F483754

General Info

Members Datasets Scaffolds Average Seq Length
858 488 1716 103

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0392039|Ga0501037_0392039_337_756
Length 122
Sequence MATRHPSIASAAEGKNTVETPLSKSYTDPRDVLIKPVVSEKSYALLDENKYTFIVDPRANKTQIKEAVQAVFEVKVTGVNTINRQGKRKRTRTGFGQRAATKRAIVTLAEGDRIDIFGGPTA

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
87 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
88 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
89 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
109 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
172 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
173 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
174 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
213 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
214 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
215 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
216 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
217 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
218 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
219 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
220 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
221 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
222 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
223 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
224 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
225 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
226 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
227 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
228 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
229 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
232 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
233 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
234 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
258 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
289 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
307 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
310 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
311 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
333 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
334 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
335 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
336 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
337 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
338 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
339 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
391 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
392 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
393 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
394 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
395 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
396 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
397 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
402 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
403 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
404 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
405 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
406 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
407 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
408 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
409 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
410 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
411 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
412 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
413 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
414 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
415 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
416 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
417 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
418 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
419 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
420 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
421 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
422 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
423 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
424 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
425 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
426 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
427 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
428 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
429 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
430 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
431 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
432 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
433 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
434 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
435 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
436 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
437 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
438 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
439 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
440 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
441 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
469 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
470 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
471 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
472 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
473 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
474 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
475 2867475112 Streptomyces sp. TM32 Isolate Unclassified
476 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
477 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
478 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
479 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
480 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
481 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
482 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
483 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
484 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
485 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
486 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
487 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
488 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.73
Metatranscriptomes 13.05
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.04
Nodule 0
Rhizoplane 6.99
Rhizosphere 77.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0392039 3300049573 Bacteria 953
2 JGI25160J50197_1032287 3300003354 Bacteria 1333
3 Ga0058859_10027059 3300004798 Bacteria 810
4 Ga0058861_12031117 3300004800 Bacteria 721
5 Ga0058860_10020864 3300004801 Bacteria 651
6 Ga0058860_12055840 3300004801 Bacteria 550
7 Ga0058862_10019043 3300004803 Bacteria 924
8 Ga0058862_12685021 3300004803 Bacteria 637
9 Ga0070658_11036574 3300005327 Bacteria 713
10 Ga0070683_100243292 3300005329 Bacteria 1711
11 Ga0070683_100730630 3300005329 Bacteria 948
12 Ga0070683_101138786 3300005329 Bacteria 749
13 Ga0070670_100425233 3300005331 Bacteria 1175
14 Ga0070670_100760505 3300005331 Bacteria 873
15 Ga0068869_100293072 3300005334 Bacteria 1311
16 Ga0070682_100283454 3300005337 Bacteria 1209
17 Ga0070682_100420354 3300005337 Bacteria 1016
18 Ga0068868_100719583 3300005338 Bacteria 894
19 Ga0068868_101528756 3300005338 Bacteria 625
20 Ga0070660_100392575 3300005339 Bacteria 1146
21 Ga0070689_100898597 3300005340 Bacteria 784
22 Ga0070687_100565731 3300005343 Bacteria 776
23 Ga0070661_100303924 3300005344 Bacteria 1242
24 Ga0070692_10467664 3300005345 Bacteria 810
25 Ga0070692_11211312 3300005345 Bacteria 538
26 Ga0070668_100198226 3300005347 Bacteria 1647
27 Ga0070668_101450308 3300005347 Bacteria 627
28 Ga0070669_101860188 3300005353 Bacteria 525
29 Ga0070675_100820281 3300005354 Bacteria 851
30 Ga0070671_100314327 3300005355 Bacteria 1334
31 Ga0070671_100546495 3300005355 Bacteria 999
32 Ga0070674_101090453 3300005356 Bacteria 705
33 Ga0070674_101177552 3300005356 Bacteria 680
34 Ga0070673_100855117 3300005364 Bacteria 842
35 Ga0070673_101041985 3300005364 Bacteria 763
36 Ga0070659_100346616 3300005366 Bacteria 1245
37 Ga0070659_101468914 3300005366 Bacteria 607
38 Ga0070667_100005984 3300005367 Bacteria 10104
39 Ga0070667_100313417 3300005367 Bacteria 1414
40 Ga0070667_100552437 3300005367 Bacteria 1058
41 Ga0070703_10117275 3300005406 Bacteria 961
42 Ga0070714_100233697 3300005435 Bacteria 1695
43 Ga0070714_100319510 3300005435 Bacteria 1451
44 Ga0070713_100004669 3300005436 Bacteria 9248
45 Ga0070701_10842954 3300005438 Bacteria 629
46 Ga0070711_100253031 3300005439 Bacteria 1383
47 Ga0070700_100780034 3300005441 Bacteria 768
48 Ga0070700_101998074 3300005441 Bacteria 503
49 Ga0070663_100166935 3300005455 Bacteria 1699
50 Ga0070678_100132027 3300005456 Bacteria 1985
51 Ga0070678_100420815 3300005456 Bacteria 1164
52 Ga0070678_101247103 3300005456 Bacteria 691
53 Ga0070678_101280762 3300005456 Bacteria 682
54 Ga0070662_100552981 3300005457 Bacteria 964
55 Ga0070662_101939477 3300005457 Bacteria 509
56 Ga0068867_100312233 3300005459 Bacteria 1299
57 Ga0070685_10284947 3300005466 Bacteria 1107
58 Ga0070685_11409986 3300005466 Bacteria 535
59 Ga0070685_11481707 3300005466 Bacteria 522
60 Ga0070706_101774999 3300005467 Bacteria 561
61 Ga0070679_101137379 3300005530 Bacteria 726
62 Ga0070679_101142826 3300005530 Bacteria 724
63 Ga0070679_101800756 3300005530 Bacteria 561
64 Ga0070684_100285523 3300005535 Bacteria 1512
65 Ga0070672_100582283 3300005543 Bacteria 974
66 Ga0070672_101372942 3300005543 Bacteria 632
67 Ga0070686_100186467 3300005544 Bacteria 1478
68 Ga0070686_101484268 3300005544 Bacteria 571
69 Ga0070693_100400377 3300005547 Bacteria 952
70 Ga0070693_101028264 3300005547 Bacteria 625
71 Ga0070665_100125445 3300005548 Bacteria 2570
72 Ga0070665_102611067 3300005548 Bacteria 506
73 Ga0070664_100611988 3300005564 Bacteria 1011
74 Ga0070664_100964697 3300005564 Bacteria 801
75 Ga0068857_100367935 3300005577 Bacteria 1333
76 Ga0068854_101954602 3300005578 Bacteria 540
77 Ga0068856_100781514 3300005614 Bacteria 975
78 Ga0068856_101071620 3300005614 Bacteria 824
79 Ga0070702_100134868 3300005615 Bacteria 1565
80 Ga0068852_100025908 3300005616 Bacteria 4759
81 Ga0068852_100649273 3300005616 Bacteria 1062
82 Ga0068852_101215577 3300005616 Bacteria 775
83 Ga0068859_100743950 3300005617 Bacteria 1070
84 Ga0068864_100521326 3300005618 Bacteria 1146
85 Ga0068864_100627925 3300005618 Bacteria 1045
86 Ga0068866_10632194 3300005718 Bacteria 726
87 Ga0068861_100130584 3300005719 Bacteria 2038
88 Ga0068851_10299893 3300005834 Bacteria 924
89 Ga0068870_10582921 3300005840 Bacteria 758
90 Ga0068870_11409036 3300005840 Bacteria 511
91 Ga0068863_100342072 3300005841 Bacteria 1455
92 Ga0068863_101686661 3300005841 Bacteria 643
93 Ga0068858_100000013 3300005842 Bacteria 216466
94 Ga0068858_100212121 3300005842 Bacteria 1833
95 Ga0068860_100780105 3300005843 Bacteria 968
96 Ga0081455_10106856 3300005937 Bacteria 2232
97 Ga0081455_10386216 3300005937 Bacteria 976
98 Ga0081455_10547032 3300005937 Bacteria 766
99 Ga0081540_1005568 3300005983 Bacteria 9381
100 Ga0070717_11314727 3300006028 Bacteria 657
101 Ga0075365_10006681 3300006038 Bacteria 6372
102 Ga0075365_10075797 3300006038 Bacteria 2270
103 Ga0075365_10855404 3300006038 Bacteria 641
104 Ga0075365_10948699 3300006038 Bacteria 606
105 Ga0075363_100038892 3300006048 Bacteria 2502
106 Ga0075364_10048616 3300006051 Bacteria 2764
107 Ga0075364_10202272 3300006051 Bacteria 1346
108 Ga0075364_10208663 3300006051 Bacteria 1324
109 Ga0075364_10683225 3300006051 Bacteria 701
110 Ga0075369_10032174 3300006186 Bacteria 2218
111 Ga0075369_10361646 3300006186 Bacteria 681
112 Ga0075366_10421996 3300006195 Bacteria 822
113 Ga0097621_100222109 3300006237 Bacteria 1646
114 Ga0075370_10988178 3300006353 Bacteria 516
115 Ga0068871_101351922 3300006358 Bacteria 671
116 Ga0068865_100534181 3300006881 Bacteria 983
117 Ga0097620_100743961 3300006931 Bacteria 1070
118 Ga0105244_10272877 3300009036 Bacteria 785
119 Ga0105244_10576351 3300009036 Bacteria 517
120 Ga0105250_10195966 3300009092 Bacteria 851
121 Ga0111539_11678634 3300009094 Bacteria 737
122 Ga0105245_10059566 3300009098 Bacteria 3438
123 Ga0105245_10078141 3300009098 Bacteria 3019
124 Ga0105245_10116828 3300009098 Bacteria 2488
125 Ga0105245_10388478 3300009098 Bacteria 1392
126 Ga0105247_10161516 3300009101 Bacteria 1484
127 Ga0105247_10252526 3300009101 Bacteria 1206
128 Ga0105247_11306377 3300009101 Bacteria 583
129 Ga0105243_10683988 3300009148 Bacteria 998
130 Ga0105243_10987054 3300009148 Bacteria 844
131 Ga0105243_11658954 3300009148 Bacteria 667
132 Ga0105241_10074305 3300009174 Bacteria 2647
133 Ga0105241_10738320 3300009174 Bacteria 902
134 Ga0105241_11899740 3300009174 Bacteria 583
135 Ga0105242_10262583 3300009176 Bacteria 1560
136 Ga0105242_10413133 3300009176 Bacteria 1262
137 Ga0105242_10643137 3300009176 Bacteria 1030
138 Ga0105248_10096561 3300009177 Bacteria 3329
139 Ga0105248_10150854 3300009177 Bacteria 2622
140 Ga0105248_10372568 3300009177 Bacteria 1607
141 Ga0105248_11187432 3300009177 Bacteria 863
142 Ga0105237_10009127 3300009545 Bacteria 10656
143 Ga0105238_10409424 3300009551 Bacteria 1350
144 Ga0105238_11431897 3300009551 Bacteria 719
145 Ga0105249_10632895 3300009553 Bacteria 1126
146 Ga0105249_11724993 3300009553 Bacteria 699
147 Ga0105249_12478515 3300009553 Bacteria 591
148 Ga0105239_10005526 3300010375 Bacteria 14802
149 Ga0105239_10942334 3300010375 Bacteria 991
150 Ga0105239_11459766 3300010375 Bacteria 790
151 Ga0105246_10813620 3300011119 Bacteria 830
152 Ga0105246_10995822 3300011119 Bacteria 758
153 Ga0105246_11572961 3300011119 Bacteria 620
154 Ga0105246_12571340 3300011119 Bacteria 502
155 Ga0157337_1005161 3300012483 Bacteria 861
156 Ga0157322_1001742 3300012490 Bacteria 1132
157 Ga0157327_1044190 3300012512 Bacteria 611
158 Ga0157326_1022361 3300012513 Bacteria 789
159 Ga0157371_10483286 3300013102 Bacteria 913
160 Ga0157370_10950512 3300013104 Bacteria 779
161 Ga0157370_11509372 3300013104 Bacteria 604
162 Ga0157369_10156154 3300013105 Bacteria 2410
163 Ga0157369_10990050 3300013105 Bacteria 861
164 Ga0157369_12484095 3300013105 Bacteria 525
165 Ga0157374_10290071 3300013296 Bacteria 1617
166 Ga0157374_11027292 3300013296 Bacteria 844
167 Ga0157374_11830770 3300013296 Bacteria 632
168 Ga0157374_12382849 3300013296 Bacteria 557
169 Ga0157378_11790932 3300013297 Bacteria 662
170 Ga0157378_11996588 3300013297 Bacteria 630
171 Ga0157378_12095641 3300013297 Bacteria 616
172 Ga0163162_10127782 3300013306 Bacteria 2649
173 Ga0163162_10882261 3300013306 Bacteria 1008
174 Ga0163162_12321706 3300013306 Bacteria 616
175 Ga0157372_11358944 3300013307 Bacteria 819
176 Ga0157372_11397875 3300013307 Bacteria 807
177 Ga0157372_11521351 3300013307 Bacteria 771
178 Ga0157372_12980673 3300013307 Bacteria 541
179 Ga0157375_10016636 3300013308 Bacteria 6614
180 Ga0157375_10268334 3300013308 Bacteria 1868
181 Ga0157375_11680425 3300013308 Bacteria 751
182 Ga0157375_12579190 3300013308 Bacteria 607
183 Ga0163163_10057195 3300014325 Bacteria 3855
184 Ga0163163_10395536 3300014325 Bacteria 1440
185 Ga0163163_10743846 3300014325 Bacteria 1044
186 Ga0163163_11532606 3300014325 Bacteria 728
187 Ga0157380_10408869 3300014326 Bacteria 1290
188 Ga0157380_11088257 3300014326 Bacteria 838
189 Ga0157380_11921502 3300014326 Bacteria 653
190 Ga0157380_12077116 3300014326 Bacteria 631
191 Ga0157380_12279246 3300014326 Bacteria 606
192 Ga0182008_10724126 3300014497 Bacteria 570
193 Ga0157377_10099821 3300014745 Bacteria 1727
194 Ga0157377_11215011 3300014745 Bacteria 584
195 Ga0157379_10000012 3300014968 Bacteria 110577
196 Ga0157379_10579836 3300014968 Bacteria 1045
197 Ga0157376_10234942 3300014969 Bacteria 1705
198 Ga0163161_11128673 3300017792 Bacteria 675
199 Ga0163161_11297982 3300017792 Bacteria 633
200 Ga0197907_10433734 3300020069 Bacteria 1096
201 Ga0197907_10477661 3300020069 Bacteria 2104
202 Ga0197907_11152397 3300020069 Bacteria 516
203 Ga0206356_10344010 3300020070 Bacteria 3475
204 Ga0206356_11141088 3300020070 Bacteria 4448
205 Ga0206356_11473966 3300020070 Bacteria 2324
206 Ga0206349_1334537 3300020075 Bacteria 709
207 Ga0206349_1527023 3300020075 Bacteria 1001
208 Ga0206349_1563816 3300020075 Bacteria 667
209 Ga0206349_1899702 3300020075 Bacteria 921
210 Ga0206355_1431124 3300020076 Bacteria 811
211 Ga0206355_1519402 3300020076 Bacteria 867
212 Ga0206355_1612783 3300020076 Bacteria 545
213 Ga0206351_10233981 3300020077 Bacteria 673
214 Ga0206351_10393194 3300020077 Bacteria 686
215 Ga0206351_10580594 3300020077 Bacteria 535
216 Ga0206351_10619467 3300020077 Bacteria 1073
217 Ga0206352_10732747 3300020078 Bacteria 804
218 Ga0206352_10762487 3300020078 Bacteria 2048
219 Ga0206352_11111464 3300020078 Bacteria 913
220 Ga0206352_11329365 3300020078 Bacteria 637
221 Ga0206350_10015308 3300020080 Bacteria 744
222 Ga0206350_10952296 3300020080 Bacteria 662
223 Ga0206354_10008953 3300020081 Bacteria 614
224 Ga0206354_10314494 3300020081 Bacteria 529
225 Ga0206354_10395367 3300020081 Bacteria 3493
226 Ga0206354_10448514 3300020081 Bacteria 3241
227 Ga0206354_10954251 3300020081 Bacteria 2646
228 Ga0206353_10604234 3300020082 Bacteria 2528
229 Ga0206353_10689809 3300020082 Bacteria 3757
230 Ga0206353_11202414 3300020082 Bacteria 1066
231 Ga0206353_11207679 3300020082 Bacteria 2102
232 Ga0154015_1295976 3300020610 Bacteria 569
233 Ga0154015_1675542 3300020610 Bacteria 593
234 Ga0213874_10080966 3300021377 Bacteria 1052
235 Ga0224712_10023353 3300022467 Bacteria 2146
236 Ga0224712_10040311 3300022467 Bacteria 1756
237 Ga0224712_10086555 3300022467 Bacteria 1304
238 Ga0224712_10528619 3300022467 Bacteria 572
239 Ga0207426_1005083 3300025302 Bacteria 6146
240 Ga0207642_10194015 3300025899 Bacteria 1117
241 Ga0207710_10331840 3300025900 Bacteria 772
242 Ga0207710_10333422 3300025900 Bacteria 771
243 Ga0207688_10159887 3300025901 Bacteria 1335
244 Ga0207688_10291667 3300025901 Bacteria 996
245 Ga0207688_10509774 3300025901 Bacteria 754
246 Ga0207688_10820536 3300025901 Bacteria 589
247 Ga0207685_10425936 3300025905 Bacteria 685
248 Ga0207699_10406267 3300025906 Bacteria 971
249 Ga0207645_10336741 3300025907 Bacteria 1008
250 Ga0207643_10187159 3300025908 Bacteria 1255
251 Ga0207671_10006629 3300025914 Bacteria 10272
252 Ga0207663_10375064 3300025916 Bacteria 1082
253 Ga0207660_10438245 3300025917 Bacteria 1055
254 Ga0207662_11366387 3300025918 Bacteria 503
255 Ga0207657_10200846 3300025919 Bacteria 1604
256 Ga0207657_10758866 3300025919 Bacteria 751
257 Ga0207649_11014735 3300025920 Bacteria 653
258 Ga0207652_10917546 3300025921 Bacteria 773
259 Ga0207652_11159145 3300025921 Bacteria 674
260 Ga0207694_10412143 3300025924 Bacteria 1125
261 Ga0207694_11227433 3300025924 Bacteria 634
262 Ga0207694_11451090 3300025924 Bacteria 579
263 Ga0207650_10769763 3300025925 Bacteria 815
264 Ga0207650_10933591 3300025925 Bacteria 737
265 Ga0207659_10867105 3300025926 Bacteria 776
266 Ga0207687_10020152 3300025927 Bacteria 4423
267 Ga0207687_10623126 3300025927 Bacteria 911
268 Ga0207687_10709849 3300025927 Bacteria 854
269 Ga0207700_10020037 3300025928 Bacteria 4532
270 Ga0207664_10340891 3300025929 Bacteria 1325
271 Ga0207664_10666031 3300025929 Bacteria 936
272 Ga0207664_11664844 3300025929 Bacteria 560
273 Ga0207644_10268217 3300025931 Bacteria 1367
274 Ga0207690_10460364 3300025932 Bacteria 1023
275 Ga0207690_11111234 3300025932 Bacteria 659
276 Ga0207690_11444636 3300025932 Bacteria 575
277 Ga0207690_11650152 3300025932 Bacteria 536
278 Ga0207706_10613371 3300025933 Bacteria 934
279 Ga0207686_10310339 3300025934 Bacteria 1175
280 Ga0207686_10672721 3300025934 Bacteria 821
281 Ga0207709_10027907 3300025935 Bacteria 3258
282 Ga0207709_11655727 3300025935 Bacteria 532
283 Ga0207670_10534365 3300025936 Bacteria 956
284 Ga0207670_11317845 3300025936 Bacteria 612
285 Ga0207669_10564610 3300025937 Bacteria 920
286 Ga0207669_11398796 3300025937 Bacteria 596
287 Ga0207665_11137336 3300025939 Bacteria 623
288 Ga0207691_10097609 3300025940 Bacteria 2626
289 Ga0207711_10006894 3300025941 Bacteria 9541
290 Ga0207711_10377122 3300025941 Bacteria 1316
291 Ga0207711_10548816 3300025941 Bacteria 1078
292 Ga0207661_10127477 3300025944 Bacteria 2175
293 Ga0207661_11804645 3300025944 Bacteria 557
294 Ga0207661_11938976 3300025944 Bacteria 535
295 Ga0207679_10943575 3300025945 Bacteria 790
296 Ga0207667_10075039 3300025949 Bacteria 3512
297 Ga0207667_11504646 3300025949 Bacteria 644
298 Ga0207651_12109538 3300025960 Bacteria 506
299 Ga0207712_10076377 3300025961 Bacteria 2425
300 Ga0207712_11805054 3300025961 Bacteria 548
301 Ga0207668_10057966 3300025972 Bacteria 2704
302 Ga0207677_10702486 3300026023 Bacteria 897
303 Ga0207677_10877598 3300026023 Bacteria 807
304 Ga0207677_11331521 3300026023 Bacteria 660
305 Ga0207703_10000009 3300026035 Bacteria 343983
306 Ga0207703_10194578 3300026035 Bacteria 1798
307 Ga0207703_10326404 3300026035 Bacteria 1407
308 Ga0207639_12078028 3300026041 Bacteria 529
309 Ga0207678_10545886 3300026067 Bacteria 1013
310 Ga0207678_10611791 3300026067 Bacteria 956
311 Ga0207678_11371858 3300026067 Bacteria 625
312 Ga0207678_11828408 3300026067 Bacteria 531
313 Ga0207708_11452155 3300026075 Bacteria 602
314 Ga0207708_11694808 3300026075 Bacteria 555
315 Ga0207702_10244783 3300026078 Bacteria 1681
316 Ga0207702_10578113 3300026078 Bacteria 1101
317 Ga0207648_10078394 3300026089 Bacteria 2882
318 Ga0207648_10717003 3300026089 Bacteria 927
319 Ga0207648_11616099 3300026089 Bacteria 609
320 Ga0207648_12065211 3300026089 Bacteria 531
321 Ga0207676_10825903 3300026095 Bacteria 905
322 Ga0207676_12386186 3300026095 Bacteria 526
323 Ga0207674_10310004 3300026116 Bacteria 1527
324 Ga0207674_10357195 3300026116 Bacteria 1412
325 Ga0207674_11370290 3300026116 Bacteria 677
326 Ga0207675_100689343 3300026118 Bacteria 1030
327 Ga0207675_100829545 3300026118 Bacteria 939
328 Ga0207683_10080520 3300026121 Bacteria 2889
329 Ga0207683_10527233 3300026121 Bacteria 1092
330 Ga0207683_10885094 3300026121 Bacteria 829
331 Ga0207683_11631060 3300026121 Bacteria 594
332 Ga0207698_10273345 3300026142 Bacteria 1559
333 Ga0207698_10346174 3300026142 Bacteria 1402
334 Ga0268266_10027754 3300028379 Bacteria 4813
335 Ga0268266_10099981 3300028379 Bacteria 2554
336 Ga0268266_10867680 3300028379 Bacteria 872
337 Ga0268265_10042371 3300028380 Bacteria 3377
338 Ga0268264_10198362 3300028381 Bacteria 1834
339 Ga0307517_10001351 3300028786 Bacteria 41147
340 Ga0307517_10156088 3300028786 Bacteria 1548
341 Ga0307515_10001812 3300028794 Bacteria 47673
342 Ga0310981_1091162 3300029285 Bacteria 761
343 Ga0268256_1062540 3300030500 Bacteria 742
344 Ga0307511_10108881 3300030521 Bacteria 1775
345 Ga0307511_10285694 3300030521 Bacteria 758
346 Ga0307512_10207419 3300030522 Bacteria 1048
347 Ga0307509_10011154 3300031507 Bacteria 10930
348 Ga0307509_10012707 3300031507 Bacteria 10038
349 Ga0307509_10256568 3300031507 Bacteria 1527
350 Ga0307408_100606623 3300031548 Bacteria 973
351 Ga0307508_10000924 3300031616 Bacteria 34111
352 Ga0307508_10003351 3300031616 Bacteria 16261
353 Ga0307508_10012942 3300031616 Bacteria 7628
354 Ga0307508_10097570 3300031616 Bacteria 2531
355 Ga0307508_10263909 3300031616 Bacteria 1316
356 Ga0307514_10107474 3300031649 Bacteria 1987
357 Ga0307516_10039371 3300031730 Bacteria 4712
358 Ga0307516_10045595 3300031730 Bacteria 4329
359 Ga0307516_10190827 3300031730 Bacteria 1775
360 Ga0307405_10100649 3300031731 Bacteria 1937
361 Ga0307405_10147227 3300031731 Bacteria 1651
362 Ga0307405_10541356 3300031731 Bacteria 940
363 Ga0307413_10082563 3300031824 Bacteria 2065
364 Ga0307413_10091348 3300031824 Bacteria 1983
365 Ga0307413_10860122 3300031824 Bacteria 767
366 Ga0307410_10352523 3300031852 Bacteria 1176
367 Ga0326468_10001555 3300031889 Bacteria 1973
368 Ga0307406_10030532 3300031901 Bacteria 3273
369 Ga0307406_10058669 3300031901 Bacteria 2474
370 Ga0307407_10087218 3300031903 Bacteria 1903
371 Ga0307412_11003713 3300031911 Bacteria 738
372 Ga0307409_100142156 3300031995 Bacteria 2069
373 Ga0307409_100354129 3300031995 Bacteria 1386
374 Ga0307409_100452788 3300031995 Bacteria 1239
375 Ga0307409_100640842 3300031995 Bacteria 1055
376 Ga0307409_102710985 3300031995 Bacteria 524
377 Ga0307416_100096719 3300032002 Bacteria 2554
378 Ga0307416_100587117 3300032002 Bacteria 1192
379 Ga0307416_100750823 3300032002 Bacteria 1068
380 Ga0307416_101733795 3300032002 Bacteria 729
381 Ga0307414_10679703 3300032004 Bacteria 930
382 Ga0307411_10082097 3300032005 Bacteria 2222
383 Ga0307411_12138770 3300032005 Bacteria 524
384 Ga0307415_100074865 3300032126 Bacteria 2394
385 Ga0307415_100145656 3300032126 Bacteria 1815
386 Ga0307415_100285088 3300032126 Bacteria 1360
387 Ga0307415_100517647 3300032126 Bacteria 1046
388 Ga0307507_10000482 3300033179 Bacteria 83990
389 Ga0307507_10096663 3300033179 Bacteria 2497
390 Ga0307507_10120549 3300033179 Bacteria 2100
391 Ga0307507_10444868 3300033179 Bacteria 718
392 Ga0307510_10095977 3300033180 Bacteria 2783
393 Ga0307510_10106134 3300033180 Bacteria 2574
394 Ga0307510_10136518 3300033180 Bacteria 2109
395 Ga0316214_1026290 3300033545 Bacteria 820
396 Ga0373949_0069568 3300035090 Bacteria 920
397 Ga0373951_0000463 3300035091 Bacteria 11707
398 Ga0373941_0239828 3300035115 Bacteria 704
399 Ga0373945_0273118 3300035116 Bacteria 719
400 Ga0373960_0108571 3300035121 Bacteria 908
401 Ga0373935_0022806 3300035692 Bacteria 3843
402 Ga0373925_0389249 3300037068 Bacteria 1136
403 Ga0395900_0050861 3300037418 Bacteria 4268
404 Ga0395898_0953350 3300037466 Bacteria 795
405 Ga0395905_0764432 3300037471 Bacteria 869
406 Ga0436364_0164890 3300037853 Bacteria 592
407 Ga0436364_1556898 3300037853 Bacteria 865
408 Ga0395901_0808086 3300038443 Bacteria 926
409 Ga0436365_0905729 3300039437 Bacteria 13103
410 Ga0436363_0026914 3300039450 Bacteria 1052
411 Ga0436363_0492081 3300039450 Bacteria 669
412 Ga0439461_0000353 3300041410 Bacteria 6532
413 Ga0439466_0001023 3300041411 Bacteria 10766
414 Ga0439465_0003128 3300041413 Bacteria 5402
415 Ga0439465_0367819 3300041413 Bacteria 545
416 Ga0451787_802906 3300041441 Bacteria 538
417 Ga0451789_0187238 3300041443 Bacteria 755
418 Ga0451789_1330385 3300041443 Bacteria 2034
419 Ga0451790_07178 3300041444 Bacteria 1719
420 Ga0451794_25357 3300041446 Bacteria 1138
421 Ga0451791_1814107 3300041451 Bacteria 987
422 Ga0451793_0621849 3300041452 Bacteria 588
423 Ga0451793_1066416 3300041452 Bacteria 1069
424 Ga0451797_0774478 3300041453 Bacteria 588
425 Ga0451797_0864649 3300041453 Bacteria 1122
426 Ga0451797_1211872 3300041453 Bacteria 1347
427 Ga0451795_1621111 3300041456 Bacteria 781
428 Ga0451800_0489214 3300041459 Bacteria 553
429 Ga0451802_1113913 3300041460 Bacteria 621
430 Ga0451802_1643678 3300041460 Bacteria 1320
431 Ga0451804_0462733 3300041463 Bacteria 562
432 Ga0451807_0482340 3300041486 Bacteria 545
433 Ga0451807_1220677 3300041486 Bacteria 1168
434 Ga0451833_0393181 3300041491 Bacteria 2121
435 Ga0451837_1730739 3300041494 Bacteria 811
436 Ga0451839_0406887 3300041496 Bacteria 645
437 Ga0451841_0603908 3300041498 Bacteria 1351
438 Ga0451843_0866875 3300041509 Bacteria 2401
439 Ga0451855_0151320 3300041511 Bacteria 635
440 Ga0451853_0729236 3300041512 Bacteria 5080
441 Ga0451853_1021921 3300041512 Bacteria 512
442 Ga0439431_0000355 3300041997 Bacteria 9648
443 Ga0439433_0051694 3300041999 Bacteria 970
444 Ga0439445_0000630 3300042004 Bacteria 7241
445 Ga0439463_074968 3300042016 Bacteria 868
446 Ga0439458_0138275 3300042157 Bacteria 648
447 Ga0439434_0063102 3300042435 Bacteria 1160
448 Ga0439459_0101286 3300042438 Bacteria 705
449 Ga0451577_0513648 3300042876 Bacteria 1088
450 Ga0451577_0518485 3300042876 Bacteria 1082
451 Ga0466969_0018916 3300044656 Bacteria 3586
452 Ga0466972_0004559 3300044658 Bacteria 6941
453 Ga0466972_0261256 3300044658 Bacteria 809
454 Ga0466972_0526363 3300044658 Bacteria 557
455 Ga0466965_0001377 3300044683 Bacteria 9751
456 Ga0466965_0009434 3300044683 Bacteria 4536
457 Ga0466966_0003375 3300044684 Bacteria 10524
458 Ga0466966_0043302 3300044684 Bacteria 2886
459 Ga0466966_0170526 3300044684 Bacteria 1322
460 Ga0466961_0030780 3300044693 Bacteria 3448
461 Ga0466961_0037140 3300044693 Bacteria 3125
462 Ga0466961_0491407 3300044693 Bacteria 741
463 Ga0466963_0187646 3300044694 Bacteria 1444
464 Ga0466964_0299145 3300044706 Bacteria 811
465 Ga0466964_0549402 3300044706 Bacteria 627
466 Ga0453684_1418889 3300044712 Bacteria 719
467 Ga0466971_0000675 3300044719 Bacteria 13616
468 Ga0466971_0123465 3300044719 Bacteria 1199
469 Ga0466971_0136311 3300044719 Bacteria 1142
470 Ga0466971_0513118 3300044719 Bacteria 592
471 Ga0466968_0028149 3300044735 Bacteria 2316
472 Ga0466968_0212703 3300044735 Bacteria 909
473 Ga0466970_0001021 3300044765 Bacteria 13508
474 Ga0466970_0206977 3300044765 Bacteria 1092
475 Ga0466970_0797442 3300044765 Bacteria 553
476 Ga0466970_0837813 3300044765 Bacteria 539
477 Ga0466970_0964420 3300044765 Bacteria 503
478 Ga0466957_0001124 3300044842 Bacteria 13849
479 Ga0466957_0074145 3300044842 Bacteria 2110
480 Ga0466957_0089846 3300044842 Bacteria 1923
481 Ga0466957_0650656 3300044842 Bacteria 741
482 Ga0466960_0002753 3300044901 Bacteria 6654
483 Ga0466959_0003800 3300045049 Bacteria 10015
484 Ga0466959_0015907 3300045049 Bacteria 5489
485 Ga0466959_0025593 3300045049 Bacteria 4375
486 Ga0466959_0041912 3300045049 Bacteria 3378
487 Ga0466959_0677759 3300045049 Bacteria 691
488 Ga0466958_0011830 3300045836 Bacteria 4927
489 Ga0466958_0026511 3300045836 Bacteria 3425
490 Ga0466967_0007609 3300045976 Bacteria 7833
491 Ga0466967_0101371 3300045976 Bacteria 2631
492 Ga0466967_0238227 3300045976 Bacteria 1735
493 Ga0466967_0363566 3300045976 Bacteria 1402
494 Ga0495627_039442 3300046453 Bacteria 1457
495 Ga0495627_100262 3300046453 Bacteria 827
496 Ga0495592_0005017 3300046454 Bacteria 9736
497 Ga0495592_0008230 3300046454 Bacteria 7828
498 Ga0495603_0159931 3300046455 Bacteria 1306
499 Ga0495603_0206622 3300046455 Bacteria 1135
500 Ga0495590_0211305 3300046457 Bacteria 715
501 Ga0495629_0060688 3300046459 Bacteria 2642
502 Ga0495629_0099847 3300046459 Bacteria 2025
503 Ga0495629_0201351 3300046459 Bacteria 1376
504 Ga0495638_0154030 3300046460 Bacteria 1331
505 Ga0495651_0000169 3300046462 Bacteria 48128
506 Ga0495651_0005300 3300046462 Bacteria 9832
507 Ga0495639_0174429 3300046475 Bacteria 1045
508 Ga0495662_0096445 3300046476 Bacteria 1445
509 Ga0495664_0030225 3300046477 Bacteria 3172
510 Ga0495664_0082835 3300046477 Bacteria 1924
511 Ga0495584_0119624 3300046491 Bacteria 1334
512 Ga0495585_0102174 3300046492 Bacteria 1532
513 Ga0495585_0147735 3300046492 Bacteria 1227
514 Ga0495594_0060133 3300046499 Bacteria 2101
515 Ga0495594_0308584 3300046499 Bacteria 901
516 Ga0495608_0060019 3300046511 Bacteria 2504
517 Ga0495608_0756532 3300046511 Bacteria 575
518 Ga0495618_0004578 3300046514 Bacteria 8485
519 Ga0495618_0078305 3300046514 Bacteria 2107
520 Ga0495620_0158527 3300046515 Bacteria 880
521 Ga0495628_0062544 3300046516 Bacteria 2917
522 Ga0495628_0262913 3300046516 Bacteria 1285
523 Ga0495630_0095803 3300046517 Bacteria 2244
524 Ga0495632_0010084 3300046519 Bacteria 5626
525 Ga0495643_0003566 3300046522 Bacteria 11309
526 Ga0495666_0065533 3300046526 Bacteria 1732
527 Ga0495642_0072089 3300046528 Bacteria 1446
528 Ga0495652_0001361 3300046529 Bacteria 27215
529 Ga0495652_0006542 3300046529 Bacteria 10830
530 Ga0495652_0549370 3300046529 Bacteria 794
531 Ga0495640_0007026 3300046533 Bacteria 8862
532 Ga0495586_0673227 3300046535 Bacteria 598
533 Ga0495587_0033543 3300046536 Bacteria 3099
534 Ga0495598_0085680 3300046537 Bacteria 1019
535 Ga0495621_0166726 3300046539 Bacteria 874
536 Ga0495645_0013381 3300046543 Bacteria 5798
537 Ga0495622_0019219 3300046557 Bacteria 3182
538 Ga0495633_0035752 3300046558 Bacteria 2384
539 Ga0495667_0034127 3300046559 Bacteria 3401
540 Ga0495667_0343976 3300046559 Bacteria 943
541 Ga0495656_0044151 3300046615 Bacteria 1875
542 Ga0495634_0003443 3300046642 Bacteria 12687
543 Ga0495634_0121401 3300046642 Bacteria 1673
544 Ga0495611_0048818 3300046648 Bacteria 1903
545 Ga0495635_0010690 3300046663 Bacteria 6426
546 Ga0495635_1068681 3300046663 Bacteria 512
547 Ga0495588_0032147 3300046674 Bacteria 2643
548 Ga0495657_0004038 3300046675 Bacteria 11767
549 Ga0495623_0003245 3300046679 Bacteria 10749
550 Ga0495623_0004870 3300046679 Bacteria 8804
551 Ga0495623_0420944 3300046679 Bacteria 716
552 Ga0495646_0008701 3300046680 Bacteria 6449
553 Ga0495658_0040123 3300046683 Bacteria 2601
554 Ga0495613_0005971 3300046689 Bacteria 9111
555 Ga0495613_0209276 3300046689 Bacteria 1372
556 Ga0495624_0059145 3300046690 Bacteria 2405
557 Ga0495670_0007585 3300046691 Bacteria 5334
558 Ga0495671_0120169 3300046692 Bacteria 1282
559 Ga0495600_0007794 3300046809 Bacteria 6556
560 Ga0495600_0039421 3300046809 Bacteria 3076
561 Ga0495600_0373910 3300046809 Bacteria 890
562 Ga0495600_0721783 3300046809 Bacteria 598
563 Ga0495660_0002768 3300046810 Bacteria 11062
564 Ga0495604_0003385 3300047317 Bacteria 12717
565 Ga0495604_0004624 3300047317 Bacteria 10906
566 Ga0495604_0617798 3300047317 Bacteria 694
567 Ga0495604_0800277 3300047317 Bacteria 594
568 Ga0495636_0182572 3300047318 Bacteria 953
569 Ga0495636_0498302 3300047318 Bacteria 589
570 Ga0495676_0015246 3300047321 Bacteria 6851
571 Ga0495676_0879911 3300047321 Bacteria 574
572 Ga0495680_0125418 3300047322 Bacteria 1892
573 Ga0495680_0673789 3300047322 Bacteria 685
574 Ga0495680_1052841 3300047322 Bacteria 517
575 Ga0495683_0013097 3300047323 Bacteria 4342
576 Ga0495687_025550 3300047443 Bacteria 2789
577 Ga0495687_259525 3300047443 Bacteria 514
578 Ga0495675_0001497 3300047444 Bacteria 14149
579 Ga0495675_0088539 3300047444 Bacteria 1944
580 Ga0495675_0089338 3300047444 Bacteria 1934
581 Ga0495675_0225518 3300047444 Bacteria 1132
582 Ga0495675_0435149 3300047444 Bacteria 760
583 Ga0495677_0116944 3300047445 Bacteria 1016
584 Ga0495679_019249 3300047446 Bacteria 2403
585 Ga0495685_000455 3300047447 Bacteria 12772
586 Ga0495685_013987 3300047447 Bacteria 2723
587 Ga0495681_0001916 3300047470 Bacteria 15254
588 Ga0495681_0305262 3300047470 Bacteria 615
589 Ga0495686_0041778 3300047472 Bacteria 2918
590 Ga0495602_0070215 3300048088 Bacteria 2999
591 Ga0495614_0076371 3300048089 Bacteria 1448
592 Ga0496100_0035427 3300048903 Bacteria 3139
593 Ga0496100_0059373 3300048903 Bacteria 2513
594 Ga0496100_1238589 3300048903 Bacteria 589
595 Ga0496101_0000075 3300048904 Bacteria 112785
596 Ga0496101_0011872 3300048904 Bacteria 5799
597 Ga0496101_0023265 3300048904 Bacteria 4279
598 Ga0496101_0488628 3300048904 Bacteria 972
599 Ga0496102_0000003 3300048905 Bacteria 592263
600 Ga0496102_0067122 3300048905 Bacteria 3289
601 Ga0496102_0096537 3300048905 Bacteria 2740
602 Ga0496102_0577213 3300048905 Bacteria 1047
603 Ga0496103_0000014 3300048906 Bacteria 290397
604 Ga0496104_0093759 3300048907 Bacteria 2872
605 Ga0496104_0096185 3300048907 Bacteria 2833
606 Ga0496104_0117995 3300048907 Bacteria 2547
607 Ga0496105_0269046 3300048908 Bacteria 1377
608 Ga0496105_0832106 3300048908 Bacteria 700
609 Ga0496106_0138601 3300048909 Bacteria 1912
610 Ga0496106_0147980 3300048909 Bacteria 1851
611 Ga0496107_0061966 3300048910 Bacteria 2709
612 Ga0496107_1119752 3300048910 Bacteria 568
613 Ga0496107_1382665 3300048910 Bacteria 501
614 Ga0496108_0085000 3300048911 Bacteria 2685
615 Ga0496108_0253120 3300048911 Bacteria 1532
616 Ga0496108_0360301 3300048911 Bacteria 1269
617 Ga0496108_0462748 3300048911 Bacteria 1108
618 Ga0496109_0058771 3300048912 Bacteria 3512
619 Ga0496109_0165475 3300048912 Bacteria 2073
620 Ga0496109_0181473 3300048912 Bacteria 1977
621 Ga0496109_0540907 3300048912 Bacteria 1099
622 Ga0496110_0085776 3300048913 Bacteria 2810
623 Ga0496110_0275300 3300048913 Bacteria 1533
624 Ga0496111_0039375 3300048914 Bacteria 3388
625 Ga0496112_0011626 3300048915 Bacteria 8051
626 Ga0496112_0155384 3300048915 Bacteria 2254
627 Ga0496113_0003233 3300048916 Bacteria 9720
628 Ga0496113_0018053 3300048916 Bacteria 4908
629 Ga0496114_0009605 3300048917 Bacteria 7684
630 Ga0496114_0020960 3300048917 Bacteria 5309
631 Ga0496114_0535943 3300048917 Bacteria 1035
632 Ga0496115_0326798 3300048918 Bacteria 1254
633 Ga0496116_0000071 3300048919 Bacteria 244521
634 Ga0496117_0000003 3300048920 Bacteria 1881097
635 Ga0496118_0000001 3300048921 Bacteria 1881100
636 Ga0496119_0000527 3300048922 Bacteria 52100
637 Ga0496119_0121327 3300048922 Bacteria 1436
638 Ga0496119_0181343 3300048922 Bacteria 1104
639 Ga0496120_0000235 3300048923 Bacteria 94653
640 Ga0496121_0000019 3300048924 Bacteria 499976
641 Ga0496122_0015410 3300048925 Bacteria 7309
642 Ga0496123_0006264 3300048926 Bacteria 11592
643 Ga0496126_0000951 3300048929 Bacteria 49637
644 Ga0496126_0011441 3300048929 Bacteria 9184
645 Ga0496126_0020119 3300048929 Bacteria 6552
646 Ga0496126_0432601 3300048929 Bacteria 1062
647 Ga0496126_0495762 3300048929 Bacteria 977
648 Ga0496126_1242094 3300048929 Bacteria 546
649 Ga0496126_1308979 3300048929 Bacteria 527
650 Ga0501306_008396 3300049127 Bacteria 1259
651 Ga0501306_030508 3300049127 Bacteria 799
652 Ga0501308_020253 3300049128 Bacteria 827
653 Ga0501309_013241 3300049129 Bacteria 1095
654 Ga0501309_044144 3300049129 Bacteria 687
655 Ga0501310_021149 3300049130 Bacteria 812
656 Ga0501304_040726 3300049160 Bacteria 518
657 Ga0501305_022556 3300049161 Bacteria 937
658 Ga0501307_036495 3300049162 Bacteria 701
659 Ga0501307_053000 3300049162 Bacteria 614
660 Ga0501311_014031 3300049527 Bacteria 1019
661 Ga0501311_101720 3300049527 Bacteria 509
662 Ga0501312_023268 3300049528 Bacteria 932
663 Ga0501312_053178 3300049528 Bacteria 687
664 Ga0501312_075695 3300049528 Bacteria 603
665 Ga0501314_001561 3300049530 Bacteria 1674
666 Ga0501315_100865 3300049531 Bacteria 510
667 Ga0501316_006966 3300049532 Bacteria 1217
668 Ga0501316_008288 3300049532 Bacteria 1145
669 Ga0501317_013188 3300049533 Bacteria 1030
670 Ga0501317_013275 3300049533 Bacteria 1028
671 Ga0501317_050835 3300049533 Bacteria 658
672 Ga0501318_012530 3300049534 Bacteria 974
673 Ga0501321_005201 3300049537 Bacteria 1277
674 Ga0501321_061930 3300049537 Bacteria 567
675 Ga0501324_014639 3300049540 Bacteria 754
676 Ga0501324_047228 3300049540 Bacteria 503
677 Ga0501325_011299 3300049541 Bacteria 823
678 Ga0501336_025574 3300049552 Bacteria 559
679 Ga0501031_0003261 3300049568 Bacteria 10426
680 Ga0501032_0001347 3300049569 Bacteria 19514
681 Ga0501032_0221765 3300049569 Bacteria 1230
682 Ga0501032_0650407 3300049569 Bacteria 669
683 Ga0501033_0005545 3300049570 Bacteria 9978
684 Ga0501034_0011756 3300049571 Bacteria 9058
685 Ga0501034_0177975 3300049571 Bacteria 2092
686 Ga0501036_0074674 3300049572 Bacteria 2867
687 Ga0501036_0302136 3300049572 Bacteria 1338
688 Ga0501037_0004030 3300049573 Bacteria 10649
689 Ga0501038_0007465 3300049574 Bacteria 10087
690 Ga0501038_0130009 3300049574 Bacteria 2068
691 Ga0501038_0992853 3300049574 Bacteria 617
692 Ga0501039_0003016 3300049575 Bacteria 12590
693 Ga0501039_0341118 3300049575 Bacteria 1177
694 Ga0501040_0002706 3300049576 Bacteria 11426
695 Ga0501040_0047321 3300049576 Bacteria 2938
696 Ga0501041_0002671 3300049577 Bacteria 10179
697 Ga0501041_0723543 3300049577 Bacteria 637
698 Ga0501042_0073359 3300049578 Bacteria 2448
699 Ga0501042_0088501 3300049578 Bacteria 2221
700 Ga0501042_0736570 3300049578 Bacteria 717
701 Ga0501043_0028012 3300049579 Bacteria 4421
702 Ga0501043_0274529 3300049579 Bacteria 1293
703 Ga0501046_0002011 3300049580 Bacteria 19297
704 Ga0501046_0473748 3300049580 Bacteria 899
705 Ga0501047_0000278 3300049581 Bacteria 59271
706 Ga0501047_0008040 3300049581 Bacteria 9951
707 Ga0501047_0119157 3300049581 Bacteria 2521
708 Ga0501047_0220639 3300049581 Bacteria 1752
709 Ga0501048_0001026 3300049582 Bacteria 20878
710 Ga0501067_0000592 3300049583 Bacteria 19503
711 Ga0501068_0003271 3300049584 Bacteria 8684
712 Ga0501069_0005589 3300049585 Bacteria 6539
713 Ga0501070_0004123 3300049586 Bacteria 12503
714 Ga0501071_0045415 3300049587 Bacteria 3153
715 Ga0501072_0001152 3300049588 Bacteria 19660
716 Ga0501072_0054085 3300049588 Bacteria 3162
717 Ga0501073_0004460 3300049589 Bacteria 10515
718 Ga0501074_0003829 3300049590 Bacteria 10704
719 Ga0501074_0881490 3300049590 Bacteria 630
720 Ga0501075_0343782 3300049591 Bacteria 1137
721 Ga0501076_0010773 3300049592 Bacteria 6796
722 Ga0501077_0031876 3300049593 Bacteria 3353
723 Ga0501221_200839 3300049704 Bacteria 554
724 Ga0501079_0007489 3300049741 Bacteria 8256
725 Ga0501080_0091006 3300049742 Bacteria 2833
726 Ga0501080_0144771 3300049742 Bacteria 2197
727 Ga0501083_0008844 3300049744 Bacteria 7110
728 Ga0501035_0097200 3300049822 Bacteria 2586
729 Ga0501035_0122555 3300049822 Bacteria 2271
730 Ga0501044_0010423 3300049823 Bacteria 10087
731 Ga0501044_0301918 3300049823 Bacteria 1529
732 Ga0501044_1015399 3300049823 Bacteria 701
733 Ga0501045_0005656 3300049824 Bacteria 8648
734 Ga0501045_0366432 3300049824 Bacteria 1072
735 nmdc:mga03683_482660_c1 3300050489 Bacteria 599
736 nmdc:mga03n38_128391_c1 3300050490 Bacteria 1254
737 nmdc:mga00v17_286344_c1 3300050491 Bacteria 1070
738 nmdc:mga00v17_326959_c1 3300050491 Bacteria 996
739 nmdc:mga00v17_361571_c1 3300050491 Bacteria 944
740 nmdc:mga00v17_452689_c1 3300050491 Bacteria 833
741 nmdc:mga00v17_64510_c1 3300050491 Bacteria 2257
742 nmdc:mga00v17_72839_c1 3300050491 Bacteria 2132
743 nmdc:mga0yw44_21262_c1 3300050492 Bacteria 3616
744 nmdc:mga0yw44_59749_c1 3300050492 Bacteria 2333
745 nmdc:mga07m45_696255_c1 3300050496 Bacteria 584
746 nmdc:mga05p37_64020_c1 3300050507 Bacteria 4524
747 nmdc:mga0rr50_1593263_c1 3300050513 Bacteria 551
748 nmdc:mga0sz30_13994_c1 3300050516 Bacteria 3151
749 nmdc:mga0sz30_86476_c1 3300050516 Bacteria 1361
750 Ga0495601_0044431 3300053077 Bacteria 2792
751 Ga0495612_0001114 3300053078 Bacteria 11005
752 Ga0495655_0105304 3300053083 Bacteria 841
753 Ga0495595_0600755 3300053084 Bacteria 563
754 Ga0495619_0039496 3300053085 Bacteria 3081
755 Ga0500578_0006009 3300053086 Bacteria 8160
756 Ga0500583_0132654 3300053092 Bacteria 1236
757 Ga0500651_0490205 3300053093 Bacteria 679
758 Ga0500566_0009561 3300053094 Bacteria 5727
759 Ga0500654_002699 3300053099 Bacteria 12710
760 Ga0500660_024964 3300053100 Bacteria 3158
761 Ga0500558_064320 3300053106 Bacteria 1525
762 Ga0500560_117181 3300053107 Bacteria 893
763 Ga0500569_000210 3300053109 Bacteria 9330
764 Ga0500580_110091 3300053113 Bacteria 1067
765 Ga0500594_0039080 3300053118 Bacteria 1289
766 Ga0500608_308905 3300053122 Bacteria 582
767 Ga0500614_165070 3300053123 Bacteria 672
768 Ga0500621_092407 3300053126 Bacteria 1202
769 Ga0500628_080887 3300053129 Bacteria 831
770 Ga0500652_001087 3300053131 Bacteria 8784
771 Ga0500658_0002819 3300053134 Bacteria 6668
772 Ga0500659_0289263 3300053135 Bacteria 742
773 Ga0500559_0449843 3300053136 Bacteria 596
774 Ga0500561_0000167 3300053137 Bacteria 12188
775 Ga0500568_0027056 3300053139 Bacteria 2401
776 Ga0500573_0032934 3300053140 Bacteria 2990
777 Ga0500573_0180499 3300053140 Bacteria 1135
778 Ga0500573_0332596 3300053140 Bacteria 745
779 Ga0500577_0183465 3300053142 Bacteria 898
780 Ga0500579_134694 3300053143 Bacteria 1140
781 Ga0500586_242712 3300053145 Bacteria 569
782 Ga0500588_0313911 3300053146 Bacteria 594
783 Ga0500600_0006438 3300053149 Bacteria 7001
784 Ga0500603_051840 3300053150 Bacteria 1125
785 Ga0500616_0004474 3300053153 Bacteria 9936
786 Ga0500616_0006073 3300053153 Bacteria 8012
787 Ga0500627_0195703 3300053158 Bacteria 907
788 Ga0500630_091102 3300053159 Bacteria 1408
789 Ga0500633_0000736 3300053160 Bacteria 5570
790 Ga0500634_0024229 3300053161 Bacteria 3300
791 Ga0500636_0215330 3300053177 Bacteria 1005
792 Ga0500636_0313595 3300053177 Bacteria 766
793 Ga0500656_000179 3300053732 Bacteria 4156
794 Ga0500587_000176 3300053739 Bacteria 6411
795 Ga0500587_012825 3300053739 Bacteria 1057
796 Ga0501084_0001550 3300054114 Bacteria 18271
797 Ga0587084_020265 3300059477 Bacteria 987
798 Ga0587084_033914 3300059477 Bacteria 836
799 Ga0587073_0074026 3300059492 Bacteria 830
800 Ga0587073_0078929 3300059492 Bacteria 813
801 Ga0587073_0116826 3300059492 Bacteria 715
802 Ga0587077_085610 3300059493 Bacteria 732
803 Ga0587077_113410 3300059493 Bacteria 667
804 Ga0587080_099869 3300059503 Bacteria 620
805 Ga0587082_022401 3300059504 Bacteria 1039
806 Ga0587083_0206547 3300059505 Bacteria 564
807 Ga0587085_178273 3300059506 Bacteria 508
808 Ga0587088_042869 3300059508 Bacteria 859
809 Ga0587090_028502 3300059510 Bacteria 920
810 Ga0587090_082861 3300059510 Bacteria 645
811 Ga0587092_044616 3300059512 Bacteria 783
812 Ga0587098_005666 3300059604 Bacteria 1235
813 Ga0587098_007546 3300059604 Bacteria 1135
814 Ga0587106_009824 3300059605 Bacteria 1226
815 Ga0587125_038170 3300059607 Bacteria 639
816 Ga0587129_006660 3300059608 Bacteria 821
817 Ga0587101_032470 3300059623 Bacteria 822
818 Ga0587109_046161 3300059624 Bacteria 880
819 Ga0587117_028126 3300059627 Bacteria 831
820 Ga0587067_023577 3300059640 Bacteria 1080
821 Ga0587067_028532 3300059640 Bacteria 1014
822 Ga0587072_107055 3300059643 Bacteria 634
823 Ga0587079_076859 3300059647 Bacteria 756
824 Ga0587100_018129 3300059648 Bacteria 666
825 Ga0587102_015709 3300059649 Bacteria 807
826 Ga0587107_014459 3300059652 Bacteria 1015
827 Ga0587119_018189 3300059658 Bacteria 875
828 Ga0587124_012606 3300059660 Bacteria 783
829 Ga0587071_016330 3300060344 Bacteria 1313
830 Ga0587071_163019 3300060344 Bacteria 562
831 Ga0587111_0001599 3300060346 Bacteria 2785
832 Ga0587111_0082473 3300060346 Bacteria 771
833 Ga0501082_0013322 3300060353 Bacteria 7070
834 Ga0501082_0309796 3300060353 Bacteria 1375
835 Ga0466962_0000160 3300061719 Bacteria 28430
836 Ga0466962_0032722 3300061719 Bacteria 2488
837 Ga0466962_0111398 3300061719 Bacteria 1318
838 Ga0466962_0111769 3300061719 Bacteria 1315
839 Ga0466962_0454679 3300061719 Bacteria 645
840 2554256784 2554235005 Bacteria 6457341
841 2644014453 2643221601 Bacteria 7493239
842 2644175890 2643221631 Bacteria 8168043
843 2793976332 2791355406 Bacteria 11364898
844 2819742258 2818991472 Bacteria 10089953
845 2867481061 2867475112 Bacteria 6909112
846 2912718451 2912715099 Bacteria 9460473
847 2990092165 2990088156 Bacteria 6657676
848 3006326219 3006321560 Bacteria 8247479
849 3006427943 3006425503 Bacteria 6491253
850 8025486085 8025478263 Bacteria 8209203
851 8047896979 8047893842 Bacteria 11723082
852 8048132579 8048127548 Bacteria 11053136
853 8048361973 8048356638 Bacteria 11044339
854 8048373964 8048369669 Bacteria 11666822
855 8048384263 8048379754 Bacteria 11877923
856 8054160791 8054160619 Bacteria 7783213
857 8056447903 8056447290 Bacteria 7680491
858 8056673136 8056667051 Bacteria 6953971
859 Ga0501037_0392039
860 JGI25160J50197_1032287
861 Ga0058859_10027059
862 Ga0058861_12031117
863 Ga0058860_10020864
864 Ga0058860_12055840
865 Ga0058862_10019043
866 Ga0058862_12685021
867 Ga0070658_11036574
868 Ga0070683_100243292
869 Ga0070683_100730630
870 Ga0070683_101138786
871 Ga0070670_100425233
872 Ga0070670_100760505
873 Ga0068869_100293072
874 Ga0070682_100283454
875 Ga0070682_100420354
876 Ga0068868_100719583
877 Ga0068868_101528756
878 Ga0070660_100392575
879 Ga0070689_100898597
880 Ga0070687_100565731
881 Ga0070661_100303924
882 Ga0070692_10467664
883 Ga0070692_11211312
884 Ga0070668_100198226
885 Ga0070668_101450308
886 Ga0070669_101860188
887 Ga0070675_100820281
888 Ga0070671_100314327
889 Ga0070671_100546495
890 Ga0070674_101090453
891 Ga0070674_101177552
892 Ga0070673_100855117
893 Ga0070673_101041985
894 Ga0070659_100346616
895 Ga0070659_101468914
896 Ga0070667_100005984
897 Ga0070667_100313417
898 Ga0070667_100552437
899 Ga0070703_10117275
900 Ga0070714_100233697
901 Ga0070714_100319510
902 Ga0070713_100004669
903 Ga0070701_10842954
904 Ga0070711_100253031
905 Ga0070700_100780034
906 Ga0070700_101998074
907 Ga0070663_100166935
908 Ga0070678_100132027
909 Ga0070678_100420815
910 Ga0070678_101247103
911 Ga0070678_101280762
912 Ga0070662_100552981
913 Ga0070662_101939477
914 Ga0068867_100312233
915 Ga0070685_10284947
916 Ga0070685_11409986
917 Ga0070685_11481707
918 Ga0070706_101774999
919 Ga0070679_101137379
920 Ga0070679_101142826
921 Ga0070679_101800756
922 Ga0070684_100285523
923 Ga0070672_100582283
924 Ga0070672_101372942
925 Ga0070686_100186467
926 Ga0070686_101484268
927 Ga0070693_100400377
928 Ga0070693_101028264
929 Ga0070665_100125445
930 Ga0070665_102611067
931 Ga0070664_100611988
932 Ga0070664_100964697
933 Ga0068857_100367935
934 Ga0068854_101954602
935 Ga0068856_100781514
936 Ga0068856_101071620
937 Ga0070702_100134868
938 Ga0068852_100025908
939 Ga0068852_100649273
940 Ga0068852_101215577
941 Ga0068859_100743950
942 Ga0068864_100521326
943 Ga0068864_100627925
944 Ga0068866_10632194
945 Ga0068861_100130584
946 Ga0068851_10299893
947 Ga0068870_10582921
948 Ga0068870_11409036
949 Ga0068863_100342072
950 Ga0068863_101686661
951 Ga0068858_100000013
952 Ga0068858_100212121
953 Ga0068860_100780105
954 Ga0081455_10106856
955 Ga0081455_10386216
956 Ga0081455_10547032
957 Ga0081540_1005568
958 Ga0070717_11314727
959 Ga0075365_10006681
960 Ga0075365_10075797
961 Ga0075365_10855404
962 Ga0075365_10948699
963 Ga0075363_100038892
964 Ga0075364_10048616
965 Ga0075364_10202272
966 Ga0075364_10208663
967 Ga0075364_10683225
968 Ga0075369_10032174
969 Ga0075369_10361646
970 Ga0075366_10421996
971 Ga0097621_100222109
972 Ga0075370_10988178
973 Ga0068871_101351922
974 Ga0068865_100534181
975 Ga0097620_100743961
976 Ga0105244_10272877
977 Ga0105244_10576351
978 Ga0105250_10195966
979 Ga0111539_11678634
980 Ga0105245_10059566
981 Ga0105245_10078141
982 Ga0105245_10116828
983 Ga0105245_10388478
984 Ga0105247_10161516
985 Ga0105247_10252526
986 Ga0105247_11306377
987 Ga0105243_10683988
988 Ga0105243_10987054
989 Ga0105243_11658954
990 Ga0105241_10074305
991 Ga0105241_10738320
992 Ga0105241_11899740
993 Ga0105242_10262583
994 Ga0105242_10413133
995 Ga0105242_10643137
996 Ga0105248_10096561
997 Ga0105248_10150854
998 Ga0105248_10372568
999 Ga0105248_11187432
1000 Ga0105237_10009127
1001 Ga0105238_10409424
1002 Ga0105238_11431897
1003 Ga0105249_10632895
1004 Ga0105249_11724993
1005 Ga0105249_12478515
1006 Ga0105239_10005526
1007 Ga0105239_10942334
1008 Ga0105239_11459766
1009 Ga0105246_10813620
1010 Ga0105246_10995822
1011 Ga0105246_11572961
1012 Ga0105246_12571340
1013 Ga0157337_1005161
1014 Ga0157322_1001742
1015 Ga0157327_1044190
1016 Ga0157326_1022361
1017 Ga0157371_10483286
1018 Ga0157370_10950512
1019 Ga0157370_11509372
1020 Ga0157369_10156154
1021 Ga0157369_10990050
1022 Ga0157369_12484095
1023 Ga0157374_10290071
1024 Ga0157374_11027292
1025 Ga0157374_11830770
1026 Ga0157374_12382849
1027 Ga0157378_11790932
1028 Ga0157378_11996588
1029 Ga0157378_12095641
1030 Ga0163162_10127782
1031 Ga0163162_10882261
1032 Ga0163162_12321706
1033 Ga0157372_11358944
1034 Ga0157372_11397875
1035 Ga0157372_11521351
1036 Ga0157372_12980673
1037 Ga0157375_10016636
1038 Ga0157375_10268334
1039 Ga0157375_11680425
1040 Ga0157375_12579190
1041 Ga0163163_10057195
1042 Ga0163163_10395536
1043 Ga0163163_10743846
1044 Ga0163163_11532606
1045 Ga0157380_10408869
1046 Ga0157380_11088257
1047 Ga0157380_11921502
1048 Ga0157380_12077116
1049 Ga0157380_12279246
1050 Ga0182008_10724126
1051 Ga0157377_10099821
1052 Ga0157377_11215011
1053 Ga0157379_10000012
1054 Ga0157379_10579836
1055 Ga0157376_10234942
1056 Ga0163161_11128673
1057 Ga0163161_11297982
1058 Ga0197907_10433734
1059 Ga0197907_10477661
1060 Ga0197907_11152397
1061 Ga0206356_10344010
1062 Ga0206356_11141088
1063 Ga0206356_11473966
1064 Ga0206349_1334537
1065 Ga0206349_1527023
1066 Ga0206349_1563816
1067 Ga0206349_1899702
1068 Ga0206355_1431124
1069 Ga0206355_1519402
1070 Ga0206355_1612783
1071 Ga0206351_10233981
1072 Ga0206351_10393194
1073 Ga0206351_10580594
1074 Ga0206351_10619467
1075 Ga0206352_10732747
1076 Ga0206352_10762487
1077 Ga0206352_11111464
1078 Ga0206352_11329365
1079 Ga0206350_10015308
1080 Ga0206350_10952296
1081 Ga0206354_10008953
1082 Ga0206354_10314494
1083 Ga0206354_10395367
1084 Ga0206354_10448514
1085 Ga0206354_10954251
1086 Ga0206353_10604234
1087 Ga0206353_10689809
1088 Ga0206353_11202414
1089 Ga0206353_11207679
1090 Ga0154015_1295976
1091 Ga0154015_1675542
1092 Ga0213874_10080966
1093 Ga0224712_10023353
1094 Ga0224712_10040311
1095 Ga0224712_10086555
1096 Ga0224712_10528619
1097 Ga0207426_1005083
1098 Ga0207642_10194015
1099 Ga0207710_10331840
1100 Ga0207710_10333422
1101 Ga0207688_10159887
1102 Ga0207688_10291667
1103 Ga0207688_10509774
1104 Ga0207688_10820536
1105 Ga0207685_10425936
1106 Ga0207699_10406267
1107 Ga0207645_10336741
1108 Ga0207643_10187159
1109 Ga0207671_10006629
1110 Ga0207663_10375064
1111 Ga0207660_10438245
1112 Ga0207662_11366387
1113 Ga0207657_10200846
1114 Ga0207657_10758866
1115 Ga0207649_11014735
1116 Ga0207652_10917546
1117 Ga0207652_11159145
1118 Ga0207694_10412143
1119 Ga0207694_11227433
1120 Ga0207694_11451090
1121 Ga0207650_10769763
1122 Ga0207650_10933591
1123 Ga0207659_10867105
1124 Ga0207687_10020152
1125 Ga0207687_10623126
1126 Ga0207687_10709849
1127 Ga0207700_10020037
1128 Ga0207664_10340891
1129 Ga0207664_10666031
1130 Ga0207664_11664844
1131 Ga0207644_10268217
1132 Ga0207690_10460364
1133 Ga0207690_11111234
1134 Ga0207690_11444636
1135 Ga0207690_11650152
1136 Ga0207706_10613371
1137 Ga0207686_10310339
1138 Ga0207686_10672721
1139 Ga0207709_10027907
1140 Ga0207709_11655727
1141 Ga0207670_10534365
1142 Ga0207670_11317845
1143 Ga0207669_10564610
1144 Ga0207669_11398796
1145 Ga0207665_11137336
1146 Ga0207691_10097609
1147 Ga0207711_10006894
1148 Ga0207711_10377122
1149 Ga0207711_10548816
1150 Ga0207661_10127477
1151 Ga0207661_11804645
1152 Ga0207661_11938976
1153 Ga0207679_10943575
1154 Ga0207667_10075039
1155 Ga0207667_11504646
1156 Ga0207651_12109538
1157 Ga0207712_10076377
1158 Ga0207712_11805054
1159 Ga0207668_10057966
1160 Ga0207677_10702486
1161 Ga0207677_10877598
1162 Ga0207677_11331521
1163 Ga0207703_10000009
1164 Ga0207703_10194578
1165 Ga0207703_10326404
1166 Ga0207639_12078028
1167 Ga0207678_10545886
1168 Ga0207678_10611791
1169 Ga0207678_11371858
1170 Ga0207678_11828408
1171 Ga0207708_11452155
1172 Ga0207708_11694808
1173 Ga0207702_10244783
1174 Ga0207702_10578113
1175 Ga0207648_10078394
1176 Ga0207648_10717003
1177 Ga0207648_11616099
1178 Ga0207648_12065211
1179 Ga0207676_10825903
1180 Ga0207676_12386186
1181 Ga0207674_10310004
1182 Ga0207674_10357195
1183 Ga0207674_11370290
1184 Ga0207675_100689343
1185 Ga0207675_100829545
1186 Ga0207683_10080520
1187 Ga0207683_10527233
1188 Ga0207683_10885094
1189 Ga0207683_11631060
1190 Ga0207698_10273345
1191 Ga0207698_10346174
1192 Ga0268266_10027754
1193 Ga0268266_10099981
1194 Ga0268266_10867680
1195 Ga0268265_10042371
1196 Ga0268264_10198362
1197 Ga0307517_10001351
1198 Ga0307517_10156088
1199 Ga0307515_10001812
1200 Ga0310981_1091162
1201 Ga0268256_1062540
1202 Ga0307511_10108881
1203 Ga0307511_10285694
1204 Ga0307512_10207419
1205 Ga0307509_10011154
1206 Ga0307509_10012707
1207 Ga0307509_10256568
1208 Ga0307408_100606623
1209 Ga0307508_10000924
1210 Ga0307508_10003351
1211 Ga0307508_10012942
1212 Ga0307508_10097570
1213 Ga0307508_10263909
1214 Ga0307514_10107474
1215 Ga0307516_10039371
1216 Ga0307516_10045595
1217 Ga0307516_10190827
1218 Ga0307405_10100649
1219 Ga0307405_10147227
1220 Ga0307405_10541356
1221 Ga0307413_10082563
1222 Ga0307413_10091348
1223 Ga0307413_10860122
1224 Ga0307410_10352523
1225 Ga0326468_10001555
1226 Ga0307406_10030532
1227 Ga0307406_10058669
1228 Ga0307407_10087218
1229 Ga0307412_11003713
1230 Ga0307409_100142156
1231 Ga0307409_100354129
1232 Ga0307409_100452788
1233 Ga0307409_100640842
1234 Ga0307409_102710985
1235 Ga0307416_100096719
1236 Ga0307416_100587117
1237 Ga0307416_100750823
1238 Ga0307416_101733795
1239 Ga0307414_10679703
1240 Ga0307411_10082097
1241 Ga0307411_12138770
1242 Ga0307415_100074865
1243 Ga0307415_100145656
1244 Ga0307415_100285088
1245 Ga0307415_100517647
1246 Ga0307507_10000482
1247 Ga0307507_10096663
1248 Ga0307507_10120549
1249 Ga0307507_10444868
1250 Ga0307510_10095977
1251 Ga0307510_10106134
1252 Ga0307510_10136518
1253 Ga0316214_1026290
1254 Ga0373949_0069568
1255 Ga0373951_0000463
1256 Ga0373941_0239828
1257 Ga0373945_0273118
1258 Ga0373960_0108571
1259 Ga0373935_0022806
1260 Ga0373925_0389249
1261 Ga0395900_0050861
1262 Ga0395898_0953350
1263 Ga0395905_0764432
1264 Ga0436364_0164890
1265 Ga0436364_1556898
1266 Ga0395901_0808086
1267 Ga0436365_0905729
1268 Ga0436363_0026914
1269 Ga0436363_0492081
1270 Ga0439461_0000353
1271 Ga0439466_0001023
1272 Ga0439465_0003128
1273 Ga0439465_0367819
1274 Ga0451787_802906
1275 Ga0451789_0187238
1276 Ga0451789_1330385
1277 Ga0451790_07178
1278 Ga0451794_25357
1279 Ga0451791_1814107
1280 Ga0451793_0621849
1281 Ga0451793_1066416
1282 Ga0451797_0774478
1283 Ga0451797_0864649
1284 Ga0451797_1211872
1285 Ga0451795_1621111
1286 Ga0451800_0489214
1287 Ga0451802_1113913
1288 Ga0451802_1643678
1289 Ga0451804_0462733
1290 Ga0451807_0482340
1291 Ga0451807_1220677
1292 Ga0451833_0393181
1293 Ga0451837_1730739
1294 Ga0451839_0406887
1295 Ga0451841_0603908
1296 Ga0451843_0866875
1297 Ga0451855_0151320
1298 Ga0451853_0729236
1299 Ga0451853_1021921
1300 Ga0439431_0000355
1301 Ga0439433_0051694
1302 Ga0439445_0000630
1303 Ga0439463_074968
1304 Ga0439458_0138275
1305 Ga0439434_0063102
1306 Ga0439459_0101286
1307 Ga0451577_0513648
1308 Ga0451577_0518485
1309 Ga0466969_0018916
1310 Ga0466972_0004559
1311 Ga0466972_0261256
1312 Ga0466972_0526363
1313 Ga0466965_0001377
1314 Ga0466965_0009434
1315 Ga0466966_0003375
1316 Ga0466966_0043302
1317 Ga0466966_0170526
1318 Ga0466961_0030780
1319 Ga0466961_0037140
1320 Ga0466961_0491407
1321 Ga0466963_0187646
1322 Ga0466964_0299145
1323 Ga0466964_0549402
1324 Ga0453684_1418889
1325 Ga0466971_0000675
1326 Ga0466971_0123465
1327 Ga0466971_0136311
1328 Ga0466971_0513118
1329 Ga0466968_0028149
1330 Ga0466968_0212703
1331 Ga0466970_0001021
1332 Ga0466970_0206977
1333 Ga0466970_0797442
1334 Ga0466970_0837813
1335 Ga0466970_0964420
1336 Ga0466957_0001124
1337 Ga0466957_0074145
1338 Ga0466957_0089846
1339 Ga0466957_0650656
1340 Ga0466960_0002753
1341 Ga0466959_0003800
1342 Ga0466959_0015907
1343 Ga0466959_0025593
1344 Ga0466959_0041912
1345 Ga0466959_0677759
1346 Ga0466958_0011830
1347 Ga0466958_0026511
1348 Ga0466967_0007609
1349 Ga0466967_0101371
1350 Ga0466967_0238227
1351 Ga0466967_0363566
1352 Ga0495627_039442
1353 Ga0495627_100262
1354 Ga0495592_0005017
1355 Ga0495592_0008230
1356 Ga0495603_0159931
1357 Ga0495603_0206622
1358 Ga0495590_0211305
1359 Ga0495629_0060688
1360 Ga0495629_0099847
1361 Ga0495629_0201351
1362 Ga0495638_0154030
1363 Ga0495651_0000169
1364 Ga0495651_0005300
1365 Ga0495639_0174429
1366 Ga0495662_0096445
1367 Ga0495664_0030225
1368 Ga0495664_0082835
1369 Ga0495584_0119624
1370 Ga0495585_0102174
1371 Ga0495585_0147735
1372 Ga0495594_0060133
1373 Ga0495594_0308584
1374 Ga0495608_0060019
1375 Ga0495608_0756532
1376 Ga0495618_0004578
1377 Ga0495618_0078305
1378 Ga0495620_0158527
1379 Ga0495628_0062544
1380 Ga0495628_0262913
1381 Ga0495630_0095803
1382 Ga0495632_0010084
1383 Ga0495643_0003566
1384 Ga0495666_0065533
1385 Ga0495642_0072089
1386 Ga0495652_0001361
1387 Ga0495652_0006542
1388 Ga0495652_0549370
1389 Ga0495640_0007026
1390 Ga0495586_0673227
1391 Ga0495587_0033543
1392 Ga0495598_0085680
1393 Ga0495621_0166726
1394 Ga0495645_0013381
1395 Ga0495622_0019219
1396 Ga0495633_0035752
1397 Ga0495667_0034127
1398 Ga0495667_0343976
1399 Ga0495656_0044151
1400 Ga0495634_0003443
1401 Ga0495634_0121401
1402 Ga0495611_0048818
1403 Ga0495635_0010690
1404 Ga0495635_1068681
1405 Ga0495588_0032147
1406 Ga0495657_0004038
1407 Ga0495623_0003245
1408 Ga0495623_0004870
1409 Ga0495623_0420944
1410 Ga0495646_0008701
1411 Ga0495658_0040123
1412 Ga0495613_0005971
1413 Ga0495613_0209276
1414 Ga0495624_0059145
1415 Ga0495670_0007585
1416 Ga0495671_0120169
1417 Ga0495600_0007794
1418 Ga0495600_0039421
1419 Ga0495600_0373910
1420 Ga0495600_0721783
1421 Ga0495660_0002768
1422 Ga0495604_0003385
1423 Ga0495604_0004624
1424 Ga0495604_0617798
1425 Ga0495604_0800277
1426 Ga0495636_0182572
1427 Ga0495636_0498302
1428 Ga0495676_0015246
1429 Ga0495676_0879911
1430 Ga0495680_0125418
1431 Ga0495680_0673789
1432 Ga0495680_1052841
1433 Ga0495683_0013097
1434 Ga0495687_025550
1435 Ga0495687_259525
1436 Ga0495675_0001497
1437 Ga0495675_0088539
1438 Ga0495675_0089338
1439 Ga0495675_0225518
1440 Ga0495675_0435149
1441 Ga0495677_0116944
1442 Ga0495679_019249
1443 Ga0495685_000455
1444 Ga0495685_013987
1445 Ga0495681_0001916
1446 Ga0495681_0305262
1447 Ga0495686_0041778
1448 Ga0495602_0070215
1449 Ga0495614_0076371
1450 Ga0496100_0035427
1451 Ga0496100_0059373
1452 Ga0496100_1238589
1453 Ga0496101_0000075
1454 Ga0496101_0011872
1455 Ga0496101_0023265
1456 Ga0496101_0488628
1457 Ga0496102_0000003
1458 Ga0496102_0067122
1459 Ga0496102_0096537
1460 Ga0496102_0577213
1461 Ga0496103_0000014
1462 Ga0496104_0093759
1463 Ga0496104_0096185
1464 Ga0496104_0117995
1465 Ga0496105_0269046
1466 Ga0496105_0832106
1467 Ga0496106_0138601
1468 Ga0496106_0147980
1469 Ga0496107_0061966
1470 Ga0496107_1119752
1471 Ga0496107_1382665
1472 Ga0496108_0085000
1473 Ga0496108_0253120
1474 Ga0496108_0360301
1475 Ga0496108_0462748
1476 Ga0496109_0058771
1477 Ga0496109_0165475
1478 Ga0496109_0181473
1479 Ga0496109_0540907
1480 Ga0496110_0085776
1481 Ga0496110_0275300
1482 Ga0496111_0039375
1483 Ga0496112_0011626
1484 Ga0496112_0155384
1485 Ga0496113_0003233
1486 Ga0496113_0018053
1487 Ga0496114_0009605
1488 Ga0496114_0020960
1489 Ga0496114_0535943
1490 Ga0496115_0326798
1491 Ga0496116_0000071
1492 Ga0496117_0000003
1493 Ga0496118_0000001
1494 Ga0496119_0000527
1495 Ga0496119_0121327
1496 Ga0496119_0181343
1497 Ga0496120_0000235
1498 Ga0496121_0000019
1499 Ga0496122_0015410
1500 Ga0496123_0006264
1501 Ga0496126_0000951
1502 Ga0496126_0011441
1503 Ga0496126_0020119
1504 Ga0496126_0432601
1505 Ga0496126_0495762
1506 Ga0496126_1242094
1507 Ga0496126_1308979
1508 Ga0501306_008396
1509 Ga0501306_030508
1510 Ga0501308_020253
1511 Ga0501309_013241
1512 Ga0501309_044144
1513 Ga0501310_021149
1514 Ga0501304_040726
1515 Ga0501305_022556
1516 Ga0501307_036495
1517 Ga0501307_053000
1518 Ga0501311_014031
1519 Ga0501311_101720
1520 Ga0501312_023268
1521 Ga0501312_053178
1522 Ga0501312_075695
1523 Ga0501314_001561
1524 Ga0501315_100865
1525 Ga0501316_006966
1526 Ga0501316_008288
1527 Ga0501317_013188
1528 Ga0501317_013275
1529 Ga0501317_050835
1530 Ga0501318_012530
1531 Ga0501321_005201
1532 Ga0501321_061930
1533 Ga0501324_014639
1534 Ga0501324_047228
1535 Ga0501325_011299
1536 Ga0501336_025574
1537 Ga0501031_0003261
1538 Ga0501032_0001347
1539 Ga0501032_0221765
1540 Ga0501032_0650407
1541 Ga0501033_0005545
1542 Ga0501034_0011756
1543 Ga0501034_0177975
1544 Ga0501036_0074674
1545 Ga0501036_0302136
1546 Ga0501037_0004030
1547 Ga0501038_0007465
1548 Ga0501038_0130009
1549 Ga0501038_0992853
1550 Ga0501039_0003016
1551 Ga0501039_0341118
1552 Ga0501040_0002706
1553 Ga0501040_0047321
1554 Ga0501041_0002671
1555 Ga0501041_0723543
1556 Ga0501042_0073359
1557 Ga0501042_0088501
1558 Ga0501042_0736570
1559 Ga0501043_0028012
1560 Ga0501043_0274529
1561 Ga0501046_0002011
1562 Ga0501046_0473748
1563 Ga0501047_0000278
1564 Ga0501047_0008040
1565 Ga0501047_0119157
1566 Ga0501047_0220639
1567 Ga0501048_0001026
1568 Ga0501067_0000592
1569 Ga0501068_0003271
1570 Ga0501069_0005589
1571 Ga0501070_0004123
1572 Ga0501071_0045415
1573 Ga0501072_0001152
1574 Ga0501072_0054085
1575 Ga0501073_0004460
1576 Ga0501074_0003829
1577 Ga0501074_0881490
1578 Ga0501075_0343782
1579 Ga0501076_0010773
1580 Ga0501077_0031876
1581 Ga0501221_200839
1582 Ga0501079_0007489
1583 Ga0501080_0091006
1584 Ga0501080_0144771
1585 Ga0501083_0008844
1586 Ga0501035_0097200
1587 Ga0501035_0122555
1588 Ga0501044_0010423
1589 Ga0501044_0301918
1590 Ga0501044_1015399
1591 Ga0501045_0005656
1592 Ga0501045_0366432
1593 nmdc:mga03683_482660_c1
1594 nmdc:mga03n38_128391_c1
1595 nmdc:mga00v17_286344_c1
1596 nmdc:mga00v17_326959_c1
1597 nmdc:mga00v17_361571_c1
1598 nmdc:mga00v17_452689_c1
1599 nmdc:mga00v17_64510_c1
1600 nmdc:mga00v17_72839_c1
1601 nmdc:mga0yw44_21262_c1
1602 nmdc:mga0yw44_59749_c1
1603 nmdc:mga07m45_696255_c1
1604 nmdc:mga05p37_64020_c1
1605 nmdc:mga0rr50_1593263_c1
1606 nmdc:mga0sz30_13994_c1
1607 nmdc:mga0sz30_86476_c1
1608 Ga0495601_0044431
1609 Ga0495612_0001114
1610 Ga0495655_0105304
1611 Ga0495595_0600755
1612 Ga0495619_0039496
1613 Ga0500578_0006009
1614 Ga0500583_0132654
1615 Ga0500651_0490205
1616 Ga0500566_0009561
1617 Ga0500654_002699
1618 Ga0500660_024964
1619 Ga0500558_064320
1620 Ga0500560_117181
1621 Ga0500569_000210
1622 Ga0500580_110091
1623 Ga0500594_0039080
1624 Ga0500608_308905
1625 Ga0500614_165070
1626 Ga0500621_092407
1627 Ga0500628_080887
1628 Ga0500652_001087
1629 Ga0500658_0002819
1630 Ga0500659_0289263
1631 Ga0500559_0449843
1632 Ga0500561_0000167
1633 Ga0500568_0027056
1634 Ga0500573_0032934
1635 Ga0500573_0180499
1636 Ga0500573_0332596
1637 Ga0500577_0183465
1638 Ga0500579_134694
1639 Ga0500586_242712
1640 Ga0500588_0313911
1641 Ga0500600_0006438
1642 Ga0500603_051840
1643 Ga0500616_0004474
1644 Ga0500616_0006073
1645 Ga0500627_0195703
1646 Ga0500630_091102
1647 Ga0500633_0000736
1648 Ga0500634_0024229
1649 Ga0500636_0215330
1650 Ga0500636_0313595
1651 Ga0500656_000179
1652 Ga0500587_000176
1653 Ga0500587_012825
1654 Ga0501084_0001550
1655 Ga0587084_020265
1656 Ga0587084_033914
1657 Ga0587073_0074026
1658 Ga0587073_0078929
1659 Ga0587073_0116826
1660 Ga0587077_085610
1661 Ga0587077_113410
1662 Ga0587080_099869
1663 Ga0587082_022401
1664 Ga0587083_0206547
1665 Ga0587085_178273
1666 Ga0587088_042869
1667 Ga0587090_028502
1668 Ga0587090_082861
1669 Ga0587092_044616
1670 Ga0587098_005666
1671 Ga0587098_007546
1672 Ga0587106_009824
1673 Ga0587125_038170
1674 Ga0587129_006660
1675 Ga0587101_032470
1676 Ga0587109_046161
1677 Ga0587117_028126
1678 Ga0587067_023577
1679 Ga0587067_028532
1680 Ga0587072_107055
1681 Ga0587079_076859
1682 Ga0587100_018129
1683 Ga0587102_015709
1684 Ga0587107_014459
1685 Ga0587119_018189
1686 Ga0587124_012606
1687 Ga0587071_016330
1688 Ga0587071_163019
1689 Ga0587111_0001599
1690 Ga0587111_0082473
1691 Ga0501082_0013322
1692 Ga0501082_0309796
1693 Ga0466962_0000160
1694 Ga0466962_0032722
1695 Ga0466962_0111398
1696 Ga0466962_0111769
1697 Ga0466962_0454679
1698 2554256784
1699 2644014453
1700 2644175890
1701 2793976332
1702 2819742258
1703 2867481061
1704 2912718451
1705 2990092165
1706 3006326219
1707 3006427943
1708 8025486085
1709 8047896979
1710 8048132579
1711 8048361973
1712 8048373964
1713 8048384263
1714 8054160791
1715 8056447903
1716 8056673136

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

31

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5d-assembly1.cif.gz_BX structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. 0.9555 14 104
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9537 13 98
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9529 11 101
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9438 14 98
6spb-assembly1.cif.gz_T pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9431 14 100
ID Description Score Start End Superfamily
af_D3ZFK7_36_158_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9489 13 95 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9374 13 99 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9308 16 99 3.30.70.330
4qs3X00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9215 16 101 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9075 13 99 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A419EVM5-F1-model_v4 Large ribosomal subunit protein uL23 0.9787 13 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A369VT02-F1-model_v4 Large ribosomal subunit protein uL23 0.978 14 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A399FYL2-F1-model_v4 Large ribosomal subunit protein uL23 0.9778 13 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7V9E522-F1-model_v4 50S ribosomal protein L23 0.9774 13 99 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G6YI82-F1-model_v4 Large ribosomal subunit protein uL23 0.977 14 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map