ga0058860_10020864 | 3300004801 | Bacteria | 651 |
| 6 | Ga0058860_12055840 | 3300004801 | Bacteria | 550 |
| 7 | Ga0058862_10019043 | 3300004803 | Bacteria | 924 |
| 8 | Ga0058862_12685021 | 3300004803 | Bacteria | 637 |
| 9 | Ga0070658_11036574 | 3300005327 | Bacteria | 713 |
| 10 | Ga0070683_100243292 | 3300005329 | Bacteria | 1711 |
| 11 | Ga0070683_100730630 | 3300005329 | Bacteria | 948 |
| 12 | Ga0070683_101138786 | 3300005329 | Bacteria | 749 |
| 13 | Ga0070670_100425233 | 3300005331 | Bacteria | 1175 |
| 14 | Ga0070670_100760505 | 3300005331 | Bacteria | 873 |
| 15 | Ga0068869_100293072 | 3300005334 | Bacteria | 1311 |
| 16 | Ga0070682_100283454 | 3300005337 | Bacteria | 1209 |
| 17 | Ga0070682_100420354 | 3300005337 | Bacteria | 1016 |
| 18 | Ga0068868_100719583 | 3300005338 | Bacteria | 894 |
| 19 | Ga0068868_101528756 | 3300005338 | Bacteria | 625 |
| 20 | Ga0070660_100392575 | 3300005339 | Bacteria | 1146 |
| 21 | Ga0070689_100898597 | 3300005340 | Bacteria | 784 |
| 22 | Ga0070687_100565731 | 3300005343 | Bacteria | 776 |
| 23 | Ga0070661_100303924 | 3300005344 | Bacteria | 1242 |
| 24 | Ga0070692_10467664 | 3300005345 | Bacteria | 810 |
| 25 | Ga0070692_11211312 | 3300005345 | Bacteria | 538 |
| 26 | Ga0070668_100198226 | 3300005347 | Bacteria | 1647 |
| 27 | Ga0070668_101450308 | 3300005347 | Bacteria | 627 |
| 28 | Ga0070669_101860188 | 3300005353 | Bacteria | 525 |
| 29 | Ga0070675_100820281 | 3300005354 | Bacteria | 851 |
| 30 | Ga0070671_100314327 | 3300005355 | Bacteria | 1334 |
| 31 | Ga0070671_100546495 | 3300005355 | Bacteria | 999 |
| 32 | Ga0070674_101090453 | 3300005356 | Bacteria | 705 |
| 33 | Ga0070674_101177552 | 3300005356 | Bacteria | 680 |
| 34 | Ga0070673_100855117 | 3300005364 | Bacteria | 842 |
| 35 | Ga0070673_101041985 | 3300005364 | Bacteria | 763 |
| 36 | Ga0070659_100346616 | 3300005366 | Bacteria | 1245 |
| 37 | Ga0070659_101468914 | 3300005366 | Bacteria | 607 |
| 38 | Ga0070667_100005984 | 3300005367 | Bacteria | 10104 |
| 39 | Ga0070667_100313417 | 3300005367 | Bacteria | 1414 |
| 40 | Ga0070667_100552437 | 3300005367 | Bacteria | 1058 |
| 41 | Ga0070703_10117275 | 3300005406 | Bacteria | 961 |
| 42 | Ga0070714_100233697 | 3300005435 | Bacteria | 1695 |
| 43 | Ga0070714_100319510 | 3300005435 | Bacteria | 1451 |
| 44 | Ga0070713_100004669 | 3300005436 | Bacteria | 9248 |
| 45 | Ga0070701_10842954 | 3300005438 | Bacteria | 629 |
| 46 | Ga0070711_100253031 | 3300005439 | Bacteria | 1383 |
| 47 | Ga0070700_100780034 | 3300005441 | Bacteria | 768 |
| 48 | Ga0070700_101998074 | 3300005441 | Bacteria | 503 |
| 49 | Ga0070663_100166935 | 3300005455 | Bacteria | 1699 |
| 50 | Ga0070678_100132027 | 3300005456 | Bacteria | 1985 |
| 51 | Ga0070678_100420815 | 3300005456 | Bacteria | 1164 |
| 52 | Ga0070678_101247103 | 3300005456 | Bacteria | 691 |
| 53 | Ga0070678_101280762 | 3300005456 | Bacteria | 682 |
| 54 | Ga0070662_100552981 | 3300005457 | Bacteria | 964 |
| 55 | Ga0070662_101939477 | 3300005457 | Bacteria | 509 |
| 56 | Ga0068867_100312233 | 3300005459 | Bacteria | 1299 |
| 57 | Ga0070685_10284947 | 3300005466 | Bacteria | 1107 |
| 58 | Ga0070685_11409986 | 3300005466 | Bacteria | 535 |
| 59 | Ga0070685_11481707 | 3300005466 | Bacteria | 522 |
| 60 | Ga0070706_101774999 | 3300005467 | Bacteria | 561 |
| 61 | Ga0070679_101137379 | 3300005530 | Bacteria | 726 |
| 62 | Ga0070679_101142826 | 3300005530 | Bacteria | 724 |
| 63 | Ga0070679_101800756 | 3300005530 | Bacteria | 561 |
| 64 | Ga0070684_100285523 | 3300005535 | Bacteria | 1512 |
| 65 | Ga0070672_100582283 | 3300005543 | Bacteria | 974 |
| 66 | Ga0070672_101372942 | 3300005543 | Bacteria | 632 |
| 67 | Ga0070686_100186467 | 3300005544 | Bacteria | 1478 |
| 68 | Ga0070686_101484268 | 3300005544 | Bacteria | 571 |
| 69 | Ga0070693_100400377 | 3300005547 | Bacteria | 952 |
| 70 | Ga0070693_101028264 | 3300005547 | Bacteria | 625 |
| 71 | Ga0070665_100125445 | 3300005548 | Bacteria | 2570 |
| 72 | Ga0070665_102611067 | 3300005548 | Bacteria | 506 |
| 73 | Ga0070664_100611988 | 3300005564 | Bacteria | 1011 |
| 74 | Ga0070664_100964697 | 3300005564 | Bacteria | 801 |
| 75 | Ga0068857_100367935 | 3300005577 | Bacteria | 1333 |
| 76 | Ga0068854_101954602 | 3300005578 | Bacteria | 540 |
| 77 | Ga0068856_100781514 | 3300005614 | Bacteria | 975 |
| 78 | Ga0068856_101071620 | 3300005614 | Bacteria | 824 |
| 79 | Ga0070702_100134868 | 3300005615 | Bacteria | 1565 |
| 80 | Ga0068852_100025908 | 3300005616 | Bacteria | 4759 |
| 81 | Ga0068852_100649273 | 3300005616 | Bacteria | 1062 |
| 82 | Ga0068852_101215577 | 3300005616 | Bacteria | 775 |
| 83 | Ga0068859_100743950 | 3300005617 | Bacteria | 1070 |
| 84 | Ga0068864_100521326 | 3300005618 | Bacteria | 1146 |
| 85 | Ga0068864_100627925 | 3300005618 | Bacteria | 1045 |
| 86 | Ga0068866_10632194 | 3300005718 | Bacteria | 726 |
| 87 | Ga0068861_100130584 | 3300005719 | Bacteria | 2038 |
| 88 | Ga0068851_10299893 | 3300005834 | Bacteria | 924 |
| 89 | Ga0068870_10582921 | 3300005840 | Bacteria | 758 |
| 90 | Ga0068870_11409036 | 3300005840 | Bacteria | 511 |
| 91 | Ga0068863_100342072 | 3300005841 | Bacteria | 1455 |
| 92 | Ga0068863_101686661 | 3300005841 | Bacteria | 643 |
| 93 | Ga0068858_100000013 | 3300005842 | Bacteria | 216466 |
| 94 | Ga0068858_100212121 | 3300005842 | Bacteria | 1833 |
| 95 | Ga0068860_100780105 | 3300005843 | Bacteria | 968 |
| 96 | Ga0081455_10106856 | 3300005937 | Bacteria | 2232 |
| 97 | Ga0081455_10386216 | 3300005937 | Bacteria | 976 |
| 98 | Ga0081455_10547032 | 3300005937 | Bacteria | 766 |
| 99 | Ga0081540_1005568 | 3300005983 | Bacteria | 9381 |
| 100 | Ga0070717_11314727 | 3300006028 | Bacteria | 657 |
| 101 | Ga0075365_10006681 | 3300006038 | Bacteria | 6372 |
| 102 | Ga0075365_10075797 | 3300006038 | Bacteria | 2270 |
| 103 | Ga0075365_10855404 | 3300006038 | Bacteria | 641 |
| 104 | Ga0075365_10948699 | 3300006038 | Bacteria | 606 |
| 105 | Ga0075363_100038892 | 3300006048 | Bacteria | 2502 |
| 106 | Ga0075364_10048616 | 3300006051 | Bacteria | 2764 |
| 107 | Ga0075364_10202272 | 3300006051 | Bacteria | 1346 |
| 108 | Ga0075364_10208663 | 3300006051 | Bacteria | 1324 |
| 109 | Ga0075364_10683225 | 3300006051 | Bacteria | 701 |
| 110 | Ga0075369_10032174 | 3300006186 | Bacteria | 2218 |
| 111 | Ga0075369_10361646 | 3300006186 | Bacteria | 681 |
| 112 | Ga0075366_10421996 | 3300006195 | Bacteria | 822 |
| 113 | Ga0097621_100222109 | 3300006237 | Bacteria | 1646 |
| 114 | Ga0075370_10988178 | 3300006353 | Bacteria | 516 |
| 115 | Ga0068871_101351922 | 3300006358 | Bacteria | 671 |
| 116 | Ga0068865_100534181 | 3300006881 | Bacteria | 983 |
| 117 | Ga0097620_100743961 | 3300006931 | Bacteria | 1070 |
| 118 | Ga0105244_10272877 | 3300009036 | Bacteria | 785 |
| 119 | Ga0105244_10576351 | 3300009036 | Bacteria | 517 |
| 120 | Ga0105250_10195966 | 3300009092 | Bacteria | 851 |
| 121 | Ga0111539_11678634 | 3300009094 | Bacteria | 737 |
| 122 | Ga0105245_10059566 | 3300009098 | Bacteria | 3438 |
| 123 | Ga0105245_10078141 | 3300009098 | Bacteria | 3019 |
| 124 | Ga0105245_10116828 | 3300009098 | Bacteria | 2488 |
| 125 | Ga0105245_10388478 | 3300009098 | Bacteria | 1392 |
| 126 | Ga0105247_10161516 | 3300009101 | Bacteria | 1484 |
| 127 | Ga0105247_10252526 | 3300009101 | Bacteria | 1206 |
| 128 | Ga0105247_11306377 | 3300009101 | Bacteria | 583 |
| 129 | Ga0105243_10683988 | 3300009148 | Bacteria | 998 |
| 130 | Ga0105243_10987054 | 3300009148 | Bacteria | 844 |
| 131 | Ga0105243_11658954 | 3300009148 | Bacteria | 667 |
| 132 | Ga0105241_10074305 | 3300009174 | Bacteria | 2647 |
| 133 | Ga0105241_10738320 | 3300009174 | Bacteria | 902 |
| 134 | Ga0105241_11899740 | 3300009174 | Bacteria | 583 |
| 135 | Ga0105242_10262583 | 3300009176 | Bacteria | 1560 |
| 136 | Ga0105242_10413133 | 3300009176 | Bacteria | 1262 |
| 137 | Ga0105242_10643137 | 3300009176 | Bacteria | 1030 |
| 138 | Ga0105248_10096561 | 3300009177 | Bacteria | 3329 |
| 139 | Ga0105248_10150854 | 3300009177 | Bacteria | 2622 |
| 140 | Ga0105248_10372568 | 3300009177 | Bacteria | 1607 |
| 141 | Ga0105248_11187432 | 3300009177 | Bacteria | 863 |
| 142 | Ga0105237_10009127 | 3300009545 | Bacteria | 10656 |
| 143 | Ga0105238_10409424 | 3300009551 | Bacteria | 1350 |
| 144 | Ga0105238_11431897 | 3300009551 | Bacteria | 719 |
| 145 | Ga0105249_10632895 | 3300009553 | Bacteria | 1126 |
| 146 | Ga0105249_11724993 | 3300009553 | Bacteria | 699 |
| 147 | Ga0105249_12478515 | 3300009553 | Bacteria | 591 |
| 148 | Ga0105239_10005526 | 3300010375 | Bacteria | 14802 |
| 149 | Ga0105239_10942334 | 3300010375 | Bacteria | 991 |
| 150 | Ga0105239_11459766 | 3300010375 | Bacteria | 790 |
| 151 | Ga0105246_10813620 | 3300011119 | Bacteria | 830 |
| 152 | Ga0105246_10995822 | 3300011119 | Bacteria | 758 |
| 153 | Ga0105246_11572961 | 3300011119 | Bacteria | 620 |
| 154 | Ga0105246_12571340 | 3300011119 | Bacteria | 502 |
| 155 | Ga0157337_1005161 | 3300012483 | Bacteria | 861 |
| 156 | Ga0157322_1001742 | 3300012490 | Bacteria | 1132 |
| 157 | Ga0157327_1044190 | 3300012512 | Bacteria | 611 |
| 158 | Ga0157326_1022361 | 3300012513 | Bacteria | 789 |
| 159 | Ga0157371_10483286 | 3300013102 | Bacteria | 913 |
| 160 | Ga0157370_10950512 | 3300013104 | Bacteria | 779 |
| 161 | Ga0157370_11509372 | 3300013104 | Bacteria | 604 |
| 162 | Ga0157369_10156154 | 3300013105 | Bacteria | 2410 |
| 163 | Ga0157369_10990050 | 3300013105 | Bacteria | 861 |
| 164 | Ga0157369_12484095 | 3300013105 | Bacteria | 525 |
| 165 | Ga0157374_10290071 | 3300013296 | Bacteria | 1617 |
| 166 | Ga0157374_11027292 | 3300013296 | Bacteria | 844 |
| 167 | Ga0157374_11830770 | 3300013296 | Bacteria | 632 |
| 168 | Ga0157374_12382849 | 3300013296 | Bacteria | 557 |
| 169 | Ga0157378_11790932 | 3300013297 | Bacteria | 662 |
| 170 | Ga0157378_11996588 | 3300013297 | Bacteria | 630 |
| 171 | Ga0157378_12095641 | 3300013297 | Bacteria | 616 |
| 172 | Ga0163162_10127782 | 3300013306 | Bacteria | 2649 |
| 173 | Ga0163162_10882261 | 3300013306 | Bacteria | 1008 |
| 174 | Ga0163162_12321706 | 3300013306 | Bacteria | 616 |
| 175 | Ga0157372_11358944 | 3300013307 | Bacteria | 819 |
| 176 | Ga0157372_11397875 | 3300013307 | Bacteria | 807 |
| 177 | Ga0157372_11521351 | 3300013307 | Bacteria | 771 |
| 178 | Ga0157372_12980673 | 3300013307 | Bacteria | 541 |
| 179 | Ga0157375_10016636 | 3300013308 | Bacteria | 6614 |
| 180 | Ga0157375_10268334 | 3300013308 | Bacteria | 1868 |
| 181 | Ga0157375_11680425 | 3300013308 | Bacteria | 751 |
| 182 | Ga0157375_12579190 | 3300013308 | Bacteria | 607 |
| 183 | Ga0163163_10057195 | 3300014325 | Bacteria | 3855 |
| 184 | Ga0163163_10395536 | 3300014325 | Bacteria | 1440 |
| 185 | Ga0163163_10743846 | 3300014325 | Bacteria | 1044 |
| 186 | Ga0163163_11532606 | 3300014325 | Bacteria | 728 |
| 187 | Ga0157380_10408869 | 3300014326 | Bacteria | 1290 |
| 188 | Ga0157380_11088257 | 3300014326 | Bacteria | 838 |
| 189 | Ga0157380_11921502 | 3300014326 | Bacteria | 653 |
| 190 | Ga0157380_12077116 | 3300014326 | Bacteria | 631 |
| 191 | Ga0157380_12279246 | 3300014326 | Bacteria | 606 |
| 192 | Ga0182008_10724126 | 3300014497 | Bacteria | 570 |
| 193 | Ga0157377_10099821 | 3300014745 | Bacteria | 1727 |
| 194 | Ga0157377_11215011 | 3300014745 | Bacteria | 584 |
| 195 | Ga0157379_10000012 | 3300014968 | Bacteria | 110577 |
| 196 | Ga0157379_10579836 | 3300014968 | Bacteria | 1045 |
| 197 | Ga0157376_10234942 | 3300014969 | Bacteria | 1705 |
| 198 | Ga0163161_11128673 | 3300017792 | Bacteria | 675 |
| 199 | Ga0163161_11297982 | 3300017792 | Bacteria | 633 |
| 200 | Ga0197907_10433734 | 3300020069 | Bacteria | 1096 |
| 201 | Ga0197907_10477661 | 3300020069 | Bacteria | 2104 |
| 202 | Ga0197907_11152397 | 3300020069 | Bacteria | 516 |
| 203 | Ga0206356_10344010 | 3300020070 | Bacteria | 3475 |
| 204 | Ga0206356_11141088 | 3300020070 | Bacteria | 4448 |
| 205 | Ga0206356_11473966 | 3300020070 | Bacteria | 2324 |
| 206 | Ga0206349_1334537 | 3300020075 | Bacteria | 709 |
| 207 | Ga0206349_1527023 | 3300020075 | Bacteria | 1001 |
| 208 | Ga0206349_1563816 | 3300020075 | Bacteria | 667 |
| 209 | Ga0206349_1899702 | 3300020075 | Bacteria | 921 |
| 210 | Ga0206355_1431124 | 3300020076 | Bacteria | 811 |
| 211 | Ga0206355_1519402 | 3300020076 | Bacteria | 867 |
| 212 | Ga0206355_1612783 | 3300020076 | Bacteria | 545 |
| 213 | Ga0206351_10233981 | 3300020077 | Bacteria | 673 |
| 214 | Ga0206351_10393194 | 3300020077 | Bacteria | 686 |
| 215 | Ga0206351_10580594 | 3300020077 | Bacteria | 535 |
| 216 | Ga0206351_10619467 | 3300020077 | Bacteria | 1073 |
| 217 | Ga0206352_10732747 | 3300020078 | Bacteria | 804 |
| 218 | Ga0206352_10762487 | 3300020078 | Bacteria | 2048 |
| 219 | Ga0206352_11111464 | 3300020078 | Bacteria | 913 |
| 220 | Ga0206352_11329365 | 3300020078 | Bacteria | 637 |
| 221 | Ga0206350_10015308 | 3300020080 | Bacteria | 744 |
| 222 | Ga0206350_10952296 | 3300020080 | Bacteria | 662 |
| 223 | Ga0206354_10008953 | 3300020081 | Bacteria | 614 |
| 224 | Ga0206354_10314494 | 3300020081 | Bacteria | 529 |
| 225 | Ga0206354_10395367 | 3300020081 | Bacteria | 3493 |
| 226 | Ga0206354_10448514 | 3300020081 | Bacteria | 3241 |
| 227 | Ga0206354_10954251 | 3300020081 | Bacteria | 2646 |
| 228 | Ga0206353_10604234 | 3300020082 | Bacteria | 2528 |
| 229 | Ga0206353_10689809 | 3300020082 | Bacteria | 3757 |
| 230 | Ga0206353_11202414 | 3300020082 | Bacteria | 1066 |
| 231 | Ga0206353_11207679 | 3300020082 | Bacteria | 2102 |
| 232 | Ga0154015_1295976 | 3300020610 | Bacteria | 569 |
| 233 | Ga0154015_1675542 | 3300020610 | Bacteria | 593 |
| 234 | Ga0213874_10080966 | 3300021377 | Bacteria | 1052 |
| 235 | Ga0224712_10023353 | 3300022467 | Bacteria | 2146 |
| 236 | Ga0224712_10040311 | 3300022467 | Bacteria | 1756 |
| 237 | Ga0224712_10086555 | 3300022467 | Bacteria | 1304 |
| 238 | Ga0224712_10528619 | 3300022467 | Bacteria | 572 |
| 239 | Ga0207426_1005083 | 3300025302 | Bacteria | 6146 |
| 240 | Ga0207642_10194015 | 3300025899 | Bacteria | 1117 |
| 241 | Ga0207710_10331840 | 3300025900 | Bacteria | 772 |
| 242 | Ga0207710_10333422 | 3300025900 | Bacteria | 771 |
| 243 | Ga0207688_10159887 | 3300025901 | Bacteria | 1335 |
| 244 | Ga0207688_10291667 | 3300025901 | Bacteria | 996 |
| 245 | Ga0207688_10509774 | 3300025901 | Bacteria | 754 |
| 246 | Ga0207688_10820536 | 3300025901 | Bacteria | 589 |
| 247 | Ga0207685_10425936 | 3300025905 | Bacteria | 685 |
| 248 | Ga0207699_10406267 | 3300025906 | Bacteria | 971 |
| 249 | Ga0207645_10336741 | 3300025907 | Bacteria | 1008 |
| 250 | Ga0207643_10187159 | 3300025908 | Bacteria | 1255 |
| 251 | Ga0207671_10006629 | 3300025914 | Bacteria | 10272 |
| 252 | Ga0207663_10375064 | 3300025916 | Bacteria | 1082 |
| 253 | Ga0207660_10438245 | 3300025917 | Bacteria | 1055 |
| 254 | Ga0207662_11366387 | 3300025918 | Bacteria | 503 |
| 255 | Ga0207657_10200846 | 3300025919 | Bacteria | 1604 |
| 256 | Ga0207657_10758866 | 3300025919 | Bacteria | 751 |
| 257 | Ga0207649_11014735 | 3300025920 | Bacteria | 653 |
| 258 | Ga0207652_10917546 | 3300025921 | Bacteria | 773 |
| 259 | Ga0207652_11159145 | 3300025921 | Bacteria | 674 |
| 260 | Ga0207694_10412143 | 3300025924 | Bacteria | 1125 |
| 261 | Ga0207694_11227433 | 3300025924 | Bacteria | 634 |
| 262 | Ga0207694_11451090 | 3300025924 | Bacteria | 579 |
| 263 | Ga0207650_10769763 | 3300025925 | Bacteria | 815 |
| 264 | Ga0207650_10933591 | 3300025925 | Bacteria | 737 |
| 265 | Ga0207659_10867105 | 3300025926 | Bacteria | 776 |
| 266 | Ga0207687_10020152 | 3300025927 | Bacteria | 4423 |
| 267 | Ga0207687_10623126 | 3300025927 | Bacteria | 911 |
| 268 | Ga0207687_10709849 | 3300025927 | Bacteria | 854 |
| 269 | Ga0207700_10020037 | 3300025928 | Bacteria | 4532 |
| 270 | Ga0207664_10340891 | 3300025929 | Bacteria | 1325 |
| 271 | Ga0207664_10666031 | 3300025929 | Bacteria | 936 |
| 272 | Ga0207664_11664844 | 3300025929 | Bacteria | 560 |
| 273 | Ga0207644_10268217 | 3300025931 | Bacteria | 1367 |
| 274 | Ga0207690_10460364 | 3300025932 | Bacteria | 1023 |
| 275 | Ga0207690_11111234 | 3300025932 | Bacteria | 659 |
| 276 | Ga0207690_11444636 | 3300025932 | Bacteria | 575 |
| 277 | Ga0207690_11650152 | 3300025932 | Bacteria | 536 |
| 278 | Ga0207706_10613371 | 3300025933 | Bacteria | 934 |
| 279 | Ga0207686_10310339 | 3300025934 | Bacteria | 1175 |
| 280 | Ga0207686_10672721 | 3300025934 | Bacteria | 821 |
| 281 | Ga0207709_10027907 | 3300025935 | Bacteria | 3258 |
| 282 | Ga0207709_11655727 | 3300025935 | Bacteria | 532 |
| 283 | Ga0207670_10534365 | 3300025936 | Bacteria | 956 |
| 284 | Ga0207670_11317845 | 3300025936 | Bacteria | 612 |
| 285 | Ga0207669_10564610 | 3300025937 | Bacteria | 920 |
| 286 | Ga0207669_11398796 | 3300025937 | Bacteria | 596 |
| 287 | Ga0207665_11137336 | 3300025939 | Bacteria | 623 |
| 288 | Ga0207691_10097609 | 3300025940 | Bacteria | 2626 |
| 289 | Ga0207711_10006894 | 3300025941 | Bacteria | 9541 |
| 290 | Ga0207711_10377122 | 3300025941 | Bacteria | 1316 |
| 291 | Ga0207711_10548816 | 3300025941 | Bacteria | 1078 |
| 292 | Ga0207661_10127477 | 3300025944 | Bacteria | 2175 |
| 293 | Ga0207661_11804645 | 3300025944 | Bacteria | 557 |
| 294 | Ga0207661_11938976 | 3300025944 | Bacteria | 535 |
| 295 | Ga0207679_10943575 | 3300025945 | Bacteria | 790 |
| 296 | Ga0207667_10075039 | 3300025949 | Bacteria | 3512 |
| 297 | Ga0207667_11504646 | 3300025949 | Bacteria | 644 |
| 298 | Ga0207651_12109538 | 3300025960 | Bacteria | 506 |
| 299 | Ga0207712_10076377 | 3300025961 | Bacteria | 2425 |
| 300 | Ga0207712_11805054 | 3300025961 | Bacteria | 548 |
| 301 | Ga0207668_10057966 | 3300025972 | Bacteria | 2704 |
| 302 | Ga0207677_10702486 | 3300026023 | Bacteria | 897 |
| 303 | Ga0207677_10877598 | 3300026023 | Bacteria | 807 |
| 304 | Ga0207677_11331521 | 3300026023 | Bacteria | 660 |
| 305 | Ga0207703_10000009 | 3300026035 | Bacteria | 343983 |
| 306 | Ga0207703_10194578 | 3300026035 | Bacteria | 1798 |
| 307 | Ga0207703_10326404 | 3300026035 | Bacteria | 1407 |
| 308 | Ga0207639_12078028 | 3300026041 | Bacteria | 529 |
| 309 | Ga0207678_10545886 | 3300026067 | Bacteria | 1013 |
| 310 | Ga0207678_10611791 | 3300026067 | Bacteria | 956 |
| 311 | Ga0207678_11371858 | 3300026067 | Bacteria | 625 |
| 312 | Ga0207678_11828408 | 3300026067 | Bacteria | 531 |
| 313 | Ga0207708_11452155 | 3300026075 | Bacteria | 602 |
| 314 | Ga0207708_11694808 | 3300026075 | Bacteria | 555 |
| 315 | Ga0207702_10244783 | 3300026078 | Bacteria | 1681 |
| 316 | Ga0207702_10578113 | 3300026078 | Bacteria | 1101 |
| 317 | Ga0207648_10078394 | 3300026089 | Bacteria | 2882 |
| 318 | Ga0207648_10717003 | 3300026089 | Bacteria | 927 |
| 319 | Ga0207648_11616099 | 3300026089 | Bacteria | 609 |
| 320 | Ga0207648_12065211 | 3300026089 | Bacteria | 531 |
| 321 | Ga0207676_10825903 | 3300026095 | Bacteria | 905 |
| 322 | Ga0207676_12386186 | 3300026095 | Bacteria | 526 |
| 323 | Ga0207674_10310004 | 3300026116 | Bacteria | 1527 |
| 324 | Ga0207674_10357195 | 3300026116 | Bacteria | 1412 |
| 325 | Ga0207674_11370290 | 3300026116 | Bacteria | 677 |
| 326 | Ga0207675_100689343 | 3300026118 | Bacteria | 1030 |
| 327 | Ga0207675_100829545 | 3300026118 | Bacteria | 939 |
| 328 | Ga0207683_10080520 | 3300026121 | Bacteria | 2889 |
| 329 | Ga0207683_10527233 | 3300026121 | Bacteria | 1092 |
| 330 | Ga0207683_10885094 | 3300026121 | Bacteria | 829 |
| 331 | Ga0207683_11631060 | 3300026121 | Bacteria | 594 |
| 332 | Ga0207698_10273345 | 3300026142 | Bacteria | 1559 |
| 333 | Ga0207698_10346174 | 3300026142 | Bacteria | 1402 |
| 334 | Ga0268266_10027754 | 3300028379 | Bacteria | 4813 |
| 335 | Ga0268266_10099981 | 3300028379 | Bacteria | 2554 |
| 336 | Ga0268266_10867680 | 3300028379 | Bacteria | 872 |
| 337 | Ga0268265_10042371 | 3300028380 | Bacteria | 3377 |
| 338 | Ga0268264_10198362 | 3300028381 | Bacteria | 1834 |
| 339 | Ga0307517_10001351 | 3300028786 | Bacteria | 41147 |
| 340 | Ga0307517_10156088 | 3300028786 | Bacteria | 1548 |
| 341 | Ga0307515_10001812 | 3300028794 | Bacteria | 47673 |
| 342 | Ga0310981_1091162 | 3300029285 | Bacteria | 761 |
| 343 | Ga0268256_1062540 | 3300030500 | Bacteria | 742 |
| 344 | Ga0307511_10108881 | 3300030521 | Bacteria | 1775 |
| 345 | Ga0307511_10285694 | 3300030521 | Bacteria | 758 |
| 346 | Ga0307512_10207419 | 3300030522 | Bacteria | 1048 |
| 347 | Ga0307509_10011154 | 3300031507 | Bacteria | 10930 |
| 348 | Ga0307509_10012707 | 3300031507 | Bacteria | 10038 |
| 349 | Ga0307509_10256568 | 3300031507 | Bacteria | 1527 |
| 350 | Ga0307408_100606623 | 3300031548 | Bacteria | 973 |
| 351 | Ga0307508_10000924 | 3300031616 | Bacteria | 34111 |
| 352 | Ga0307508_10003351 | 3300031616 | Bacteria | 16261 |
| 353 | Ga0307508_10012942 | 3300031616 | Bacteria | 7628 |
| 354 | Ga0307508_10097570 | 3300031616 | Bacteria | 2531 |
| 355 | Ga0307508_10263909 | 3300031616 | Bacteria | 1316 |
| 356 | Ga0307514_10107474 | 3300031649 | Bacteria | 1987 |
| 357 | Ga0307516_10039371 | 3300031730 | Bacteria | 4712 |
| 358 | Ga0307516_10045595 | 3300031730 | Bacteria | 4329 |
| 359 | Ga0307516_10190827 | 3300031730 | Bacteria | 1775 |
| 360 | Ga0307405_10100649 | 3300031731 | Bacteria | 1937 |
| 361 | Ga0307405_10147227 | 3300031731 | Bacteria | 1651 |
| 362 | Ga0307405_10541356 | 3300031731 | Bacteria | 940 |
| 363 | Ga0307413_10082563 | 3300031824 | Bacteria | 2065 |
| 364 | Ga0307413_10091348 | 3300031824 | Bacteria | 1983 |
| 365 | Ga0307413_10860122 | 3300031824 | Bacteria | 767 |
| 366 | Ga0307410_10352523 | 3300031852 | Bacteria | 1176 |
| 367 | Ga0326468_10001555 | 3300031889 | Bacteria | 1973 |
| 368 | Ga0307406_10030532 | 3300031901 | Bacteria | 3273 |
| 369 | Ga0307406_10058669 | 3300031901 | Bacteria | 2474 |
| 370 | Ga0307407_10087218 | 3300031903 | Bacteria | 1903 |
| 371 | Ga0307412_11003713 | 3300031911 | Bacteria | 738 |
| 372 | Ga0307409_100142156 | 3300031995 | Bacteria | 2069 |
| 373 | Ga0307409_100354129 | 3300031995 | Bacteria | 1386 |
| 374 | Ga0307409_100452788 | 3300031995 | Bacteria | 1239 |
| 375 | Ga0307409_100640842 | 3300031995 | Bacteria | 1055 |
| 376 | Ga0307409_102710985 | 3300031995 | Bacteria | 524 |
| 377 | Ga0307416_100096719 | 3300032002 | Bacteria | 2554 |
| 378 | Ga0307416_100587117 | 3300032002 | Bacteria | 1192 |
| 379 | Ga0307416_100750823 | 3300032002 | Bacteria | 1068 |
| 380 | Ga0307416_101733795 | 3300032002 | Bacteria | 729 |
| 381 | Ga0307414_10679703 | 3300032004 | Bacteria | 930 |
| 382 | Ga0307411_10082097 | 3300032005 | Bacteria | 2222 |
| 383 | Ga0307411_12138770 | 3300032005 | Bacteria | 524 |
| 384 | Ga0307415_100074865 | 3300032126 | Bacteria | 2394 |
| 385 | Ga0307415_100145656 | 3300032126 | Bacteria | 1815 |
| 386 | Ga0307415_100285088 | 3300032126 | Bacteria | 1360 |
| 387 | Ga0307415_100517647 | 3300032126 | Bacteria | 1046 |
| 388 | Ga0307507_10000482 | 3300033179 | Bacteria | 83990 |
| 389 | Ga0307507_10096663 | 3300033179 | Bacteria | 2497 |
| 390 | Ga0307507_10120549 | 3300033179 | Bacteria | 2100 |
| 391 | Ga0307507_10444868 | 3300033179 | Bacteria | 718 |
| 392 | Ga0307510_10095977 | 3300033180 | Bacteria | 2783 |
| 393 | Ga0307510_10106134 | 3300033180 | Bacteria | 2574 |
| 394 | Ga0307510_10136518 | 3300033180 | Bacteria | 2109 |
| 395 | Ga0316214_1026290 | 3300033545 | Bacteria | 820 |
| 396 | Ga0373949_0069568 | 3300035090 | Bacteria | 920 |
| 397 | Ga0373951_0000463 | 3300035091 | Bacteria | 11707 |
| 398 | Ga0373941_0239828 | 3300035115 | Bacteria | 704 |
| 399 | Ga0373945_0273118 | 3300035116 | Bacteria | 719 |
| 400 | Ga0373960_0108571 | 3300035121 | Bacteria | 908 |
| 401 | Ga0373935_0022806 | 3300035692 | Bacteria | 3843 |
| 402 | Ga0373925_0389249 | 3300037068 | Bacteria | 1136 |
| 403 | Ga0395900_0050861 | 3300037418 | Bacteria | 4268 |
| 404 | Ga0395898_0953350 | 3300037466 | Bacteria | 795 |
| 405 | Ga0395905_0764432 | 3300037471 | Bacteria | 869 |
| 406 | Ga0436364_0164890 | 3300037853 | Bacteria | 592 |
| 407 | Ga0436364_1556898 | 3300037853 | Bacteria | 865 |
| 408 | Ga0395901_0808086 | 3300038443 | Bacteria | 926 |
| 409 | Ga0436365_0905729 | 3300039437 | Bacteria | 13103 |
| 410 | Ga0436363_0026914 | 3300039450 | Bacteria | 1052 |
| 411 | Ga0436363_0492081 | 3300039450 | Bacteria | 669 |
| 412 | Ga0439461_0000353 | 3300041410 | Bacteria | 6532 |
| 413 | Ga0439466_0001023 | 3300041411 | Bacteria | 10766 |
| 414 | Ga0439465_0003128 | 3300041413 | Bacteria | 5402 |
| 415 | Ga0439465_0367819 | 3300041413 | Bacteria | 545 |
| 416 | Ga0451787_802906 | 3300041441 | Bacteria | 538 |
| 417 | Ga0451789_0187238 | 3300041443 | Bacteria | 755 |
| 418 | Ga0451789_1330385 | 3300041443 | Bacteria | 2034 |
| 419 | Ga0451790_07178 | 3300041444 | Bacteria | 1719 |
| 420 | Ga0451794_25357 | 3300041446 | Bacteria | 1138 |
| 421 | Ga0451791_1814107 | 3300041451 | Bacteria | 987 |
| 422 | Ga0451793_0621849 | 3300041452 | Bacteria | 588 |
| 423 | Ga0451793_1066416 | 3300041452 | Bacteria | 1069 |
| 424 | Ga0451797_0774478 | 3300041453 | Bacteria | 588 |
| 425 | Ga0451797_0864649 | 3300041453 | Bacteria | 1122 |
| 426 | Ga0451797_1211872 | 3300041453 | Bacteria | 1347 |
| 427 | Ga0451795_1621111 | 3300041456 | Bacteria | 781 |
| 428 | Ga0451800_0489214 | 3300041459 | Bacteria | 553 |
| 429 | Ga0451802_1113913 | 3300041460 | Bacteria | 621 |
| 430 | Ga0451802_1643678 | 3300041460 | Bacteria | 1320 |
| 431 | Ga0451804_0462733 | 3300041463 | Bacteria | 562 |
| 432 | Ga0451807_0482340 | 3300041486 | Bacteria | 545 |
| 433 | Ga0451807_1220677 | 3300041486 | Bacteria | 1168 |
| 434 | Ga0451833_0393181 | 3300041491 | Bacteria | 2121 |
| 435 | Ga0451837_1730739 | 3300041494 | Bacteria | 811 |
| 436 | Ga0451839_0406887 | 3300041496 | Bacteria | 645 |
| 437 | Ga0451841_0603908 | 3300041498 | Bacteria | 1351 |
| 438 | Ga0451843_0866875 | 3300041509 | Bacteria | 2401 |
| 439 | Ga0451855_0151320 | 3300041511 | Bacteria | 635 |
| 440 | Ga0451853_0729236 | 3300041512 | Bacteria | 5080 |
| 441 | Ga0451853_1021921 | 3300041512 | Bacteria | 512 |
| 442 | Ga0439431_0000355 | 3300041997 | Bacteria | 9648 |
| 443 | Ga0439433_0051694 | 3300041999 | Bacteria | 970 |
| 444 | Ga0439445_0000630 | 3300042004 | Bacteria | 7241 |
| 445 | Ga0439463_074968 | 3300042016 | Bacteria | 868 |
| 446 | Ga0439458_0138275 | 3300042157 | Bacteria | 648 |
| 447 | Ga0439434_0063102 | 3300042435 | Bacteria | 1160 |
| 448 | Ga0439459_0101286 | 3300042438 | Bacteria | 705 |
| 449 | Ga0451577_0513648 | 3300042876 | Bacteria | 1088 |
| 450 | Ga0451577_0518485 | 3300042876 | Bacteria | 1082 |
| 451 | Ga0466969_0018916 | 3300044656 | Bacteria | 3586 |
| 452 | Ga0466972_0004559 | 3300044658 | Bacteria | 6941 |
| 453 | Ga0466972_0261256 | 3300044658 | Bacteria | 809 |
| 454 | Ga0466972_0526363 | 3300044658 | Bacteria | 557 |
| 455 | Ga0466965_0001377 | 3300044683 | Bacteria | 9751 |
| 456 | Ga0466965_0009434 | 3300044683 | Bacteria | 4536 |
| 457 | Ga0466966_0003375 | 3300044684 | Bacteria | 10524 |
| 458 | Ga0466966_0043302 | 3300044684 | Bacteria | 2886 |
| 459 | Ga0466966_0170526 | 3300044684 | Bacteria | 1322 |
| 460 | Ga0466961_0030780 | 3300044693 | Bacteria | 3448 |
| 461 | Ga0466961_0037140 | 3300044693 | Bacteria | 3125 |
| 462 | Ga0466961_0491407 | 3300044693 | Bacteria | 741 |
| 463 | Ga0466963_0187646 | 3300044694 | Bacteria | 1444 |
| 464 | Ga0466964_0299145 | 3300044706 | Bacteria | 811 |
| 465 | Ga0466964_0549402 | 3300044706 | Bacteria | 627 |
| 466 | Ga0453684_1418889 | 3300044712 | Bacteria | 719 |
| 467 | Ga0466971_0000675 | 3300044719 | Bacteria | 13616 |
| 468 | Ga0466971_0123465 | 3300044719 | Bacteria | 1199 |
| 469 | Ga0466971_0136311 | 3300044719 | Bacteria | 1142 |
| 470 | Ga0466971_0513118 | 3300044719 | Bacteria | 592 |
| 471 | Ga0466968_0028149 | 3300044735 | Bacteria | 2316 |
| 472 | Ga0466968_0212703 | 3300044735 | Bacteria | 909 |
| 473 | Ga0466970_0001021 | 3300044765 | Bacteria | 13508 |
| 474 | Ga0466970_0206977 | 3300044765 | Bacteria | 1092 |
| 475 | Ga0466970_0797442 | 3300044765 | Bacteria | 553 |
| 476 | Ga0466970_0837813 | 3300044765 | Bacteria | 539 |
| 477 | Ga0466970_0964420 | 3300044765 | Bacteria | 503 |
| 478 | Ga0466957_0001124 | 3300044842 | Bacteria | 13849 |
| 479 | Ga0466957_0074145 | 3300044842 | Bacteria | 2110 |
| 480 | Ga0466957_0089846 | 3300044842 | Bacteria | 1923 |
| 481 | Ga0466957_0650656 | 3300044842 | Bacteria | 741 |
| 482 | Ga0466960_0002753 | 3300044901 | Bacteria | 6654 |
| 483 | Ga0466959_0003800 | 3300045049 | Bacteria | 10015 |
| 484 | Ga0466959_0015907 | 3300045049 | Bacteria | 5489 |
| 485 | Ga0466959_0025593 | 3300045049 | Bacteria | 4375 |
| 486 | Ga0466959_0041912 | 3300045049 | Bacteria | 3378 |
| 487 | Ga0466959_0677759 | 3300045049 | Bacteria | 691 |
| 488 | Ga0466958_0011830 | 3300045836 | Bacteria | 4927 |
| 489 | Ga0466958_0026511 | 3300045836 | Bacteria | 3425 |
| 490 | Ga0466967_0007609 | 3300045976 | Bacteria | 7833 |
| 491 | Ga0466967_0101371 | 3300045976 | Bacteria | 2631 |
| 492 | Ga0466967_0238227 | 3300045976 | Bacteria | 1735 |
| 493 | Ga0466967_0363566 | 3300045976 | Bacteria | 1402 |
| 494 | Ga0495627_039442 | 3300046453 | Bacteria | 1457 |
| 495 | Ga0495627_100262 | 3300046453 | Bacteria | 827 |
| 496 | Ga0495592_0005017 | 3300046454 | Bacteria | 9736 |
| 497 | Ga0495592_0008230 | 3300046454 | Bacteria | 7828 |
| 498 | Ga0495603_0159931 | 3300046455 | Bacteria | 1306 |
| 499 | Ga0495603_0206622 | 3300046455 | Bacteria | 1135 |
| 500 | Ga0495590_0211305 | 3300046457 | Bacteria | 715 |
| 501 | Ga0495629_0060688 | 3300046459 | Bacteria | 2642 |
| 502 | Ga0495629_0099847 | 3300046459 | Bacteria | 2025 |
| 503 | Ga0495629_0201351 | 3300046459 | Bacteria | 1376 |
| 504 | Ga0495638_0154030 | 3300046460 | Bacteria | 1331 |
| 505 | Ga0495651_0000169 | 3300046462 | Bacteria | 48128 |
| 506 | Ga0495651_0005300 | 3300046462 | Bacteria | 9832 |
| 507 | Ga0495639_0174429 | 3300046475 | Bacteria | 1045 |
| 508 | Ga0495662_0096445 | 3300046476 | Bacteria | 1445 |
| 509 | Ga0495664_0030225 | 3300046477 | Bacteria | 3172 |
| 510 | Ga0495664_0082835 | 3300046477 | Bacteria | 1924 |
| 511 | Ga0495584_0119624 | 3300046491 | Bacteria | 1334 |
| 512 | Ga0495585_0102174 | 3300046492 | Bacteria | 1532 |
| 513 | Ga0495585_0147735 | 3300046492 | Bacteria | 1227 |
| 514 | Ga0495594_0060133 | 3300046499 | Bacteria | 2101 |
| 515 | Ga0495594_0308584 | 3300046499 | Bacteria | 901 |
| 516 | Ga0495608_0060019 | 3300046511 | Bacteria | 2504 |
| 517 | Ga0495608_0756532 | 3300046511 | Bacteria | 575 |
| 518 | Ga0495618_0004578 | 3300046514 | Bacteria | 8485 |
| 519 | Ga0495618_0078305 | 3300046514 | Bacteria | 2107 |
| 520 | Ga0495620_0158527 | 3300046515 | Bacteria | 880 |
| 521 | Ga0495628_0062544 | 3300046516 | Bacteria | 2917 |
| 522 | Ga0495628_0262913 | 3300046516 | Bacteria | 1285 |
| 523 | Ga0495630_0095803 | 3300046517 | Bacteria | 2244 |
| 524 | Ga0495632_0010084 | 3300046519 | Bacteria | 5626 |
| 525 | Ga0495643_0003566 | 3300046522 | Bacteria | 11309 |
| 526 | Ga0495666_0065533 | 3300046526 | Bacteria | 1732 |
| 527 | Ga0495642_0072089 | 3300046528 | Bacteria | 1446 |
| 528 | Ga0495652_0001361 | 3300046529 | Bacteria | 27215 |
| 529 | Ga0495652_0006542 | 3300046529 | Bacteria | 10830 |
| 530 | Ga0495652_0549370 | 3300046529 | Bacteria | 794 |
| 531 | Ga0495640_0007026 | 3300046533 | Bacteria | 8862 |
| 532 | Ga0495586_0673227 | 3300046535 | Bacteria | 598 |
| 533 | Ga0495587_0033543 | 3300046536 | Bacteria | 3099 |
| 534 | Ga0495598_0085680 | 3300046537 | Bacteria | 1019 |
| 535 | Ga0495621_0166726 | 3300046539 | Bacteria | 874 |
| 536 | Ga0495645_0013381 | 3300046543 | Bacteria | 5798 |
| 537 | Ga0495622_0019219 | 3300046557 | Bacteria | 3182 |
| 538 | Ga0495633_0035752 | 3300046558 | Bacteria | 2384 |
| 539 | Ga0495667_0034127 | 3300046559 | Bacteria | 3401 |
| 540 | Ga0495667_0343976 | 3300046559 | Bacteria | 943 |
| 541 | Ga0495656_0044151 | 3300046615 | Bacteria | 1875 |
| 542 | Ga0495634_0003443 | 3300046642 | Bacteria | 12687 |
| 543 | Ga0495634_0121401 | 3300046642 | Bacteria | 1673 |
| 544 | Ga0495611_0048818 | 3300046648 | Bacteria | 1903 |
| 545 | Ga0495635_0010690 | 3300046663 | Bacteria | 6426 |
| 546 | Ga0495635_1068681 | 3300046663 | Bacteria | 512 |
| 547 | Ga0495588_0032147 | 3300046674 | Bacteria | 2643 |
| 548 | Ga0495657_0004038 | 3300046675 | Bacteria | 11767 |
| 549 | Ga0495623_0003245 | 3300046679 | Bacteria | 10749 |
| 550 | Ga0495623_0004870 | 3300046679 | Bacteria | 8804 |
| 551 | Ga0495623_0420944 | 3300046679 | Bacteria | 716 |
| 552 | Ga0495646_0008701 | 3300046680 | Bacteria | 6449 |
| 553 | Ga0495658_0040123 | 3300046683 | Bacteria | 2601 |
| 554 | Ga0495613_0005971 | 3300046689 | Bacteria | 9111 |
| 555 | Ga0495613_0209276 | 3300046689 | Bacteria | 1372 |
| 556 | Ga0495624_0059145 | 3300046690 | Bacteria | 2405 |
| 557 | Ga0495670_0007585 | 3300046691 | Bacteria | 5334 |
| 558 | Ga0495671_0120169 | 3300046692 | Bacteria | 1282 |
| 559 | Ga0495600_0007794 | 3300046809 | Bacteria | 6556 |
| 560 | Ga0495600_0039421 | 3300046809 | Bacteria | 3076 |
| 561 | Ga0495600_0373910 | 3300046809 | Bacteria | 890 |
| 562 | Ga0495600_0721783 | 3300046809 | Bacteria | 598 |
| 563 | Ga0495660_0002768 | 3300046810 | Bacteria | 11062 |
| 564 | Ga0495604_0003385 | 3300047317 | Bacteria | 12717 |
| 565 | Ga0495604_0004624 | 3300047317 | Bacteria | 10906 |
| 566 | Ga0495604_0617798 | 3300047317 | Bacteria | 694 |
| 567 | Ga0495604_0800277 | 3300047317 | Bacteria | 594 |
| 568 | Ga0495636_0182572 | 3300047318 | Bacteria | 953 |
| 569 | Ga0495636_0498302 | 3300047318 | Bacteria | 589 |
| 570 | Ga0495676_0015246 | 3300047321 | Bacteria | 6851 |
| 571 | Ga0495676_0879911 | 3300047321 | Bacteria | 574 |
| 572 | Ga0495680_0125418 | 3300047322 | Bacteria | 1892 |
| 573 | Ga0495680_0673789 | 3300047322 | Bacteria | 685 |
| 574 | Ga0495680_1052841 | 3300047322 | Bacteria | 517 |
| 575 | Ga0495683_0013097 | 3300047323 | Bacteria | 4342 |
| 576 | Ga0495687_025550 | 3300047443 | Bacteria | 2789 |
| 577 | Ga0495687_259525 | 3300047443 | Bacteria | 514 |
| 578 | Ga0495675_0001497 | 3300047444 | Bacteria | 14149 |
| 579 | Ga0495675_0088539 | 3300047444 | Bacteria | 1944 |
| 580 | Ga0495675_0089338 | 3300047444 | Bacteria | 1934 |
| 581 | Ga0495675_0225518 | 3300047444 | Bacteria | 1132 |
| 582 | Ga0495675_0435149 | 3300047444 | Bacteria | 760 |
| 583 | Ga0495677_0116944 | 3300047445 | Bacteria | 1016 |
| 584 | Ga0495679_019249 | 3300047446 | Bacteria | 2403 |
| 585 | Ga0495685_000455 | 3300047447 | Bacteria | 12772 |
| 586 | Ga0495685_013987 | 3300047447 | Bacteria | 2723 |
| 587 | Ga0495681_0001916 | 3300047470 | Bacteria | 15254 |
| 588 | Ga0495681_0305262 | 3300047470 | Bacteria | 615 |
| 589 | Ga0495686_0041778 | 3300047472 | Bacteria | 2918 |
| 590 | Ga0495602_0070215 | 3300048088 | Bacteria | 2999 |
| 591 | Ga0495614_0076371 | 3300048089 | Bacteria | 1448 |
| 592 | Ga0496100_0035427 | 3300048903 | Bacteria | 3139 |
| 593 | Ga0496100_0059373 | 3300048903 | Bacteria | 2513 |
| 594 | Ga0496100_1238589 | 3300048903 | Bacteria | 589 |
| 595 | Ga0496101_0000075 | 3300048904 | Bacteria | 112785 |
| 596 | Ga0496101_0011872 | 3300048904 | Bacteria | 5799 |
| 597 | Ga0496101_0023265 | 3300048904 | Bacteria | 4279 |
| 598 | Ga0496101_0488628 | 3300048904 | Bacteria | 972 |
| 599 | Ga0496102_0000003 | 3300048905 | Bacteria | 592263 |
| 600 | Ga0496102_0067122 | 3300048905 | Bacteria | 3289 |
| 601 | Ga0496102_0096537 | 3300048905 | Bacteria | 2740 |
| 602 | Ga0496102_0577213 | 3300048905 | Bacteria | 1047 |
| 603 | Ga0496103_0000014 | 3300048906 | Bacteria | 290397 |
| 604 | Ga0496104_0093759 | 3300048907 | Bacteria | 2872 |
| 605 | Ga0496104_0096185 | 3300048907 | Bacteria | 2833 |
| 606 | Ga0496104_0117995 | 3300048907 | Bacteria | 2547 |
| 607 | Ga0496105_0269046 | 3300048908 | Bacteria | 1377 |
| 608 | Ga0496105_0832106 | 3300048908 | Bacteria | 700 |
| 609 | Ga0496106_0138601 | 3300048909 | Bacteria | 1912 |
| 610 | Ga0496106_0147980 | 3300048909 | Bacteria | 1851 |
| 611 | Ga0496107_0061966 | 3300048910 | Bacteria | 2709 |
| 612 | Ga0496107_1119752 | 3300048910 | Bacteria | 568 |
| 613 | Ga0496107_1382665 | 3300048910 | Bacteria | 501 |
| 614 | Ga0496108_0085000 | 3300048911 | Bacteria | 2685 |
| 615 | Ga0496108_0253120 | 3300048911 | Bacteria | 1532 |
| 616 | Ga0496108_0360301 | 3300048911 | Bacteria | 1269 |
| 617 | Ga0496108_0462748 | 3300048911 | Bacteria | 1108 |
| 618 | Ga0496109_0058771 | 3300048912 | Bacteria | 3512 |
| 619 | Ga0496109_0165475 | 3300048912 | Bacteria | 2073 |
| 620 | Ga0496109_0181473 | 3300048912 | Bacteria | 1977 |
| 621 | Ga0496109_0540907 | 3300048912 | Bacteria | 1099 |
| 622 | Ga0496110_0085776 | 3300048913 | Bacteria | 2810 |
| 623 | Ga0496110_0275300 | 3300048913 | Bacteria | 1533 |
| 624 | Ga0496111_0039375 | 3300048914 | Bacteria | 3388 |
| 625 | Ga0496112_0011626 | 3300048915 | Bacteria | 8051 |
| 626 | Ga0496112_0155384 | 3300048915 | Bacteria | 2254 |
| 627 | Ga0496113_0003233 | 3300048916 | Bacteria | 9720 |
| 628 | Ga0496113_0018053 | 3300048916 | Bacteria | 4908 |
| 629 | Ga0496114_0009605 | 3300048917 | Bacteria | 7684 |
| 630 | Ga0496114_0020960 | 3300048917 | Bacteria | 5309 |
| 631 | Ga0496114_0535943 | 3300048917 | Bacteria | 1035 |
| 632 | Ga0496115_0326798 | 3300048918 | Bacteria | 1254 |
| 633 | Ga0496116_0000071 | 3300048919 | Bacteria | 244521 |
| 634 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 635 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 636 | Ga0496119_0000527 | 3300048922 | Bacteria | 52100 |
| 637 | Ga0496119_0121327 | 3300048922 | Bacteria | 1436 |
| 638 | Ga0496119_0181343 | 3300048922 | Bacteria | 1104 |
| 639 | Ga0496120_0000235 | 3300048923 | Bacteria | 94653 |
| 640 | Ga0496121_0000019 | 3300048924 | Bacteria | 499976 |
| 641 | Ga0496122_0015410 | 3300048925 | Bacteria | 7309 |
| 642 | Ga0496123_0006264 | 3300048926 | Bacteria | 11592 |
| 643 | Ga0496126_0000951 | 3300048929 | Bacteria | 49637 |
| 644 | Ga0496126_0011441 | 3300048929 | Bacteria | 9184 |
| 645 | Ga0496126_0020119 | 3300048929 | Bacteria | 6552 |
| 646 | Ga0496126_0432601 | 3300048929 | Bacteria | 1062 |
| 647 | Ga0496126_0495762 | 3300048929 | Bacteria | 977 |
| 648 | Ga0496126_1242094 | 3300048929 | Bacteria | 546 |
| 649 | Ga0496126_1308979 | 3300048929 | Bacteria | 527 |
| 650 | Ga0501306_008396 | 3300049127 | Bacteria | 1259 |
| 651 | Ga0501306_030508 | 3300049127 | Bacteria | 799 |
| 652 | Ga0501308_020253 | 3300049128 | Bacteria | 827 |
| 653 | Ga0501309_013241 | 3300049129 | Bacteria | 1095 |
| 654 | Ga0501309_044144 | 3300049129 | Bacteria | 687 |
| 655 | Ga0501310_021149 | 3300049130 | Bacteria | 812 |
| 656 | Ga0501304_040726 | 3300049160 | Bacteria | 518 |
| 657 | Ga0501305_022556 | 3300049161 | Bacteria | 937 |
| 658 | Ga0501307_036495 | 3300049162 | Bacteria | 701 |
| 659 | Ga0501307_053000 | 3300049162 | Bacteria | 614 |
| 660 | Ga0501311_014031 | 3300049527 | Bacteria | 1019 |
| 661 | Ga0501311_101720 | 3300049527 | Bacteria | 509 |
| 662 | Ga0501312_023268 | 3300049528 | Bacteria | 932 |
| 663 | Ga0501312_053178 | 3300049528 | Bacteria | 687 |
| 664 | Ga0501312_075695 | 3300049528 | Bacteria | 603 |
| 665 | Ga0501314_001561 | 3300049530 | Bacteria | 1674 |
| 666 | Ga0501315_100865 | 3300049531 | Bacteria | 510 |
| 667 | Ga0501316_006966 | 3300049532 | Bacteria | 1217 |
| 668 | Ga0501316_008288 | 3300049532 | Bacteria | 1145 |
| 669 | Ga0501317_013188 | 3300049533 | Bacteria | 1030 |
| 670 | Ga0501317_013275 | 3300049533 | Bacteria | 1028 |
| 671 | Ga0501317_050835 | 3300049533 | Bacteria | 658 |
| 672 | Ga0501318_012530 | 3300049534 | Bacteria | 974 |
| 673 | Ga0501321_005201 | 3300049537 | Bacteria | 1277 |
| 674 | Ga0501321_061930 | 3300049537 | Bacteria | 567 |
| 675 | Ga0501324_014639 | 3300049540 | Bacteria | 754 |
| 676 | Ga0501324_047228 | 3300049540 | Bacteria | 503 |
| 677 | Ga0501325_011299 | 3300049541 | Bacteria | 823 |
| 678 | Ga0501336_025574 | 3300049552 | Bacteria | 559 |
| 679 | Ga0501031_0003261 | 3300049568 | Bacteria | 10426 |
| 680 | Ga0501032_0001347 | 3300049569 | Bacteria | 19514 |
| 681 | Ga0501032_0221765 | 3300049569 | Bacteria | 1230 |
| 682 | Ga0501032_0650407 | 3300049569 | Bacteria | 669 |
| 683 | Ga0501033_0005545 | 3300049570 | Bacteria | 9978 |
| 684 | Ga0501034_0011756 | 3300049571 | Bacteria | 9058 |
| 685 | Ga0501034_0177975 | 3300049571 | Bacteria | 2092 |
| 686 | Ga0501036_0074674 | 3300049572 | Bacteria | 2867 |
| 687 | Ga0501036_0302136 | 3300049572 | Bacteria | 1338 |
| 688 | Ga0501037_0004030 | 3300049573 | Bacteria | 10649 |
| 689 | Ga0501038_0007465 | 3300049574 | Bacteria | 10087 |
| 690 | Ga0501038_0130009 | 3300049574 | Bacteria | 2068 |
| 691 | Ga0501038_0992853 | 3300049574 | Bacteria | 617 |
| 692 | Ga0501039_0003016 | 3300049575 | Bacteria | 12590 |
| 693 | Ga0501039_0341118 | 3300049575 | Bacteria | 1177 |
| 694 | Ga0501040_0002706 | 3300049576 | Bacteria | 11426 |
| 695 | Ga0501040_0047321 | 3300049576 | Bacteria | 2938 |
| 696 | Ga0501041_0002671 | 3300049577 | Bacteria | 10179 |
| 697 | Ga0501041_0723543 | 3300049577 | Bacteria | 637 |
| 698 | Ga0501042_0073359 | 3300049578 | Bacteria | 2448 |
| 699 | Ga0501042_0088501 | 3300049578 | Bacteria | 2221 |
| 700 | Ga0501042_0736570 | 3300049578 | Bacteria | 717 |
| 701 | Ga0501043_0028012 | 3300049579 | Bacteria | 4421 |
| 702 | Ga0501043_0274529 | 3300049579 | Bacteria | 1293 |
| 703 | Ga0501046_0002011 | 3300049580 | Bacteria | 19297 |
| 704 | Ga0501046_0473748 | 3300049580 | Bacteria | 899 |
| 705 | Ga0501047_0000278 | 3300049581 | Bacteria | 59271 |
| 706 | Ga0501047_0008040 | 3300049581 | Bacteria | 9951 |
| 707 | Ga0501047_0119157 | 3300049581 | Bacteria | 2521 |
| 708 | Ga0501047_0220639 | 3300049581 | Bacteria | 1752 |
| 709 | Ga0501048_0001026 | 3300049582 | Bacteria | 20878 |
| 710 | Ga0501067_0000592 | 3300049583 | Bacteria | 19503 |
| 711 | Ga0501068_0003271 | 3300049584 | Bacteria | 8684 |
| 712 | Ga0501069_0005589 | 3300049585 | Bacteria | 6539 |
| 713 | Ga0501070_0004123 | 3300049586 | Bacteria | 12503 |
| 714 | Ga0501071_0045415 | 3300049587 | Bacteria | 3153 |
| 715 | Ga0501072_0001152 | 3300049588 | Bacteria | 19660 |
| 716 | Ga0501072_0054085 | 3300049588 | Bacteria | 3162 |
| 717 | Ga0501073_0004460 | 3300049589 | Bacteria | 10515 |
| 718 | Ga0501074_0003829 | 3300049590 | Bacteria | 10704 |
| 719 | Ga0501074_0881490 | 3300049590 | Bacteria | 630 |
| 720 | Ga0501075_0343782 | 3300049591 | Bacteria | 1137 |
| 721 | Ga0501076_0010773 | 3300049592 | Bacteria | 6796 |
| 722 | Ga0501077_0031876 | 3300049593 | Bacteria | 3353 |
| 723 | Ga0501221_200839 | 3300049704 | Bacteria | 554 |
| 724 | Ga0501079_0007489 | 3300049741 | Bacteria | 8256 |
| 725 | Ga0501080_0091006 | 3300049742 | Bacteria | 2833 |
| 726 | Ga0501080_0144771 | 3300049742 | Bacteria | 2197 |
| 727 | Ga0501083_0008844 | 3300049744 | Bacteria | 7110 |
| 728 | Ga0501035_0097200 | 3300049822 | Bacteria | 2586 |
| 729 | Ga0501035_0122555 | 3300049822 | Bacteria | 2271 |
| 730 | Ga0501044_0010423 | 3300049823 | Bacteria | 10087 |
| 731 | Ga0501044_0301918 | 3300049823 | Bacteria | 1529 |
| 732 | Ga0501044_1015399 | 3300049823 | Bacteria | 701 |
| 733 | Ga0501045_0005656 | 3300049824 | Bacteria | 8648 |
| 734 | Ga0501045_0366432 | 3300049824 | Bacteria | 1072 |
| 735 | nmdc:mga03683_482660_c1 | 3300050489 | Bacteria | 599 |
| 736 | nmdc:mga03n38_128391_c1 | 3300050490 | Bacteria | 1254 |
| 737 | nmdc:mga00v17_286344_c1 | 3300050491 | Bacteria | 1070 |
| 738 | nmdc:mga00v17_326959_c1 | 3300050491 | Bacteria | 996 |
| 739 | nmdc:mga00v17_361571_c1 | 3300050491 | Bacteria | 944 |
| 740 | nmdc:mga00v17_452689_c1 | 3300050491 | Bacteria | 833 |
| 741 | nmdc:mga00v17_64510_c1 | 3300050491 | Bacteria | 2257 |
| 742 | nmdc:mga00v17_72839_c1 | 3300050491 | Bacteria | 2132 |
| 743 | nmdc:mga0yw44_21262_c1 | 3300050492 | Bacteria | 3616 |
| 744 | nmdc:mga0yw44_59749_c1 | 3300050492 | Bacteria | 2333 |
| 745 | nmdc:mga07m45_696255_c1 | 3300050496 | Bacteria | 584 |
| 746 | nmdc:mga05p37_64020_c1 | 3300050507 | Bacteria | 4524 |
| 747 | nmdc:mga0rr50_1593263_c1 | 3300050513 | Bacteria | 551 |
| 748 | nmdc:mga0sz30_13994_c1 | 3300050516 | Bacteria | 3151 |
| 749 | nmdc:mga0sz30_86476_c1 | 3300050516 | Bacteria | 1361 |
| 750 | Ga0495601_0044431 | 3300053077 | Bacteria | 2792 |
| 751 | Ga0495612_0001114 | 3300053078 | Bacteria | 11005 |
| 752 | Ga0495655_0105304 | 3300053083 | Bacteria | 841 |
| 753 | Ga0495595_0600755 | 3300053084 | Bacteria | 563 |
| 754 | Ga0495619_0039496 | 3300053085 | Bacteria | 3081 |
| 755 | Ga0500578_0006009 | 3300053086 | Bacteria | 8160 |
| 756 | Ga0500583_0132654 | 3300053092 | Bacteria | 1236 |
| 757 | Ga0500651_0490205 | 3300053093 | Bacteria | 679 |
| 758 | Ga0500566_0009561 | 3300053094 | Bacteria | 5727 |
| 759 | Ga0500654_002699 | 3300053099 | Bacteria | 12710 |
| 760 | Ga0500660_024964 | 3300053100 | Bacteria | 3158 |
| 761 | Ga0500558_064320 | 3300053106 | Bacteria | 1525 |
| 762 | Ga0500560_117181 | 3300053107 | Bacteria | 893 |
| 763 | Ga0500569_000210 | 3300053109 | Bacteria | 9330 |
| 764 | Ga0500580_110091 | 3300053113 | Bacteria | 1067 |
| 765 | Ga0500594_0039080 | 3300053118 | Bacteria | 1289 |
| 766 | Ga0500608_308905 | 3300053122 | Bacteria | 582 |
| 767 | Ga0500614_165070 | 3300053123 | Bacteria | 672 |
| 768 | Ga0500621_092407 | 3300053126 | Bacteria | 1202 |
| 769 | Ga0500628_080887 | 3300053129 | Bacteria | 831 |
| 770 | Ga0500652_001087 | 3300053131 | Bacteria | 8784 |
| 771 | Ga0500658_0002819 | 3300053134 | Bacteria | 6668 |
| 772 | Ga0500659_0289263 | 3300053135 | Bacteria | 742 |
| 773 | Ga0500559_0449843 | 3300053136 | Bacteria | 596 |
| 774 | Ga0500561_0000167 | 3300053137 | Bacteria | 12188 |
| 775 | Ga0500568_0027056 | 3300053139 | Bacteria | 2401 |
| 776 | Ga0500573_0032934 | 3300053140 | Bacteria | 2990 |
| 777 | Ga0500573_0180499 | 3300053140 | Bacteria | 1135 |
| 778 | Ga0500573_0332596 | 3300053140 | Bacteria | 745 |
| 779 | Ga0500577_0183465 | 3300053142 | Bacteria | 898 |
| 780 | Ga0500579_134694 | 3300053143 | Bacteria | 1140 |
| 781 | Ga0500586_242712 | 3300053145 | Bacteria | 569 |
| 782 | Ga0500588_0313911 | 3300053146 | Bacteria | 594 |
| 783 | Ga0500600_0006438 | 3300053149 | Bacteria | 7001 |
| 784 | Ga0500603_051840 | 3300053150 | Bacteria | 1125 |
| 785 | Ga0500616_0004474 | 3300053153 | Bacteria | 9936 |
| 786 | Ga0500616_0006073 | 3300053153 | Bacteria | 8012 |
| 787 | Ga0500627_0195703 | 3300053158 | Bacteria | 907 |
| 788 | Ga0500630_091102 | 3300053159 | Bacteria | 1408 |
| 789 | Ga0500633_0000736 | 3300053160 | Bacteria | 5570 |
| 790 | Ga0500634_0024229 | 3300053161 | Bacteria | 3300 |
| 791 | Ga0500636_0215330 | 3300053177 | Bacteria | 1005 |
| 792 | Ga0500636_0313595 | 3300053177 | Bacteria | 766 |
| 793 | Ga0500656_000179 | 3300053732 | Bacteria | 4156 |
| 794 | Ga0500587_000176 | 3300053739 | Bacteria | 6411 |
| 795 | Ga0500587_012825 | 3300053739 | Bacteria | 1057 |
| 796 | Ga0501084_0001550 | 3300054114 | Bacteria | 18271 |
| 797 | Ga0587084_020265 | 3300059477 | Bacteria | 987 |
| 798 | Ga0587084_033914 | 3300059477 | Bacteria | 836 |
| 799 | Ga0587073_0074026 | 3300059492 | Bacteria | 830 |
| 800 | Ga0587073_0078929 | 3300059492 | Bacteria | 813 |
| 801 | Ga0587073_0116826 | 3300059492 | Bacteria | 715 |
| 802 | Ga0587077_085610 | 3300059493 | Bacteria | 732 |
| 803 | Ga0587077_113410 | 3300059493 | Bacteria | 667 |
| 804 | Ga0587080_099869 | 3300059503 | Bacteria | 620 |
| 805 | Ga0587082_022401 | 3300059504 | Bacteria | 1039 |
| 806 | Ga0587083_0206547 | 3300059505 | Bacteria | 564 |
| 807 | Ga0587085_178273 | 3300059506 | Bacteria | 508 |
| 808 | Ga0587088_042869 | 3300059508 | Bacteria | 859 |
| 809 | Ga0587090_028502 | 3300059510 | Bacteria | 920 |
| 810 | Ga0587090_082861 | 3300059510 | Bacteria | 645 |
| 811 | Ga0587092_044616 | 3300059512 | Bacteria | 783 |
| 812 | Ga0587098_005666 | 3300059604 | Bacteria | 1235 |
| 813 | Ga0587098_007546 | 3300059604 | Bacteria | 1135 |
| 814 | Ga0587106_009824 | 3300059605 | Bacteria | 1226 |
| 815 | Ga0587125_038170 | 3300059607 | Bacteria | 639 |
| 816 | Ga0587129_006660 | 3300059608 | Bacteria | 821 |
| 817 | Ga0587101_032470 | 3300059623 | Bacteria | 822 |
| 818 | Ga0587109_046161 | 3300059624 | Bacteria | 880 |
| 819 | Ga0587117_028126 | 3300059627 | Bacteria | 831 |
| 820 | Ga0587067_023577 | 3300059640 | Bacteria | 1080 |
| 821 | Ga0587067_028532 | 3300059640 | Bacteria | 1014 |
| 822 | Ga0587072_107055 | 3300059643 | Bacteria | 634 |
| 823 | Ga0587079_076859 | 3300059647 | Bacteria | 756 |
| 824 | Ga0587100_018129 | 3300059648 | Bacteria | 666 |
| 825 | Ga0587102_015709 | 3300059649 | Bacteria | 807 |
| 826 | Ga0587107_014459 | 3300059652 | Bacteria | 1015 |
| 827 | Ga0587119_018189 | 3300059658 | Bacteria | 875 |
| 828 | Ga0587124_012606 | 3300059660 | Bacteria | 783 |
| 829 | Ga0587071_016330 | 3300060344 | Bacteria | 1313 |
| 830 | Ga0587071_163019 | 3300060344 | Bacteria | 562 |
| 831 | Ga0587111_0001599 | 3300060346 | Bacteria | 2785 |
| 832 | Ga0587111_0082473 | 3300060346 | Bacteria | 771 |
| 833 | Ga0501082_0013322 | 3300060353 | Bacteria | 7070 |
| 834 | Ga0501082_0309796 | 3300060353 | Bacteria | 1375 |
| 835 | Ga0466962_0000160 | 3300061719 | Bacteria | 28430 |
| 836 | Ga0466962_0032722 | 3300061719 | Bacteria | 2488 |
| 837 | Ga0466962_0111398 | 3300061719 | Bacteria | 1318 |
| 838 | Ga0466962_0111769 | 3300061719 | Bacteria | 1315 |
| 839 | Ga0466962_0454679 | 3300061719 | Bacteria | 645 |
| 840 | 2554256784 | 2554235005 | Bacteria | 6457341 |
| 841 | 2644014453 | 2643221601 | Bacteria | 7493239 |
| 842 | 2644175890 | 2643221631 | Bacteria | 8168043 |
| 843 | 2793976332 | 2791355406 | Bacteria | 11364898 |
| 844 | 2819742258 | 2818991472 | Bacteria | 10089953 |
| 845 | 2867481061 | 2867475112 | Bacteria | 6909112 |
| 846 | 2912718451 | 2912715099 | Bacteria | 9460473 |
| 847 | 2990092165 | 2990088156 | Bacteria | 6657676 |
| 848 | 3006326219 | 3006321560 | Bacteria | 8247479 |
| 849 | 3006427943 | 3006425503 | Bacteria | 6491253 |
| 850 | 8025486085 | 8025478263 | Bacteria | 8209203 |
| 851 | 8047896979 | 8047893842 | Bacteria | 11723082 |
| 852 | 8048132579 | 8048127548 | Bacteria | 11053136 |
| 853 | 8048361973 | 8048356638 | Bacteria | 11044339 |
| 854 | 8048373964 | 8048369669 | Bacteria | 11666822 |
| 855 | 8048384263 | 8048379754 | Bacteria | 11877923 |
| 856 | 8054160791 | 8054160619 | Bacteria | 7783213 |
| 857 | 8056447903 | 8056447290 | Bacteria | 7680491 |
| 858 | 8056673136 | 8056667051 | Bacteria | 6953971 |
| 859 | Ga0501037_0392039 | |||
| 860 | JGI25160J50197_1032287 | |||
| 861 | Ga0058859_10027059 | |||
| 862 | Ga0058861_12031117 | |||
| 863 | Ga0058860_10020864 | |||
| 864 | Ga0058860_12055840 | |||
| 865 | Ga0058862_10019043 | |||
| 866 | Ga0058862_12685021 | |||
| 867 | Ga0070658_11036574 | |||
| 868 | Ga0070683_100243292 | |||
| 869 | Ga0070683_100730630 | |||
| 870 | Ga0070683_101138786 | |||
| 871 | Ga0070670_100425233 | |||
| 872 | Ga0070670_100760505 | |||
| 873 | Ga0068869_100293072 | |||
| 874 | Ga0070682_100283454 | |||
| 875 | Ga0070682_100420354 | |||
| 876 | Ga0068868_100719583 | |||
| 877 | Ga0068868_101528756 | |||
| 878 | Ga0070660_100392575 | |||
| 879 | Ga0070689_100898597 | |||
| 880 | Ga0070687_100565731 | |||
| 881 | Ga0070661_100303924 | |||
| 882 | Ga0070692_10467664 | |||
| 883 | Ga0070692_11211312 | |||
| 884 | Ga0070668_100198226 | |||
| 885 | Ga0070668_101450308 | |||
| 886 | Ga0070669_101860188 | |||
| 887 | Ga0070675_100820281 | |||
| 888 | Ga0070671_100314327 | |||
| 889 | Ga0070671_100546495 | |||
| 890 | Ga0070674_101090453 | |||
| 891 | Ga0070674_101177552 | |||
| 892 | Ga0070673_100855117 | |||
| 893 | Ga0070673_101041985 | |||
| 894 | Ga0070659_100346616 | |||
| 895 | Ga0070659_101468914 | |||
| 896 | Ga0070667_100005984 | |||
| 897 | Ga0070667_100313417 | |||
| 898 | Ga0070667_100552437 | |||
| 899 | Ga0070703_10117275 | |||
| 900 | Ga0070714_100233697 | |||
| 901 | Ga0070714_100319510 | |||
| 902 | Ga0070713_100004669 | |||
| 903 | Ga0070701_10842954 | |||
| 904 | Ga0070711_100253031 | |||
| 905 | Ga0070700_100780034 | |||
| 906 | Ga0070700_101998074 | |||
| 907 | Ga0070663_100166935 | |||
| 908 | Ga0070678_100132027 | |||
| 909 | Ga0070678_100420815 | |||
| 910 | Ga0070678_101247103 | |||
| 911 | Ga0070678_101280762 | |||
| 912 | Ga0070662_100552981 | |||
| 913 | Ga0070662_101939477 | |||
| 914 | Ga0068867_100312233 | |||
| 915 | Ga0070685_10284947 | |||
| 916 | Ga0070685_11409986 | |||
| 917 | Ga0070685_11481707 | |||
| 918 | Ga0070706_101774999 | |||
| 919 | Ga0070679_101137379 | |||
| 920 | Ga0070679_101142826 | |||
| 921 | Ga0070679_101800756 | |||
| 922 | Ga0070684_100285523 | |||
| 923 | Ga0070672_100582283 | |||
| 924 | Ga0070672_101372942 | |||
| 925 | Ga0070686_100186467 | |||
| 926 | Ga0070686_101484268 | |||
| 927 | Ga0070693_100400377 | |||
| 928 | Ga0070693_101028264 | |||
| 929 | Ga0070665_100125445 | |||
| 930 | Ga0070665_102611067 | |||
| 931 | Ga0070664_100611988 | |||
| 932 | Ga0070664_100964697 | |||
| 933 | Ga0068857_100367935 | |||
| 934 | Ga0068854_101954602 | |||
| 935 | Ga0068856_100781514 | |||
| 936 | Ga0068856_101071620 | |||
| 937 | Ga0070702_100134868 | |||
| 938 | Ga0068852_100025908 | |||
| 939 | Ga0068852_100649273 | |||
| 940 | Ga0068852_101215577 | |||
| 941 | Ga0068859_100743950 | |||
| 942 | Ga0068864_100521326 | |||
| 943 | Ga0068864_100627925 | |||
| 944 | Ga0068866_10632194 | |||
| 945 | Ga0068861_100130584 | |||
| 946 | Ga0068851_10299893 | |||
| 947 | Ga0068870_10582921 | |||
| 948 | Ga0068870_11409036 | |||
| 949 | Ga0068863_100342072 | |||
| 950 | Ga0068863_101686661 | |||
| 951 | Ga0068858_100000013 | |||
| 952 | Ga0068858_100212121 | |||
| 953 | Ga0068860_100780105 | |||
| 954 | Ga0081455_10106856 | |||
| 955 | Ga0081455_10386216 | |||
| 956 | Ga0081455_10547032 | |||
| 957 | Ga0081540_1005568 | |||
| 958 | Ga0070717_11314727 | |||
| 959 | Ga0075365_10006681 | |||
| 960 | Ga0075365_10075797 | |||
| 961 | Ga0075365_10855404 | |||
| 962 | Ga0075365_10948699 | |||
| 963 | Ga0075363_100038892 | |||
| 964 | Ga0075364_10048616 | |||
| 965 | Ga0075364_10202272 | |||
| 966 | Ga0075364_10208663 | |||
| 967 | Ga0075364_10683225 | |||
| 968 | Ga0075369_10032174 | |||
| 969 | Ga0075369_10361646 | |||
| 970 | Ga0075366_10421996 | |||
| 971 | Ga0097621_100222109 | |||
| 972 | Ga0075370_10988178 | |||
| 973 | Ga0068871_101351922 | |||
| 974 | Ga0068865_100534181 | |||
| 975 | Ga0097620_100743961 | |||
| 976 | Ga0105244_10272877 | |||
| 977 | Ga0105244_10576351 | |||
| 978 | Ga0105250_10195966 | |||
| 979 | Ga0111539_11678634 | |||
| 980 | Ga0105245_10059566 | |||
| 981 | Ga0105245_10078141 | |||
| 982 | Ga0105245_10116828 | |||
| 983 | Ga0105245_10388478 | |||
| 984 | Ga0105247_10161516 | |||
| 985 | Ga0105247_10252526 | |||
| 986 | Ga0105247_11306377 | |||
| 987 | Ga0105243_10683988 | |||
| 988 | Ga0105243_10987054 | |||
| 989 | Ga0105243_11658954 | |||
| 990 | Ga0105241_10074305 | |||
| 991 | Ga0105241_10738320 | |||
| 992 | Ga0105241_11899740 | |||
| 993 | Ga0105242_10262583 | |||
| 994 | Ga0105242_10413133 | |||
| 995 | Ga0105242_10643137 | |||
| 996 | Ga0105248_10096561 | |||
| 997 | Ga0105248_10150854 | |||
| 998 | Ga0105248_10372568 | |||
| 999 | Ga0105248_11187432 | |||
| 1000 | Ga0105237_10009127 | |||
| 1001 | Ga0105238_10409424 | |||
| 1002 | Ga0105238_11431897 | |||
| 1003 | Ga0105249_10632895 | |||
| 1004 | Ga0105249_11724993 | |||
| 1005 | Ga0105249_12478515 | |||
| 1006 | Ga0105239_10005526 | |||
| 1007 | Ga0105239_10942334 | |||
| 1008 | Ga0105239_11459766 | |||
| 1009 | Ga0105246_10813620 | |||
| 1010 | Ga0105246_10995822 | |||
| 1011 | Ga0105246_11572961 | |||
| 1012 | Ga0105246_12571340 | |||
| 1013 | Ga0157337_1005161 | |||
| 1014 | Ga0157322_1001742 | |||
| 1015 | Ga0157327_1044190 | |||
| 1016 | Ga0157326_1022361 | |||
| 1017 | Ga0157371_10483286 | |||
| 1018 | Ga0157370_10950512 | |||
| 1019 | Ga0157370_11509372 | |||
| 1020 | Ga0157369_10156154 | |||
| 1021 | Ga0157369_10990050 | |||
| 1022 | Ga0157369_12484095 | |||
| 1023 | Ga0157374_10290071 | |||
| 1024 | Ga0157374_11027292 | |||
| 1025 | Ga0157374_11830770 | |||
| 1026 | Ga0157374_12382849 | |||
| 1027 | Ga0157378_11790932 | |||
| 1028 | Ga0157378_11996588 | |||
| 1029 | Ga0157378_12095641 | |||
| 1030 | Ga0163162_10127782 | |||
| 1031 | Ga0163162_10882261 | |||
| 1032 | Ga0163162_12321706 | |||
| 1033 | Ga0157372_11358944 | |||
| 1034 | Ga0157372_11397875 | |||
| 1035 | Ga0157372_11521351 | |||
| 1036 | Ga0157372_12980673 | |||
| 1037 | Ga0157375_10016636 | |||
| 1038 | Ga0157375_10268334 | |||
| 1039 | Ga0157375_11680425 | |||
| 1040 | Ga0157375_12579190 | |||
| 1041 | Ga0163163_10057195 | |||
| 1042 | Ga0163163_10395536 | |||
| 1043 | Ga0163163_10743846 | |||
| 1044 | Ga0163163_11532606 | |||
| 1045 | Ga0157380_10408869 | |||
| 1046 | Ga0157380_11088257 | |||
| 1047 | Ga0157380_11921502 | |||
| 1048 | Ga0157380_12077116 | |||
| 1049 | Ga0157380_12279246 | |||
| 1050 | Ga0182008_10724126 | |||
| 1051 | Ga0157377_10099821 | |||
| 1052 | Ga0157377_11215011 | |||
| 1053 | Ga0157379_10000012 | |||
| 1054 | Ga0157379_10579836 | |||
| 1055 | Ga0157376_10234942 | |||
| 1056 | Ga0163161_11128673 | |||
| 1057 | Ga0163161_11297982 | |||
| 1058 | Ga0197907_10433734 | |||
| 1059 | Ga0197907_10477661 | |||
| 1060 | Ga0197907_11152397 | |||
| 1061 | Ga0206356_10344010 | |||
| 1062 | Ga0206356_11141088 | |||
| 1063 | Ga0206356_11473966 | |||
| 1064 | Ga0206349_1334537 | |||
| 1065 | Ga0206349_1527023 | |||
| 1066 | Ga0206349_1563816 | |||
| 1067 | Ga0206349_1899702 | |||
| 1068 | Ga0206355_1431124 | |||
| 1069 | Ga0206355_1519402 | |||
| 1070 | Ga0206355_1612783 | |||
| 1071 | Ga0206351_10233981 | |||
| 1072 | Ga0206351_10393194 | |||
| 1073 | Ga0206351_10580594 | |||
| 1074 | Ga0206351_10619467 | |||
| 1075 | Ga0206352_10732747 | |||
| 1076 | Ga0206352_10762487 | |||
| 1077 | Ga0206352_11111464 | |||
| 1078 | Ga0206352_11329365 | |||
| 1079 | Ga0206350_10015308 | |||
| 1080 | Ga0206350_10952296 | |||
| 1081 | Ga0206354_10008953 | |||
| 1082 | Ga0206354_10314494 | |||
| 1083 | Ga0206354_10395367 | |||
| 1084 | Ga0206354_10448514 | |||
| 1085 | Ga0206354_10954251 | |||
| 1086 | Ga0206353_10604234 | |||
| 1087 | Ga0206353_10689809 | |||
| 1088 | Ga0206353_11202414 | |||
| 1089 | Ga0206353_11207679 | |||
| 1090 | Ga0154015_1295976 | |||
| 1091 | Ga0154015_1675542 | |||
| 1092 | Ga0213874_10080966 | |||
| 1093 | Ga0224712_10023353 | |||
| 1094 | Ga0224712_10040311 | |||
| 1095 | Ga0224712_10086555 | |||
| 1096 | Ga0224712_10528619 | |||
| 1097 | Ga0207426_1005083 | |||
| 1098 | Ga0207642_10194015 | |||
| 1099 | Ga0207710_10331840 | |||
| 1100 | Ga0207710_10333422 | |||
| 1101 | Ga0207688_10159887 | |||
| 1102 | Ga0207688_10291667 | |||
| 1103 | Ga0207688_10509774 | |||
| 1104 | Ga0207688_10820536 | |||
| 1105 | Ga0207685_10425936 | |||
| 1106 | Ga0207699_10406267 | |||
| 1107 | Ga0207645_10336741 | |||
| 1108 | Ga0207643_10187159 | |||
| 1109 | Ga0207671_10006629 | |||
| 1110 | Ga0207663_10375064 | |||
| 1111 | Ga0207660_10438245 | |||
| 1112 | Ga0207662_11366387 | |||
| 1113 | Ga0207657_10200846 | |||
| 1114 | Ga0207657_10758866 | |||
| 1115 | Ga0207649_11014735 | |||
| 1116 | Ga0207652_10917546 | |||
| 1117 | Ga0207652_11159145 | |||
| 1118 | Ga0207694_10412143 | |||
| 1119 | Ga0207694_11227433 | |||
| 1120 | Ga0207694_11451090 | |||
| 1121 | Ga0207650_10769763 | |||
| 1122 | Ga0207650_10933591 | |||
| 1123 | Ga0207659_10867105 | |||
| 1124 | Ga0207687_10020152 | |||
| 1125 | Ga0207687_10623126 | |||
| 1126 | Ga0207687_10709849 | |||
| 1127 | Ga0207700_10020037 | |||
| 1128 | Ga0207664_10340891 | |||
| 1129 | Ga0207664_10666031 | |||
| 1130 | Ga0207664_11664844 | |||
| 1131 | Ga0207644_10268217 | |||
| 1132 | Ga0207690_10460364 | |||
| 1133 | Ga0207690_11111234 | |||
| 1134 | Ga0207690_11444636 | |||
| 1135 | Ga0207690_11650152 | |||
| 1136 | Ga0207706_10613371 | |||
| 1137 | Ga0207686_10310339 | |||
| 1138 | Ga0207686_10672721 | |||
| 1139 | Ga0207709_10027907 | |||
| 1140 | Ga0207709_11655727 | |||
| 1141 | Ga0207670_10534365 | |||
| 1142 | Ga0207670_11317845 | |||
| 1143 | Ga0207669_10564610 | |||
| 1144 | Ga0207669_11398796 | |||
| 1145 | Ga0207665_11137336 | |||
| 1146 | Ga0207691_10097609 | |||
| 1147 | Ga0207711_10006894 | |||
| 1148 | Ga0207711_10377122 | |||
| 1149 | Ga0207711_10548816 | |||
| 1150 | Ga0207661_10127477 | |||
| 1151 | Ga0207661_11804645 | |||
| 1152 | Ga0207661_11938976 | |||
| 1153 | Ga0207679_10943575 | |||
| 1154 | Ga0207667_10075039 | |||
| 1155 | Ga0207667_11504646 | |||
| 1156 | Ga0207651_12109538 | |||
| 1157 | Ga0207712_10076377 | |||
| 1158 | Ga0207712_11805054 | |||
| 1159 | Ga0207668_10057966 | |||
| 1160 | Ga0207677_10702486 | |||
| 1161 | Ga0207677_10877598 | |||
| 1162 | Ga0207677_11331521 | |||
| 1163 | Ga0207703_10000009 | |||
| 1164 | Ga0207703_10194578 | |||
| 1165 | Ga0207703_10326404 | |||
| 1166 | Ga0207639_12078028 | |||
| 1167 | Ga0207678_10545886 | |||
| 1168 | Ga0207678_10611791 | |||
| 1169 | Ga0207678_11371858 | |||
| 1170 | Ga0207678_11828408 | |||
| 1171 | Ga0207708_11452155 | |||
| 1172 | Ga0207708_11694808 | |||
| 1173 | Ga0207702_10244783 | |||
| 1174 | Ga0207702_10578113 | |||
| 1175 | Ga0207648_10078394 | |||
| 1176 | Ga0207648_10717003 | |||
| 1177 | Ga0207648_11616099 | |||
| 1178 | Ga0207648_12065211 | |||
| 1179 | Ga0207676_10825903 | |||
| 1180 | Ga0207676_12386186 | |||
| 1181 | Ga0207674_10310004 | |||
| 1182 | Ga0207674_10357195 | |||
| 1183 | Ga0207674_11370290 | |||
| 1184 | Ga0207675_100689343 | |||
| 1185 | Ga0207675_100829545 | |||
| 1186 | Ga0207683_10080520 | |||
| 1187 | Ga0207683_10527233 | |||
| 1188 | Ga0207683_10885094 | |||
| 1189 | Ga0207683_11631060 | |||
| 1190 | Ga0207698_10273345 | |||
| 1191 | Ga0207698_10346174 | |||
| 1192 | Ga0268266_10027754 | |||
| 1193 | Ga0268266_10099981 | |||
| 1194 | Ga0268266_10867680 | |||
| 1195 | Ga0268265_10042371 | |||
| 1196 | Ga0268264_10198362 | |||
| 1197 | Ga0307517_10001351 | |||
| 1198 | Ga0307517_10156088 | |||
| 1199 | Ga0307515_10001812 | |||
| 1200 | Ga0310981_1091162 | |||
| 1201 | Ga0268256_1062540 | |||
| 1202 | Ga0307511_10108881 | |||
| 1203 | Ga0307511_10285694 | |||
| 1204 | Ga0307512_10207419 | |||
| 1205 | Ga0307509_10011154 | |||
| 1206 | Ga0307509_10012707 | |||
| 1207 | Ga0307509_10256568 | |||
| 1208 | Ga0307408_100606623 | |||
| 1209 | Ga0307508_10000924 | |||
| 1210 | Ga0307508_10003351 | |||
| 1211 | Ga0307508_10012942 | |||
| 1212 | Ga0307508_10097570 | |||
| 1213 | Ga0307508_10263909 | |||
| 1214 | Ga0307514_10107474 | |||
| 1215 | Ga0307516_10039371 | |||
| 1216 | Ga0307516_10045595 | |||
| 1217 | Ga0307516_10190827 | |||
| 1218 | Ga0307405_10100649 | |||
| 1219 | Ga0307405_10147227 | |||
| 1220 | Ga0307405_10541356 | |||
| 1221 | Ga0307413_10082563 | |||
| 1222 | Ga0307413_10091348 | |||
| 1223 | Ga0307413_10860122 | |||
| 1224 | Ga0307410_10352523 | |||
| 1225 | Ga0326468_10001555 | |||
| 1226 | Ga0307406_10030532 | |||
| 1227 | Ga0307406_10058669 | |||
| 1228 | Ga0307407_10087218 | |||
| 1229 | Ga0307412_11003713 | |||
| 1230 | Ga0307409_100142156 | |||
| 1231 | Ga0307409_100354129 | |||
| 1232 | Ga0307409_100452788 | |||
| 1233 | Ga0307409_100640842 | |||
| 1234 | Ga0307409_102710985 | |||
| 1235 | Ga0307416_100096719 | |||
| 1236 | Ga0307416_100587117 | |||
| 1237 | Ga0307416_100750823 | |||
| 1238 | Ga0307416_101733795 | |||
| 1239 | Ga0307414_10679703 | |||
| 1240 | Ga0307411_10082097 | |||
| 1241 | Ga0307411_12138770 | |||
| 1242 | Ga0307415_100074865 | |||
| 1243 | Ga0307415_100145656 | |||
| 1244 | Ga0307415_100285088 | |||
| 1245 | Ga0307415_100517647 | |||
| 1246 | Ga0307507_10000482 | |||
| 1247 | Ga0307507_10096663 | |||
| 1248 | Ga0307507_10120549 | |||
| 1249 | Ga0307507_10444868 | |||
| 1250 | Ga0307510_10095977 | |||
| 1251 | Ga0307510_10106134 | |||
| 1252 | Ga0307510_10136518 | |||
| 1253 | Ga0316214_1026290 | |||
| 1254 | Ga0373949_0069568 | |||
| 1255 | Ga0373951_0000463 | |||
| 1256 | Ga0373941_0239828 | |||
| 1257 | Ga0373945_0273118 | |||
| 1258 | Ga0373960_0108571 | |||
| 1259 | Ga0373935_0022806 | |||
| 1260 | Ga0373925_0389249 | |||
| 1261 | Ga0395900_0050861 | |||
| 1262 | Ga0395898_0953350 | |||
| 1263 | Ga0395905_0764432 | |||
| 1264 | Ga0436364_0164890 | |||
| 1265 | Ga0436364_1556898 | |||
| 1266 | Ga0395901_0808086 | |||
| 1267 | Ga0436365_0905729 | |||
| 1268 | Ga0436363_0026914 | |||
| 1269 | Ga0436363_0492081 | |||
| 1270 | Ga0439461_0000353 | |||
| 1271 | Ga0439466_0001023 | |||
| 1272 | Ga0439465_0003128 | |||
| 1273 | Ga0439465_0367819 | |||
| 1274 | Ga0451787_802906 | |||
| 1275 | Ga0451789_0187238 | |||
| 1276 | Ga0451789_1330385 | |||
| 1277 | Ga0451790_07178 | |||
| 1278 | Ga0451794_25357 | |||
| 1279 | Ga0451791_1814107 | |||
| 1280 | Ga0451793_0621849 | |||
| 1281 | Ga0451793_1066416 | |||
| 1282 | Ga0451797_0774478 | |||
| 1283 | Ga0451797_0864649 | |||
| 1284 | Ga0451797_1211872 | |||
| 1285 | Ga0451795_1621111 | |||
| 1286 | Ga0451800_0489214 | |||
| 1287 | Ga0451802_1113913 | |||
| 1288 | Ga0451802_1643678 | |||
| 1289 | Ga0451804_0462733 | |||
| 1290 | Ga0451807_0482340 | |||
| 1291 | Ga0451807_1220677 | |||
| 1292 | Ga0451833_0393181 | |||
| 1293 | Ga0451837_1730739 | |||
| 1294 | Ga0451839_0406887 | |||
| 1295 | Ga0451841_0603908 | |||
| 1296 | Ga0451843_0866875 | |||
| 1297 | Ga0451855_0151320 | |||
| 1298 | Ga0451853_0729236 | |||
| 1299 | Ga0451853_1021921 | |||
| 1300 | Ga0439431_0000355 | |||
| 1301 | Ga0439433_0051694 | |||
| 1302 | Ga0439445_0000630 | |||
| 1303 | Ga0439463_074968 | |||
| 1304 | Ga0439458_0138275 | |||
| 1305 | Ga0439434_0063102 | |||
| 1306 | Ga0439459_0101286 | |||
| 1307 | Ga0451577_0513648 | |||
| 1308 | Ga0451577_0518485 | |||
| 1309 | Ga0466969_0018916 | |||
| 1310 | Ga0466972_0004559 | |||
| 1311 | Ga0466972_0261256 | |||
| 1312 | Ga0466972_0526363 | |||
| 1313 | Ga0466965_0001377 | |||
| 1314 | Ga0466965_0009434 | |||
| 1315 | Ga0466966_0003375 | |||
| 1316 | Ga0466966_0043302 | |||
| 1317 | Ga0466966_0170526 | |||
| 1318 | Ga0466961_0030780 | |||
| 1319 | Ga0466961_0037140 | |||
| 1320 | Ga0466961_0491407 | |||
| 1321 | Ga0466963_0187646 | |||
| 1322 | Ga0466964_0299145 | |||
| 1323 | Ga0466964_0549402 | |||
| 1324 | Ga0453684_1418889 | |||
| 1325 | Ga0466971_0000675 | |||
| 1326 | Ga0466971_0123465 | |||
| 1327 | Ga0466971_0136311 | |||
| 1328 | Ga0466971_0513118 | |||
| 1329 | Ga0466968_0028149 | |||
| 1330 | Ga0466968_0212703 | |||
| 1331 | Ga0466970_0001021 | |||
| 1332 | Ga0466970_0206977 | |||
| 1333 | Ga0466970_0797442 | |||
| 1334 | Ga0466970_0837813 | |||
| 1335 | Ga0466970_0964420 | |||
| 1336 | Ga0466957_0001124 | |||
| 1337 | Ga0466957_0074145 | |||
| 1338 | Ga0466957_0089846 | |||
| 1339 | Ga0466957_0650656 | |||
| 1340 | Ga0466960_0002753 | |||
| 1341 | Ga0466959_0003800 | |||
| 1342 | Ga0466959_0015907 | |||
| 1343 | Ga0466959_0025593 | |||
| 1344 | Ga0466959_0041912 | |||
| 1345 | Ga0466959_0677759 | |||
| 1346 | Ga0466958_0011830 | |||
| 1347 | Ga0466958_0026511 | |||
| 1348 | Ga0466967_0007609 | |||
| 1349 | Ga0466967_0101371 | |||
| 1350 | Ga0466967_0238227 | |||
| 1351 | Ga0466967_0363566 | |||
| 1352 | Ga0495627_039442 | |||
| 1353 | Ga0495627_100262 | |||
| 1354 | Ga0495592_0005017 | |||
| 1355 | Ga0495592_0008230 | |||
| 1356 | Ga0495603_0159931 | |||
| 1357 | Ga0495603_0206622 | |||
| 1358 | Ga0495590_0211305 | |||
| 1359 | Ga0495629_0060688 | |||
| 1360 | Ga0495629_0099847 | |||
| 1361 | Ga0495629_0201351 | |||
| 1362 | Ga0495638_0154030 | |||
| 1363 | Ga0495651_0000169 | |||
| 1364 | Ga0495651_0005300 | |||
| 1365 | Ga0495639_0174429 | |||
| 1366 | Ga0495662_0096445 | |||
| 1367 | Ga0495664_0030225 | |||
| 1368 | Ga0495664_0082835 | |||
| 1369 | Ga0495584_0119624 | |||
| 1370 | Ga0495585_0102174 | |||
| 1371 | Ga0495585_0147735 | |||
| 1372 | Ga0495594_0060133 | |||
| 1373 | Ga0495594_0308584 | |||
| 1374 | Ga0495608_0060019 | |||
| 1375 | Ga0495608_0756532 | |||
| 1376 | Ga0495618_0004578 | |||
| 1377 | Ga0495618_0078305 | |||
| 1378 | Ga0495620_0158527 | |||
| 1379 | Ga0495628_0062544 | |||
| 1380 | Ga0495628_0262913 | |||
| 1381 | Ga0495630_0095803 | |||
| 1382 | Ga0495632_0010084 | |||
| 1383 | Ga0495643_0003566 | |||
| 1384 | Ga0495666_0065533 | |||
| 1385 | Ga0495642_0072089 | |||
| 1386 | Ga0495652_0001361 | |||
| 1387 | Ga0495652_0006542 | |||
| 1388 | Ga0495652_0549370 | |||
| 1389 | Ga0495640_0007026 | |||
| 1390 | Ga0495586_0673227 | |||
| 1391 | Ga0495587_0033543 | |||
| 1392 | Ga0495598_0085680 | |||
| 1393 | Ga0495621_0166726 | |||
| 1394 | Ga0495645_0013381 | |||
| 1395 | Ga0495622_0019219 | |||
| 1396 | Ga0495633_0035752 | |||
| 1397 | Ga0495667_0034127 | |||
| 1398 | Ga0495667_0343976 | |||
| 1399 | Ga0495656_0044151 | |||
| 1400 | Ga0495634_0003443 | |||
| 1401 | Ga0495634_0121401 | |||
| 1402 | Ga0495611_0048818 | |||
| 1403 | Ga0495635_0010690 | |||
| 1404 | Ga0495635_1068681 | |||
| 1405 | Ga0495588_0032147 | |||
| 1406 | Ga0495657_0004038 | |||
| 1407 | Ga0495623_0003245 | |||
| 1408 | Ga0495623_0004870 | |||
| 1409 | Ga0495623_0420944 | |||
| 1410 | Ga0495646_0008701 | |||
| 1411 | Ga0495658_0040123 | |||
| 1412 | Ga0495613_0005971 | |||
| 1413 | Ga0495613_0209276 | |||
| 1414 | Ga0495624_0059145 | |||
| 1415 | Ga0495670_0007585 | |||
| 1416 | Ga0495671_0120169 | |||
| 1417 | Ga0495600_0007794 | |||
| 1418 | Ga0495600_0039421 | |||
| 1419 | Ga0495600_0373910 | |||
| 1420 | Ga0495600_0721783 | |||
| 1421 | Ga0495660_0002768 | |||
| 1422 | Ga0495604_0003385 | |||
| 1423 | Ga0495604_0004624 | |||
| 1424 | Ga0495604_0617798 | |||
| 1425 | Ga0495604_0800277 | |||
| 1426 | Ga0495636_0182572 | |||
| 1427 | Ga0495636_0498302 | |||
| 1428 | Ga0495676_0015246 | |||
| 1429 | Ga0495676_0879911 | |||
| 1430 | Ga0495680_0125418 | |||
| 1431 | Ga0495680_0673789 | |||
| 1432 | Ga0495680_1052841 | |||
| 1433 | Ga0495683_0013097 | |||
| 1434 | Ga0495687_025550 | |||
| 1435 | Ga0495687_259525 | |||
| 1436 | Ga0495675_0001497 | |||
| 1437 | Ga0495675_0088539 | |||
| 1438 | Ga0495675_0089338 | |||
| 1439 | Ga0495675_0225518 | |||
| 1440 | Ga0495675_0435149 | |||
| 1441 | Ga0495677_0116944 | |||
| 1442 | Ga0495679_019249 | |||
| 1443 | Ga0495685_000455 | |||
| 1444 | Ga0495685_013987 | |||
| 1445 | Ga0495681_0001916 | |||
| 1446 | Ga0495681_0305262 | |||
| 1447 | Ga0495686_0041778 | |||
| 1448 | Ga0495602_0070215 | |||
| 1449 | Ga0495614_0076371 | |||
| 1450 | Ga0496100_0035427 | |||
| 1451 | Ga0496100_0059373 | |||
| 1452 | Ga0496100_1238589 | |||
| 1453 | Ga0496101_0000075 | |||
| 1454 | Ga0496101_0011872 | |||
| 1455 | Ga0496101_0023265 | |||
| 1456 | Ga0496101_0488628 | |||
| 1457 | Ga0496102_0000003 | |||
| 1458 | Ga0496102_0067122 | |||
| 1459 | Ga0496102_0096537 | |||
| 1460 | Ga0496102_0577213 | |||
| 1461 | Ga0496103_0000014 | |||
| 1462 | Ga0496104_0093759 | |||
| 1463 | Ga0496104_0096185 | |||
| 1464 | Ga0496104_0117995 | |||
| 1465 | Ga0496105_0269046 | |||
| 1466 | Ga0496105_0832106 | |||
| 1467 | Ga0496106_0138601 | |||
| 1468 | Ga0496106_0147980 | |||
| 1469 | Ga0496107_0061966 | |||
| 1470 | Ga0496107_1119752 | |||
| 1471 | Ga0496107_1382665 | |||
| 1472 | Ga0496108_0085000 | |||
| 1473 | Ga0496108_0253120 | |||
| 1474 | Ga0496108_0360301 | |||
| 1475 | Ga0496108_0462748 | |||
| 1476 | Ga0496109_0058771 | |||
| 1477 | Ga0496109_0165475 | |||
| 1478 | Ga0496109_0181473 | |||
| 1479 | Ga0496109_0540907 | |||
| 1480 | Ga0496110_0085776 | |||
| 1481 | Ga0496110_0275300 | |||
| 1482 | Ga0496111_0039375 | |||
| 1483 | Ga0496112_0011626 | |||
| 1484 | Ga0496112_0155384 | |||
| 1485 | Ga0496113_0003233 | |||
| 1486 | Ga0496113_0018053 | |||
| 1487 | Ga0496114_0009605 | |||
| 1488 | Ga0496114_0020960 | |||
| 1489 | Ga0496114_0535943 | |||
| 1490 | Ga0496115_0326798 | |||
| 1491 | Ga0496116_0000071 | |||
| 1492 | Ga0496117_0000003 | |||
| 1493 | Ga0496118_0000001 | |||
| 1494 | Ga0496119_0000527 | |||
| 1495 | Ga0496119_0121327 | |||
| 1496 | Ga0496119_0181343 | |||
| 1497 | Ga0496120_0000235 | |||
| 1498 | Ga0496121_0000019 | |||
| 1499 | Ga0496122_0015410 | |||
| 1500 | Ga0496123_0006264 | |||
| 1501 | Ga0496126_0000951 | |||
| 1502 | Ga0496126_0011441 | |||
| 1503 | Ga0496126_0020119 | |||
| 1504 | Ga0496126_0432601 | |||
| 1505 | Ga0496126_0495762 | |||
| 1506 | Ga0496126_1242094 | |||
| 1507 | Ga0496126_1308979 | |||
| 1508 | Ga0501306_008396 | |||
| 1509 | Ga0501306_030508 | |||
| 1510 | Ga0501308_020253 | |||
| 1511 | Ga0501309_013241 | |||
| 1512 | Ga0501309_044144 | |||
| 1513 | Ga0501310_021149 | |||
| 1514 | Ga0501304_040726 | |||
| 1515 | Ga0501305_022556 | |||
| 1516 | Ga0501307_036495 | |||
| 1517 | Ga0501307_053000 | |||
| 1518 | Ga0501311_014031 | |||
| 1519 | Ga0501311_101720 | |||
| 1520 | Ga0501312_023268 | |||
| 1521 | Ga0501312_053178 | |||
| 1522 | Ga0501312_075695 | |||
| 1523 | Ga0501314_001561 | |||
| 1524 | Ga0501315_100865 | |||
| 1525 | Ga0501316_006966 | |||
| 1526 | Ga0501316_008288 | |||
| 1527 | Ga0501317_013188 | |||
| 1528 | Ga0501317_013275 | |||
| 1529 | Ga0501317_050835 | |||
| 1530 | Ga0501318_012530 | |||
| 1531 | Ga0501321_005201 | |||
| 1532 | Ga0501321_061930 | |||
| 1533 | Ga0501324_014639 | |||
| 1534 | Ga0501324_047228 | |||
| 1535 | Ga0501325_011299 | |||
| 1536 | Ga0501336_025574 | |||
| 1537 | Ga0501031_0003261 | |||
| 1538 | Ga0501032_0001347 | |||
| 1539 | Ga0501032_0221765 | |||
| 1540 | Ga0501032_0650407 | |||
| 1541 | Ga0501033_0005545 | |||
| 1542 | Ga0501034_0011756 | |||
| 1543 | Ga0501034_0177975 | |||
| 1544 | Ga0501036_0074674 | |||
| 1545 | Ga0501036_0302136 | |||
| 1546 | Ga0501037_0004030 | |||
| 1547 | Ga0501038_0007465 | |||
| 1548 | Ga0501038_0130009 | |||
| 1549 | Ga0501038_0992853 | |||
| 1550 | Ga0501039_0003016 | |||
| 1551 | Ga0501039_0341118 | |||
| 1552 | Ga0501040_0002706 | |||
| 1553 | Ga0501040_0047321 | |||
| 1554 | Ga0501041_0002671 | |||
| 1555 | Ga0501041_0723543 | |||
| 1556 | Ga0501042_0073359 | |||
| 1557 | Ga0501042_0088501 | |||
| 1558 | Ga0501042_0736570 | |||
| 1559 | Ga0501043_0028012 | |||
| 1560 | Ga0501043_0274529 | |||
| 1561 | Ga0501046_0002011 | |||
| 1562 | Ga0501046_0473748 | |||
| 1563 | Ga0501047_0000278 | |||
| 1564 | Ga0501047_0008040 | |||
| 1565 | Ga0501047_0119157 | |||
| 1566 | Ga0501047_0220639 | |||
| 1567 | Ga0501048_0001026 | |||
| 1568 | Ga0501067_0000592 | |||
| 1569 | Ga0501068_0003271 | |||
| 1570 | Ga0501069_0005589 | |||
| 1571 | Ga0501070_0004123 | |||
| 1572 | Ga0501071_0045415 | |||
| 1573 | Ga0501072_0001152 | |||
| 1574 | Ga0501072_0054085 | |||
| 1575 | Ga0501073_0004460 | |||
| 1576 | Ga0501074_0003829 | |||
| 1577 | Ga0501074_0881490 | |||
| 1578 | Ga0501075_0343782 | |||
| 1579 | Ga0501076_0010773 | |||
| 1580 | Ga0501077_0031876 | |||
| 1581 | Ga0501221_200839 | |||
| 1582 | Ga0501079_0007489 | |||
| 1583 | Ga0501080_0091006 | |||
| 1584 | Ga0501080_0144771 | |||
| 1585 | Ga0501083_0008844 | |||
| 1586 | Ga0501035_0097200 | |||
| 1587 | Ga0501035_0122555 | |||
| 1588 | Ga0501044_0010423 | |||
| 1589 | Ga0501044_0301918 | |||
| 1590 | Ga0501044_1015399 | |||
| 1591 | Ga0501045_0005656 | |||
| 1592 | Ga0501045_0366432 | |||
| 1593 | nmdc:mga03683_482660_c1 | |||
| 1594 | nmdc:mga03n38_128391_c1 | |||
| 1595 | nmdc:mga00v17_286344_c1 | |||
| 1596 | nmdc:mga00v17_326959_c1 | |||
| 1597 | nmdc:mga00v17_361571_c1 | |||
| 1598 | nmdc:mga00v17_452689_c1 | |||
| 1599 | nmdc:mga00v17_64510_c1 | |||
| 1600 | nmdc:mga00v17_72839_c1 | |||
| 1601 | nmdc:mga0yw44_21262_c1 | |||
| 1602 | nmdc:mga0yw44_59749_c1 | |||
| 1603 | nmdc:mga07m45_696255_c1 | |||
| 1604 | nmdc:mga05p37_64020_c1 | |||
| 1605 | nmdc:mga0rr50_1593263_c1 | |||
| 1606 | nmdc:mga0sz30_13994_c1 | |||
| 1607 | nmdc:mga0sz30_86476_c1 | |||
| 1608 | Ga0495601_0044431 | |||
| 1609 | Ga0495612_0001114 | |||
| 1610 | Ga0495655_0105304 | |||
| 1611 | Ga0495595_0600755 | |||
| 1612 | Ga0495619_0039496 | |||
| 1613 | Ga0500578_0006009 | |||
| 1614 | Ga0500583_0132654 | |||
| 1615 | Ga0500651_0490205 | |||
| 1616 | Ga0500566_0009561 | |||
| 1617 | Ga0500654_002699 | |||
| 1618 | Ga0500660_024964 | |||
| 1619 | Ga0500558_064320 | |||
| 1620 | Ga0500560_117181 | |||
| 1621 | Ga0500569_000210 | |||
| 1622 | Ga0500580_110091 | |||
| 1623 | Ga0500594_0039080 | |||
| 1624 | Ga0500608_308905 | |||
| 1625 | Ga0500614_165070 | |||
| 1626 | Ga0500621_092407 | |||
| 1627 | Ga0500628_080887 | |||
| 1628 | Ga0500652_001087 | |||
| 1629 | Ga0500658_0002819 | |||
| 1630 | Ga0500659_0289263 | |||
| 1631 | Ga0500559_0449843 | |||
| 1632 | Ga0500561_0000167 | |||
| 1633 | Ga0500568_0027056 | |||
| 1634 | Ga0500573_0032934 | |||
| 1635 | Ga0500573_0180499 | |||
| 1636 | Ga0500573_0332596 | |||
| 1637 | Ga0500577_0183465 | |||
| 1638 | Ga0500579_134694 | |||
| 1639 | Ga0500586_242712 | |||
| 1640 | Ga0500588_0313911 | |||
| 1641 | Ga0500600_0006438 | |||
| 1642 | Ga0500603_051840 | |||
| 1643 | Ga0500616_0004474 | |||
| 1644 | Ga0500616_0006073 | |||
| 1645 | Ga0500627_0195703 | |||
| 1646 | Ga0500630_091102 | |||
| 1647 | Ga0500633_0000736 | |||
| 1648 | Ga0500634_0024229 | |||
| 1649 | Ga0500636_0215330 | |||
| 1650 | Ga0500636_0313595 | |||
| 1651 | Ga0500656_000179 | |||
| 1652 | Ga0500587_000176 | |||
| 1653 | Ga0500587_012825 | |||
| 1654 | Ga0501084_0001550 | |||
| 1655 | Ga0587084_020265 | |||
| 1656 | Ga0587084_033914 | |||
| 1657 | Ga0587073_0074026 | |||
| 1658 | Ga0587073_0078929 | |||
| 1659 | Ga0587073_0116826 | |||
| 1660 | Ga0587077_085610 | |||
| 1661 | Ga0587077_113410 | |||
| 1662 | Ga0587080_099869 | |||
| 1663 | Ga0587082_022401 | |||
| 1664 | Ga0587083_0206547 | |||
| 1665 | Ga0587085_178273 | |||
| 1666 | Ga0587088_042869 | |||
| 1667 | Ga0587090_028502 | |||
| 1668 | Ga0587090_082861 | |||
| 1669 | Ga0587092_044616 | |||
| 1670 | Ga0587098_005666 | |||
| 1671 | Ga0587098_007546 | |||
| 1672 | Ga0587106_009824 | |||
| 1673 | Ga0587125_038170 | |||
| 1674 | Ga0587129_006660 | |||
| 1675 | Ga0587101_032470 | |||
| 1676 | Ga0587109_046161 | |||
| 1677 | Ga0587117_028126 | |||
| 1678 | Ga0587067_023577 | |||
| 1679 | Ga0587067_028532 | |||
| 1680 | Ga0587072_107055 | |||
| 1681 | Ga0587079_076859 | |||
| 1682 | Ga0587100_018129 | |||
| 1683 | Ga0587102_015709 | |||
| 1684 | Ga0587107_014459 | |||
| 1685 | Ga0587119_018189 | |||
| 1686 | Ga0587124_012606 | |||
| 1687 | Ga0587071_016330 | |||
| 1688 | Ga0587071_163019 | |||
| 1689 | Ga0587111_0001599 | |||
| 1690 | Ga0587111_0082473 | |||
| 1691 | Ga0501082_0013322 | |||
| 1692 | Ga0501082_0309796 | |||
| 1693 | Ga0466962_0000160 | |||
| 1694 | Ga0466962_0032722 | |||
| 1695 | Ga0466962_0111398 | |||
| 1696 | Ga0466962_0111769 | |||
| 1697 | Ga0466962_0454679 | |||
| 1698 | 2554256784 | |||
| 1699 | 2644014453 | |||
| 1700 | 2644175890 | |||
| 1701 | 2793976332 | |||
| 1702 | 2819742258 | |||
| 1703 | 2867481061 | |||
| 1704 | 2912718451 | |||
| 1705 | 2990092165 | |||
| 1706 | 3006326219 | |||
| 1707 | 3006427943 | |||
| 1708 | 8025486085 | |||
| 1709 | 8047896979 | |||
| 1710 | 8048132579 | |||
| 1711 | 8048361973 | |||
| 1712 | 8048373964 | |||
| 1713 | 8048384263 | |||
| 1714 | 8054160791 | |||
| 1715 | 8056447903 | |||
| 1716 | 8056673136 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v5d-assembly1.cif.gz_BX | structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. | 0.9555 | 14 | 104 |
| 7nhn-assembly1.cif.gz_W | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9537 | 13 | 98 |
| 8cvm-assembly1.cif.gz_s | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9529 | 11 | 101 |
| 7m4z-assembly1.cif.gz_S | a. baumannii ribosome-eravacycline complex: hpf-bound 70s | 0.9438 | 14 | 98 |
| 6spb-assembly1.cif.gz_T | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9431 | 14 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZFK7_36_158_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9489 | 13 | 95 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9374 | 13 | 99 | 3.30.70.330 |
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9308 | 16 | 99 | 3.30.70.330 |
| 4qs3X00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9215 | 16 | 101 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9075 | 13 | 99 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A419EVM5-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9787 | 13 | 100 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A369VT02-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.978 | 14 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A399FYL2-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9778 | 13 | 100 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7V9E522-F1-model_v4 | 50S ribosomal protein L23 | 0.9774 | 13 | 99 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-G6YI82-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.977 | 14 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |