F483757

General Info

Members Datasets Scaffolds Average Seq Length
858 404 1716 383

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_001022|Ga0500618_001022_3488_4759
Length 423
Sequence MEALTVSNISFAQLATHQSSGDAQRRKRQFQFVKGNSPVSINKDFRTIAAANGIADDTAYGAVTPPLYLSSNFAFRKFEQAQAYEYSRTSNPTRDLLADTLAKLEGGAGAVVTSSGMAAVNLVLSLLKPGDRVIAPHDCYGGTYRLLAALRDKGHFHVEFVDQGNQEHLASALTRGATLVFVETPSNPLMRIVDINAIARQTKSAQARLVVDNTFLSPALQRPIALGADFVIHSTTKYLNGHSDVVGGTVVGANANDVEELKAWANIIGVTGSPFDSYLTLRGIRSLFARIERQQTTAMAVARFLSQHRQVGVVHYPGLPTHPGHELAARQQSGFGAMLSFELEGGLEAVRYFVAGLRIFTLAESLGGVESLVAHPASMTHVGMGAEARHAAGIKEGLLRVSVGLEAEEDLLSDLATSLAKIE

Samples

Sample ID Description Type Environment
1 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
120 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
123 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
188 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
189 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
190 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
191 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
227 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
228 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
229 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
230 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
231 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
318 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
319 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
325 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
326 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
327 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
339 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
343 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
344 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
347 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
348 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
349 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
350 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
351 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
352 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
353 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
354 2643221607 Rhizobium sp. Root73 Isolate Unclassified
355 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
356 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
357 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
358 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
359 2643221729 Bacillus sp. Root11 Isolate Unclassified
360 2643221730 Bacillus sp. Root131 Isolate Unclassified
361 2684622632 Bacillus cereus 905 Isolate Unclassified
362 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
363 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
364 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
365 2738541358 Bacillus sp. OV752 Isolate Unclassified
366 2738543006 Bacillus sp. OK077 Isolate Unclassified
367 2738543017 Bacillus sp. OV186 Isolate Unclassified
368 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
369 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
370 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
371 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
372 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
373 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
374 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
375 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
376 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
377 2857586860 Bacillus sp. R-71935 Isolate Unclassified
378 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
379 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
380 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
381 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
382 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
383 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
384 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
385 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
386 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
387 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
388 2938917290 Bacillus sp. CR71 Isolate Unclassified
389 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
390 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
391 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
392 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
393 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
394 2965761152 Bacillus sp. COPE52 Isolate Unclassified
395 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
396 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
397 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
398 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
399 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
400 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
401 8022792930 Bacillus sp. Xin Isolate Rhizosphere
402 8023438354 Bacillus sp. BH2 Isolate Unclassified
403 8023444577 Bacillus sp. BH32 Isolate Unclassified
404 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.12
Metatranscriptomes 0
Isolates 6.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.01
Nodule 0.58
Rhizoplane 5.71
Rhizosphere 78.09
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500618_001022 3300053125 Bacteria 14017
2 JGI24740J21852_10000067 3300001979 Bacteria 34146
3 JGI25155J39150_1000021 3300002704 Bacteria 150730
4 JGI25156J39149_1000022 3300002705 Bacteria 150730
5 JGI25162J39368_1000768 3300002737 Bacteria 21685
6 JGI25162J39368_1007079 3300002737 Bacteria 1808
7 JGI25154J39366_1000048 3300002738 Bacteria 126252
8 JGI25157J39369_1000025 3300002741 Bacteria 150726
9 JGI25159J45721_1001956 3300002987 Bacteria 8207
10 JGI25151J46595_10000200 3300003187 Bacteria 73683
11 JGI25151J46595_10001902 3300003187 Bacteria 13270
12 JGI25151J46595_10008914 3300003187 Bacteria 4786
13 JGI25151J46595_10009147 3300003187 Bacteria 4714
14 JGI25165J46597_1000866 3300003214 Bacteria 21685
15 rootH1_10263746 3300003323 Bacteria 2212
16 Ga0055532_1000126 3300003758 Bacteria 76489
17 Ga0055536_1001449 3300003781 Bacteria 14277
18 Ga0055531_10013001 3300003794 Bacteria 3870
19 Ga0065715_10108125 3300005293 Bacteria 2735
20 Ga0070658_10000088 3300005327 Bacteria 85441
21 Ga0070658_10000930 3300005327 Bacteria 25063
22 Ga0070658_10040249 3300005327 Bacteria 3770
23 Ga0070658_10056117 3300005327 Bacteria 3201
24 Ga0070658_10084410 3300005327 Unclassified 2611
25 Ga0070658_10103327 3300005327 Bacteria 2357
26 Ga0070658_10219345 3300005327 Bacteria 1608
27 Ga0070676_10023903 3300005328 Unclassified 3437
28 Ga0070683_100082114 3300005329 Bacteria 3018
29 Ga0070690_100054220 3300005330 Bacteria 2566
30 Ga0070690_100203021 3300005330 Bacteria 1380
31 Ga0068869_100048558 3300005334 Bacteria 3069
32 Ga0070666_10029720 3300005335 Bacteria 3595
33 Ga0070680_100081930 3300005336 Bacteria 2662
34 Ga0070680_100239569 3300005336 Bacteria 1533
35 Ga0070682_100071514 3300005337 Unclassified 2220
36 Ga0068868_100147466 3300005338 Unclassified 1936
37 Ga0070660_100054524 3300005339 Bacteria 3088
38 Ga0070692_10009417 3300005345 Bacteria 4404
39 Ga0070668_100005416 3300005347 Bacteria 9473
40 Ga0070668_100108007 3300005347 Bacteria 2212
41 Ga0070669_100110512 3300005353 Bacteria 2085
42 Ga0070675_100126407 3300005354 Bacteria 2175
43 Ga0070675_100244615 3300005354 Bacteria 1568
44 Ga0070675_100301146 3300005354 Bacteria 1413
45 Ga0070671_100010754 3300005355 Bacteria 7345
46 Ga0070674_100000051 3300005356 Bacteria 51724
47 Ga0070674_100051511 3300005356 Bacteria 2837
48 Ga0070673_100145146 3300005364 Unclassified 2006
49 Ga0070673_100146664 3300005364 Bacteria 1995
50 Ga0070659_100019292 3300005366 Bacteria 5164
51 Ga0070667_100242062 3300005367 Bacteria 1611
52 Ga0070703_10004280 3300005406 Bacteria 4021
53 Ga0070709_10000961 3300005434 Bacteria 15980
54 Ga0070709_10002694 3300005434 Bacteria 9592
55 Ga0070709_10119210 3300005434 Bacteria 1786
56 Ga0070714_100013846 3300005435 Bacteria 6467
57 Ga0070711_100000042 3300005439 Bacteria 84000
58 Ga0070711_100004639 3300005439 Bacteria 8133
59 Ga0070705_100002218 3300005440 Bacteria 9876
60 Ga0070705_100054283 3300005440 Bacteria 2350
61 Ga0070705_100062832 3300005440 Bacteria 2213
62 Ga0070705_100064377 3300005440 Bacteria 2190
63 Ga0070694_100012511 3300005444 Bacteria 5278
64 Ga0070694_100058655 3300005444 Bacteria 2619
65 Ga0070694_100059773 3300005444 Bacteria 2597
66 Ga0070694_100073102 3300005444 Bacteria 2367
67 Ga0070694_100079917 3300005444 Bacteria 2271
68 Ga0070694_100201254 3300005444 Unclassified 1485
69 Ga0070708_100002721 3300005445 Bacteria 13720
70 Ga0070708_100007399 3300005445 Bacteria 8785
71 Ga0070708_100012615 3300005445 Bacteria 6902
72 Ga0070708_100101052 3300005445 Bacteria 2640
73 Ga0070663_100166477 3300005455 Bacteria 1701
74 Ga0070678_100010192 3300005456 Bacteria 5729
75 Ga0070678_100101513 3300005456 Bacteria 2230
76 Ga0070662_100012673 3300005457 Bacteria 5596
77 Ga0070681_10040737 3300005458 Bacteria 4653
78 Ga0070681_10084492 3300005458 Bacteria 3126
79 Ga0068867_100000105 3300005459 Bacteria 53757
80 Ga0068867_100038567 3300005459 Bacteria 3478
81 Ga0068867_100064912 3300005459 Bacteria 2715
82 Ga0070706_100004195 3300005467 Bacteria 13995
83 Ga0070706_100018895 3300005467 Bacteria 6357
84 Ga0070706_100031700 3300005467 Bacteria 4873
85 Ga0070706_100044665 3300005467 Bacteria 4093
86 Ga0070706_100058297 3300005467 Bacteria 3564
87 Ga0070706_100077352 3300005467 Bacteria 3080
88 Ga0070707_100000424 3300005468 Bacteria 41821
89 Ga0070707_100012132 3300005468 Bacteria 8045
90 Ga0070707_100050316 3300005468 Bacteria 3994
91 Ga0070707_100056206 3300005468 Bacteria 3775
92 Ga0070707_100169318 3300005468 Bacteria 2129
93 Ga0070707_100409915 3300005468 Bacteria 1316
94 Ga0070698_100001017 3300005471 Bacteria 30831
95 Ga0070698_100007200 3300005471 Bacteria 12052
96 Ga0070698_100036570 3300005471 Bacteria 5070
97 Ga0070698_100041965 3300005471 Bacteria 4695
98 Ga0070698_100089610 3300005471 Bacteria 3060
99 Ga0070698_100092091 3300005471 Bacteria 3012
100 Ga0070698_100096235 3300005471 Bacteria 2938
101 Ga0070699_100000214 3300005518 Bacteria 57401
102 Ga0070699_100000323 3300005518 Bacteria 46254
103 Ga0070699_100001300 3300005518 Bacteria 23052
104 Ga0070699_100005410 3300005518 Bacteria 11195
105 Ga0070699_100005704 3300005518 Bacteria 10904
106 Ga0070699_100006606 3300005518 Bacteria 10084
107 Ga0070699_100054949 3300005518 Bacteria 3448
108 Ga0070699_100081319 3300005518 Bacteria 2824
109 Ga0070699_100099817 3300005518 Bacteria 2544
110 Ga0070699_100132089 3300005518 Bacteria 2201
111 Ga0070679_100034282 3300005530 Bacteria 5030
112 Ga0070679_100043973 3300005530 Bacteria 4448
113 Ga0070679_100132311 3300005530 Bacteria 2475
114 Ga0070684_100054255 3300005535 Bacteria 3492
115 Ga0070684_100153434 3300005535 Bacteria 2087
116 Ga0070684_100219972 3300005535 Unclassified 1733
117 Ga0070697_100000978 3300005536 Bacteria 21569
118 Ga0070697_100005606 3300005536 Bacteria 9672
119 Ga0070697_100008921 3300005536 Bacteria 7835
120 Ga0070697_100018428 3300005536 Bacteria 5503
121 Ga0070697_100057993 3300005536 Bacteria 3150
122 Ga0070697_100095318 3300005536 Bacteria 2467
123 Ga0070697_100102639 3300005536 Bacteria 2376
124 Ga0070697_100108894 3300005536 Bacteria 2307
125 Ga0068853_100000379 3300005539 Bacteria 30522
126 Ga0068853_100013999 3300005539 Bacteria 6562
127 Ga0068853_100142862 3300005539 Bacteria 2149
128 Ga0070672_100163950 3300005543 Bacteria 1846
129 Ga0070686_100215635 3300005544 Bacteria 1384
130 Ga0070695_100004478 3300005545 Bacteria 8207
131 Ga0070695_100004986 3300005545 Bacteria 7826
132 Ga0070695_100012708 3300005545 Bacteria 5054
133 Ga0070695_100016650 3300005545 Bacteria 4453
134 Ga0070695_100017339 3300005545 Bacteria 4366
135 Ga0070695_100023116 3300005545 Bacteria 3817
136 Ga0070695_100045700 3300005545 Bacteria 2792
137 Ga0070696_100001570 3300005546 Bacteria 14963
138 Ga0070696_100002058 3300005546 Bacteria 13191
139 Ga0070696_100003170 3300005546 Bacteria 10949
140 Ga0070696_100004043 3300005546 Bacteria 9781
141 Ga0070696_100013474 3300005546 Bacteria 5486
142 Ga0070696_100198850 3300005546 Bacteria 1495
143 Ga0070704_100002951 3300005549 Bacteria 9674
144 Ga0070704_100004126 3300005549 Bacteria 8384
145 Ga0070704_100006978 3300005549 Bacteria 6698
146 Ga0070704_100088720 3300005549 Bacteria 2298
147 Ga0070704_100132699 3300005549 Bacteria 1933
148 Ga0070704_100258588 3300005549 Bacteria 1433
149 Ga0068855_100000173 3300005563 Bacteria 82962
150 Ga0068855_100046214 3300005563 Bacteria 5147
151 Ga0068855_100349972 3300005563 Bacteria 1628
152 Ga0070664_100009642 3300005564 Bacteria 7834
153 Ga0070664_100069393 3300005564 Bacteria 3016
154 Ga0070664_100088458 3300005564 Unclassified 2678
155 Ga0068857_100000037 3300005577 Bacteria 72271
156 Ga0068857_100014839 3300005577 Bacteria 6795
157 Ga0068854_100000155 3300005578 Bacteria 46783
158 Ga0068854_100011752 3300005578 Bacteria 5714
159 Ga0068856_100061326 3300005614 Bacteria 3715
160 Ga0068856_100189030 3300005614 Bacteria 2073
161 Ga0068852_100000060 3300005616 Bacteria 73764
162 Ga0068852_100007002 3300005616 Bacteria 8207
163 Ga0068852_100016276 3300005616 Bacteria 5793
164 Ga0068852_100101952 3300005616 Bacteria 2593
165 Ga0068852_100290956 3300005616 Bacteria 1578
166 Ga0068859_100014945 3300005617 Bacteria 7792
167 Ga0068859_100047934 3300005617 Bacteria 4292
168 Ga0068859_100316633 3300005617 Bacteria 1654
169 Ga0068864_100038559 3300005618 Bacteria 4081
170 Ga0068864_100120885 3300005618 Bacteria 2342
171 Ga0068864_100172242 3300005618 Bacteria 1974
172 Ga0068864_100172316 3300005618 Bacteria 1974
173 Ga0068866_10000089 3300005718 Bacteria 37940
174 Ga0068861_100022544 3300005719 Bacteria 4539
175 Ga0068861_100184845 3300005719 Bacteria 1737
176 Ga0068851_10051817 3300005834 Bacteria 2086
177 Ga0068851_10053311 3300005834 Unclassified 2059
178 Ga0068870_10022667 3300005840 Bacteria 3088
179 Ga0068863_100024078 3300005841 Bacteria 5809
180 Ga0068863_100346622 3300005841 Bacteria 1446
181 Ga0068858_100002910 3300005842 Bacteria 17221
182 Ga0068858_100182716 3300005842 Unclassified 1980
183 Ga0068862_100025988 3300005844 Bacteria 4920
184 Ga0081455_10021249 3300005937 Bacteria 6090
185 Ga0068871_100154425 3300006358 Bacteria 1959
186 Ga0075428_100032572 3300006844 Bacteria 5757
187 Ga0075428_100140034 3300006844 Bacteria 2630
188 Ga0075428_100151453 3300006844 Bacteria 2520
189 Ga0075428_100271391 3300006844 Bacteria 1825
190 Ga0075428_100285135 3300006844 Bacteria 1777
191 Ga0075430_100011922 3300006846 Bacteria 7400
192 Ga0075431_100013317 3300006847 Bacteria 8312
193 Ga0075431_100067740 3300006847 Bacteria 3685
194 Ga0075431_100141528 3300006847 Bacteria 2480
195 Ga0075431_100170418 3300006847 Bacteria 2237
196 Ga0075431_100221008 3300006847 Bacteria 1932
197 Ga0075433_10000417 3300006852 Bacteria 27154
198 Ga0075433_10032796 3300006852 Bacteria 4450
199 Ga0075433_10039292 3300006852 Bacteria 4091
200 Ga0075433_10063335 3300006852 Bacteria 3239
201 Ga0075433_10101883 3300006852 Bacteria 2542
202 Ga0075433_10156122 3300006852 Bacteria 2030
203 Ga0075434_100021972 3300006871 Bacteria 6210
204 Ga0075434_100024845 3300006871 Bacteria 5857
205 Ga0075434_100025785 3300006871 Bacteria 5755
206 Ga0075434_100030166 3300006871 Bacteria 5339
207 Ga0075434_100042605 3300006871 Bacteria 4500
208 Ga0075434_100350208 3300006871 Bacteria 1498
209 Ga0075429_100000245 3300006880 Bacteria 37442
210 Ga0075429_100026890 3300006880 Bacteria 4995
211 Ga0068865_100024985 3300006881 Bacteria 3924
212 Ga0068865_100041162 3300006881 Bacteria 3143
213 Ga0075436_100006278 3300006914 Bacteria 8143
214 Ga0075436_100012872 3300006914 Bacteria 5735
215 Ga0075436_100028747 3300006914 Bacteria 3824
216 Ga0075436_100150499 3300006914 Bacteria 1638
217 Ga0097620_100014945 3300006931 Bacteria 7792
218 Ga0097620_100047935 3300006931 Bacteria 4292
219 Ga0097620_100316601 3300006931 Bacteria 1654
220 Ga0075435_100030291 3300007076 Bacteria 4253
221 Ga0075435_100050811 3300007076 Bacteria 3337
222 Ga0099794_10000209 3300007265 Bacteria 21183
223 Ga0099794_10023753 3300007265 Bacteria 2808
224 Ga0105251_10065619 3300009011 Bacteria 1698
225 Ga0105244_10063488 3300009036 Bacteria 1855
226 Ga0105244_10090664 3300009036 Bacteria 1503
227 Ga0105244_10131485 3300009036 Bacteria 1207
228 Ga0105244_10137388 3300009036 Bacteria 1177
229 Ga0105250_10015525 3300009092 Bacteria 3117
230 Ga0105240_10001752 3300009093 Bacteria 36654
231 Ga0105240_10017002 3300009093 Bacteria 9826
232 Ga0105240_10206402 3300009093 Bacteria 2299
233 Ga0105240_10263024 3300009093 Bacteria 1989
234 Ga0111539_10065774 3300009094 Bacteria 4283
235 Ga0111539_10128706 3300009094 Bacteria 2966
236 Ga0111539_10151820 3300009094 Bacteria 2711
237 Ga0111539_10196392 3300009094 Bacteria 2353
238 Ga0105245_10008907 3300009098 Bacteria 8760
239 Ga0105245_10020091 3300009098 Bacteria 5855
240 Ga0105245_10195763 3300009098 Bacteria 1939
241 Ga0114129_10000842 3300009147 Bacteria 39704
242 Ga0114129_10058540 3300009147 Bacteria 5389
243 Ga0114129_10060174 3300009147 Bacteria 5310
244 Ga0114129_10060316 3300009147 Bacteria 5304
245 Ga0114129_10103781 3300009147 Bacteria 3930
246 Ga0114129_10116171 3300009147 Bacteria 3687
247 Ga0114129_10118161 3300009147 Bacteria 3652
248 Ga0114129_10162690 3300009147 Bacteria 3047
249 Ga0105241_10002544 3300009174 Bacteria 13686
250 Ga0105241_10003242 3300009174 Bacteria 12101
251 Ga0105248_10001920 3300009177 Bacteria 23071
252 Ga0105248_10357544 3300009177 Bacteria 1644
253 Ga0105237_10000038 3300009545 Bacteria 190707
254 Ga0105237_10000378 3300009545 Bacteria 63407
255 Ga0105237_10007764 3300009545 Bacteria 11701
256 Ga0105238_10003191 3300009551 Bacteria 16361
257 Ga0105249_10034132 3300009553 Bacteria 4608
258 Ga0105249_10169024 3300009553 Bacteria 2119
259 Ga0105239_10000108 3300010375 Bacteria 116364
260 Ga0105239_10000232 3300010375 Bacteria 82037
261 Ga0105239_10033598 3300010375 Bacteria 5632
262 Ga0105239_10035885 3300010375 Bacteria 5444
263 Ga0105239_10106815 3300010375 Unclassified 3101
264 Ga0105239_10265918 3300010375 Unclassified 1928
265 Ga0105246_10025986 3300011119 Bacteria 3819
266 Ga0157373_10013102 3300013100 Bacteria 6086
267 Ga0157371_10000011 3300013102 Bacteria 377608
268 Ga0157371_10012401 3300013102 Bacteria 6517
269 Ga0157371_10026023 3300013102 Bacteria 4258
270 Ga0157371_10104704 3300013102 Bacteria 2008
271 Ga0157370_10001010 3300013104 Bacteria 35540
272 Ga0157369_10019197 3300013105 Bacteria 7650
273 Ga0157369_10062381 3300013105 Bacteria 4017
274 Ga0171463_1009 3300013249 Bacteria 288284
275 Ga0157378_10001196 3300013297 Bacteria 23552
276 Ga0163162_10021040 3300013306 Bacteria 6417
277 Ga0163162_10033518 3300013306 Bacteria 5105
278 Ga0163162_10238539 3300013306 Bacteria 1949
279 Ga0163162_10583199 3300013306 Bacteria 1245
280 Ga0157372_10003085 3300013307 Bacteria 17940
281 Ga0157372_10043260 3300013307 Bacteria 4986
282 Ga0157372_10094480 3300013307 Bacteria 3405
283 Ga0157372_10258575 3300013307 Bacteria 2022
284 Ga0157375_10011591 3300013308 Bacteria 7789
285 Ga0157375_10035997 3300013308 Bacteria 4730
286 Ga0157375_10180905 3300013308 Bacteria 2260
287 Ga0157375_10335493 3300013308 Bacteria 1677
288 Ga0157375_10623542 3300013308 Bacteria 1236
289 Ga0163163_10064971 3300014325 Bacteria 3621
290 Ga0157377_10014060 3300014745 Bacteria 4067
291 Ga0157379_10022316 3300014968 Bacteria 5608
292 Ga0157379_10076534 3300014968 Unclassified 2996
293 Ga0157376_10345516 3300014969 Bacteria 1422
294 Ga0183363_1132 3300015690 Bacteria 18933
295 Ga0163161_10048311 3300017792 Bacteria 3073
296 Ga0213874_10022602 3300021377 Bacteria 1747
297 Ga0213875_10003417 3300021388 Bacteria 9038
298 Ga0209435_100033 3300025206 Bacteria 150395
299 Ga0209147_100182 3300025229 Bacteria 76541
300 Ga0209147_102454 3300025229 Bacteria 4590
301 Ga0209437_100326 3300025233 Bacteria 60536
302 Ga0209437_100653 3300025233 Bacteria 19877
303 Ga0209646_1000116 3300025246 Bacteria 150395
304 Ga0209026_1000103 3300025250 Bacteria 152843
305 Ga0209759_1000105 3300025256 Bacteria 150395
306 Ga0209233_1000505 3300025261 Bacteria 23256
307 Ga0209130_1001456 3300025284 Bacteria 15598
308 Ga0209130_1002177 3300025284 Bacteria 10330
309 Ga0209130_1002890 3300025284 Bacteria 7926
310 Ga0209130_1015391 3300025284 Bacteria 1887
311 Ga0209130_1018617 3300025284 Bacteria 1626
312 Ga0209676_1000082 3300025292 Bacteria 280400
313 Ga0209676_1000204 3300025292 Bacteria 132896
314 Ga0209676_1003265 3300025292 Bacteria 10197
315 Ga0209025_1000127 3300025294 Bacteria 200766
316 Ga0209025_1000302 3300025294 Bacteria 110301
317 Ga0209025_1001914 3300025294 Bacteria 24196
318 Ga0209025_1002745 3300025294 Bacteria 17818
319 Ga0209025_1002785 3300025294 Bacteria 17647
320 Ga0209025_1003039 3300025294 Bacteria 16550
321 Ga0209025_1004968 3300025294 Bacteria 11126
322 Ga0209025_1011227 3300025294 Bacteria 5937
323 Ga0209025_1011903 3300025294 Bacteria 5662
324 Ga0209025_1012611 3300025294 Bacteria 5401
325 Ga0209025_1016191 3300025294 Bacteria 4424
326 Ga0209025_1025518 3300025294 Bacteria 3004
327 Ga0209257_1000218 3300025304 Bacteria 135855
328 Ga0209257_1030103 3300025304 Bacteria 1757
329 Ga0207697_10035643 3300025315 Bacteria 2037
330 Ga0207696_1004839 3300025711 Bacteria 5711
331 Ga0207655_1005330 3300025728 Bacteria 8787
332 Ga0207713_1028977 3300025735 Bacteria 2488
333 Ga0207653_10000273 3300025885 Bacteria 30551
334 Ga0207682_10007409 3300025893 Bacteria 4372
335 Ga0207642_10000046 3300025899 Bacteria 35514
336 Ga0207642_10084847 3300025899 Bacteria 1548
337 Ga0207647_10021374 3300025904 Bacteria 4320
338 Ga0207699_10002055 3300025906 Bacteria 9504
339 Ga0207699_10014531 3300025906 Bacteria 4061
340 Ga0207645_10000126 3300025907 Bacteria 58037
341 Ga0207645_10000968 3300025907 Bacteria 23749
342 Ga0207643_10007769 3300025908 Bacteria 5760
343 Ga0207705_10000138 3300025909 Bacteria 78969
344 Ga0207705_10019433 3300025909 Bacteria 4859
345 Ga0207705_10051675 3300025909 Bacteria 2958
346 Ga0207684_10009386 3300025910 Bacteria 8641
347 Ga0207684_10021137 3300025910 Bacteria 5556
348 Ga0207684_10035113 3300025910 Bacteria 4258
349 Ga0207684_10045424 3300025910 Bacteria 3726
350 Ga0207684_10079113 3300025910 Bacteria 2797
351 Ga0207707_10015158 3300025912 Bacteria 6710
352 Ga0207707_10170807 3300025912 Bacteria 1900
353 Ga0207695_10008932 3300025913 Bacteria 12475
354 Ga0207671_10000045 3300025914 Bacteria 201245
355 Ga0207671_10000222 3300025914 Bacteria 85244
356 Ga0207663_10000029 3300025916 Bacteria 99755
357 Ga0207663_10021704 3300025916 Bacteria 3659
358 Ga0207660_10019170 3300025917 Bacteria 4569
359 Ga0207662_10002952 3300025918 Bacteria 8646
360 Ga0207657_10027762 3300025919 Bacteria 5177
361 Ga0207657_10030969 3300025919 Bacteria 4850
362 Ga0207649_10033575 3300025920 Bacteria 3067
363 Ga0207652_10015401 3300025921 Bacteria 6211
364 Ga0207652_10038090 3300025921 Bacteria 4073
365 Ga0207652_10211736 3300025921 Bacteria 1745
366 Ga0207646_10001346 3300025922 Bacteria 30514
367 Ga0207646_10020973 3300025922 Bacteria 6044
368 Ga0207646_10029267 3300025922 Bacteria 5008
369 Ga0207646_10031254 3300025922 Bacteria 4822
370 Ga0207646_10049773 3300025922 Bacteria 3752
371 Ga0207646_10057511 3300025922 Bacteria 3474
372 Ga0207646_10063943 3300025922 Bacteria 3284
373 Ga0207646_10107380 3300025922 Bacteria 2504
374 Ga0207646_10189008 3300025922 Bacteria 1860
375 Ga0207694_10002617 3300025924 Bacteria 14600
376 Ga0207659_10057311 3300025926 Bacteria 2793
377 Ga0207659_10242520 3300025926 Bacteria 1459
378 Ga0207659_10243729 3300025926 Bacteria 1455
379 Ga0207687_10010124 3300025927 Bacteria 6165
380 Ga0207700_10125781 3300025928 Bacteria 2086
381 Ga0207706_10000067 3300025933 Bacteria 108077
382 Ga0207706_10020426 3300025933 Bacteria 5955
383 Ga0207686_10000926 3300025934 Bacteria 17531
384 Ga0207709_10005169 3300025935 Bacteria 7439
385 Ga0207669_10000915 3300025937 Bacteria 12508
386 Ga0207704_10001622 3300025938 Bacteria 10107
387 Ga0207665_10003174 3300025939 Bacteria 11012
388 Ga0207691_10005018 3300025940 Bacteria 12764
389 Ga0207691_10074534 3300025940 Bacteria 3061
390 Ga0207691_10109142 3300025940 Bacteria 2462
391 Ga0207711_10021889 3300025941 Bacteria 5340
392 Ga0207689_10000496 3300025942 Bacteria 37082
393 Ga0207661_10114809 3300025944 Unclassified 2284
394 Ga0207667_10000001 3300025949 Bacteria 1178522
395 Ga0207667_10049122 3300025949 Bacteria 4458
396 Ga0207667_10186519 3300025949 Bacteria 2129
397 Ga0207667_10325125 3300025949 Bacteria 1570
398 Ga0207651_10025143 3300025960 Bacteria 3698
399 Ga0207712_10018700 3300025961 Bacteria 4515
400 Ga0207712_10150951 3300025961 Bacteria 1794
401 Ga0207668_10013775 3300025972 Bacteria 4990
402 Ga0207668_10026314 3300025972 Bacteria 3776
403 Ga0207640_10000041 3300025981 Bacteria 105374
404 Ga0207640_10002337 3300025981 Bacteria 10189
405 Ga0207703_10002168 3300026035 Bacteria 17242
406 Ga0207703_10090185 3300026035 Bacteria 2576
407 Ga0207703_10168729 3300026035 Unclassified 1923
408 Ga0207639_10000081 3300026041 Bacteria 82747
409 Ga0207678_10027682 3300026067 Bacteria 4948
410 Ga0207678_10072497 3300026067 Bacteria 2951
411 Ga0207708_10019351 3300026075 Bacteria 5131
412 Ga0207702_10036451 3300026078 Bacteria 4114
413 Ga0207648_10000029 3300026089 Bacteria 130026
414 Ga0207648_10007822 3300026089 Bacteria 10437
415 Ga0207648_10046939 3300026089 Bacteria 3786
416 Ga0207648_10050641 3300026089 Bacteria 3631
417 Ga0207676_10027570 3300026095 Bacteria 4232
418 Ga0207676_10100109 3300026095 Bacteria 2400
419 Ga0207676_10138678 3300026095 Bacteria 2079
420 Ga0207676_10286766 3300026095 Bacteria 1497
421 Ga0207674_10001824 3300026116 Bacteria 27181
422 Ga0207674_10002595 3300026116 Bacteria 22741
423 Ga0207674_10043177 3300026116 Bacteria 4650
424 Ga0207675_100000705 3300026118 Bacteria 33099
425 Ga0207675_100044971 3300026118 Bacteria 4125
426 Ga0207675_100115978 3300026118 Bacteria 2531
427 Ga0207675_100146479 3300026118 Bacteria 2245
428 Ga0207698_10000054 3300026142 Bacteria 82681
429 Ga0207698_10052453 3300026142 Bacteria 3124
430 Ga0209588_1001809 3300027671 Bacteria 5688
431 Ga0209588_1007883 3300027671 Bacteria 3149
432 Ga0207428_10057593 3300027907 Bacteria 3085
433 Ga0207428_10095113 3300027907 Bacteria 2308
434 Ga0268266_10051937 3300028379 Bacteria 3520
435 Ga0268266_10090203 3300028379 Bacteria 2686
436 Ga0268266_10349850 3300028379 Unclassified 1389
437 Ga0268265_10048044 3300028380 Unclassified 3201
438 Ga0268264_10008943 3300028381 Bacteria 8313
439 Ga0237817_10191 3300030083 Bacteria 16329
440 Ga0237817_10591 3300030083 Bacteria 3859
441 Ga0316176_1009536 3300030732 Bacteria 17516
442 Ga0316183_1210370 3300030742 Bacteria 36771
443 Ga0316181_1088391 3300030744 Bacteria 37007
444 Ga0265330_10018389 3300031235 Unclassified 3210
445 Ga0307408_100039830 3300031548 Bacteria 3324
446 Ga0307408_100058864 3300031548 Bacteria 2795
447 Ga0307508_10000550 3300031616 Bacteria 44447
448 Ga0316576_10024785 3300031727 Bacteria 4193
449 Ga0316576_10035664 3300031727 Bacteria 3552
450 Ga0307405_10087934 3300031731 Unclassified 2049
451 Ga0307405_10199129 3300031731 Bacteria 1453
452 Ga0307413_10005211 3300031824 Bacteria 5768
453 Ga0307413_10014354 3300031824 Bacteria 4019
454 Ga0307413_10026492 3300031824 Bacteria 3196
455 Ga0307413_10112056 3300031824 Bacteria 1828
456 Ga0307413_10112772 3300031824 Bacteria 1823
457 Ga0307410_10014618 3300031852 Bacteria 4625
458 Ga0307410_10021932 3300031852 Unclassified 3938
459 Ga0307410_10022398 3300031852 Bacteria 3904
460 Ga0307410_10022442 3300031852 Bacteria 3902
461 Ga0307410_10044409 3300031852 Bacteria 2952
462 Ga0307410_10067404 3300031852 Bacteria 2469
463 Ga0307406_10001468 3300031901 Bacteria 13023
464 Ga0307406_10013208 3300031901 Bacteria 4727
465 Ga0307406_10026492 3300031901 Bacteria 3483
466 Ga0307406_10076334 3300031901 Bacteria 2213
467 Ga0307407_10006903 3300031903 Bacteria 5099
468 Ga0307407_10010318 3300031903 Bacteria 4398
469 Ga0307407_10016873 3300031903 Bacteria 3647
470 Ga0307407_10077520 3300031903 Bacteria 1999
471 Ga0307412_10006035 3300031911 Bacteria 6821
472 Ga0307412_10077175 3300031911 Bacteria 2291
473 Ga0307412_10147550 3300031911 Bacteria 1731
474 Ga0307409_100000305 3300031995 Bacteria 20027
475 Ga0307409_100005174 3300031995 Bacteria 7458
476 Ga0307409_100008138 3300031995 Bacteria 6335
477 Ga0307409_100019112 3300031995 Bacteria 4629
478 Ga0307409_100044882 3300031995 Bacteria 3332
479 Ga0307409_100052330 3300031995 Bacteria 3130
480 Ga0307409_100102136 3300031995 Bacteria 2381
481 Ga0307409_100421884 3300031995 Bacteria 1280
482 Ga0307416_100002315 3300032002 Bacteria 10883
483 Ga0307416_100008496 3300032002 Bacteria 6634
484 Ga0307416_100034245 3300032002 Bacteria 3863
485 Ga0307416_100068670 3300032002 Bacteria 2929
486 Ga0307416_100078774 3300032002 Bacteria 2775
487 Ga0307414_10018967 3300032004 Bacteria 4252
488 Ga0307414_10029882 3300032004 Bacteria 3553
489 Ga0307414_10035462 3300032004 Bacteria 3320
490 Ga0307414_10039357 3300032004 Bacteria 3184
491 Ga0307414_10044072 3300032004 Bacteria 3043
492 Ga0307411_10003366 3300032005 Bacteria 7407
493 Ga0307411_10007492 3300032005 Bacteria 5568
494 Ga0307411_10010346 3300032005 Bacteria 4967
495 Ga0307411_10029362 3300032005 Bacteria 3356
496 Ga0307411_10078454 3300032005 Bacteria 2264
497 Ga0307411_10085752 3300032005 Bacteria 2182
498 Ga0307415_100002405 3300032126 Bacteria 9334
499 Ga0307415_100074973 3300032126 Unclassified 2393
500 Ga0307415_100095485 3300032126 Bacteria 2164
501 Ga0307510_10053028 3300033180 Bacteria 4268
502 Ga0373926_0011029 3300035083 Bacteria 3037
503 Ga0373945_0010236 3300035116 Bacteria 3085
504 Ga0373946_0030230 3300035171 Bacteria 2162
505 Ga0373931_0028763 3300035691 Bacteria 2849
506 Ga0373931_0037595 3300035691 Bacteria 2528
507 Ga0373935_0007556 3300035692 Bacteria 6508
508 Ga0373927_0002150 3300035695 Bacteria 14497
509 Ga0373927_0002540 3300035695 Bacteria 13317
510 Ga0373947_0022427 3300035725 Bacteria 3662
511 Ga0373937_0078114 3300036401 Bacteria 3059
512 Ga0373925_0000150 3300037068 Bacteria 74481
513 Ga0373925_0000268 3300037068 Bacteria 54347
514 Ga0395899_0040966 3300037312 Bacteria 3463
515 Ga0395900_0088212 3300037418 Bacteria 3189
516 Ga0395898_0053878 3300037466 Bacteria 3927
517 Ga0395905_0000453 3300037471 Bacteria 57443
518 Ga0395905_0103433 3300037471 Bacteria 2674
519 Ga0436364_0237168 3300037853 Bacteria 3264
520 Ga0436364_0258311 3300037853 Bacteria 5020
521 Ga0436364_0900741 3300037853 Bacteria 16529
522 Ga0395901_0178824 3300038443 Bacteria 2225
523 Ga0237819_00335 3300038705 Bacteria 17194
524 Ga0237819_00340 3300038705 Bacteria 17018
525 Ga0436365_0305623 3300039437 Bacteria 2617
526 Ga0436360_0992964 3300039438 Bacteria 2611
527 Ga0436363_0497395 3300039450 Bacteria 3831
528 Ga0436363_1258012 3300039450 Bacteria 1645
529 Ga0451833_0349530 3300041491 Bacteria 5339
530 Ga0451837_0409557 3300041494 Bacteria 5309
531 Ga0451849_0549757 3300041505 Bacteria 6030
532 Ga0451843_0348774 3300041509 Bacteria 4663
533 Ga0451855_1464677 3300041511 Bacteria 5905
534 Ga0450910_006064 3300042147 Bacteria 1660
535 Ga0439435_0052317 3300042436 Bacteria 1172
536 Ga0451577_0024930 3300042876 Bacteria 5432
537 Ga0451577_0029778 3300042876 Bacteria 4933
538 Ga0451577_0125839 3300042876 Bacteria 2296
539 Ga0451577_0277939 3300042876 Bacteria 1517
540 Ga0451577_0427025 3300042876 Bacteria 1203
541 Ga0453683_0017887 3300044673 Bacteria 4556
542 Ga0453683_0023779 3300044673 Bacteria 3903
543 Ga0453683_0196082 3300044673 Bacteria 1282
544 Ga0466963_0083659 3300044694 Bacteria 2164
545 Ga0453684_0055788 3300044712 Bacteria 5133
546 Ga0453684_0129600 3300044712 Bacteria 3028
547 Ga0453684_0200586 3300044712 Unclassified 2326
548 Ga0466970_0000677 3300044765 Bacteria 16657
549 Ga0466957_0002447 3300044842 Bacteria 9967
550 Ga0466959_0015455 3300045049 Bacteria 5562
551 Ga0451576_0003765 3300045051 Bacteria 20447
552 Ga0451576_0006877 3300045051 Bacteria 13776
553 Ga0451576_0031330 3300045051 Bacteria 5671
554 Ga0451576_0060358 3300045051 Bacteria 3956
555 Ga0451576_0086250 3300045051 Bacteria 3265
556 Ga0451576_0113754 3300045051 Bacteria 2817
557 Ga0451576_0124593 3300045051 Bacteria 2684
558 Ga0451576_0228913 3300045051 Unclassified 1941
559 Ga0466958_0042350 3300045836 Bacteria 2742
560 Ga0466967_0000146 3300045976 Bacteria 27617
561 Ga0466967_0018043 3300045976 Bacteria 5628
562 Ga0466967_0034628 3300045976 Bacteria 4289
563 Ga0495603_0027760 3300046455 Bacteria 3414
564 Ga0495591_026314 3300046458 Bacteria 1810
565 Ga0495580_0014204 3300046472 Bacteria 6047
566 Ga0495662_0051620 3300046476 Bacteria 1985
567 Ga0495585_0105296 3300046492 Bacteria 1505
568 Ga0495594_0003876 3300046499 Bacteria 7692
569 Ga0495594_0026725 3300046499 Bacteria 3107
570 Ga0495618_0003625 3300046514 Bacteria 9566
571 Ga0495630_0009445 3300046517 Bacteria 7013
572 Ga0495630_0096123 3300046517 Bacteria 2240
573 Ga0495643_0028028 3300046522 Bacteria 3161
574 Ga0495666_0002314 3300046526 Bacteria 9507
575 Ga0495652_0228888 3300046529 Bacteria 1392
576 Ga0495665_0066580 3300046531 Bacteria 1901
577 Ga0495640_0040386 3300046533 Bacteria 3267
578 Ga0495586_0018993 3300046535 Bacteria 3658
579 Ga0495598_0034937 3300046537 Bacteria 1436
580 Ga0495667_0005248 3300046559 Bacteria 8758
581 Ga0495634_0001475 3300046642 Bacteria 20831
582 Ga0495659_0033531 3300046664 Bacteria 1803
583 Ga0495659_0080591 3300046664 Unclassified 1235
584 Ga0495588_0123207 3300046674 Bacteria 1367
585 Ga0495647_0074756 3300046681 Bacteria 1363
586 Ga0495658_0001709 3300046683 Bacteria 11417
587 Ga0495658_0013808 3300046683 Bacteria 4116
588 Ga0495613_0027031 3300046689 Bacteria 4271
589 Ga0495649_0006214 3300046694 Bacteria 7453
590 Ga0495649_0014081 3300046694 Bacteria 4594
591 Ga0495581_0058289 3300047315 Bacteria 2230
592 Ga0495674_0011641 3300047319 Bacteria 8295
593 Ga0495680_0025218 3300047322 Bacteria 4924
594 Ga0495687_020690 3300047443 Bacteria 3203
595 Ga0495677_0013846 3300047445 Bacteria 2937
596 Ga0496102_0020693 3300048905 Bacteria 5814
597 Ga0496102_0021351 3300048905 Bacteria 5726
598 Ga0496102_0054342 3300048905 Bacteria 3651
599 Ga0496102_0095754 3300048905 Bacteria 2752
600 Ga0496103_0007312 3300048906 Bacteria 6581
601 Ga0496103_0035619 3300048906 Bacteria 3048
602 Ga0496103_0064948 3300048906 Bacteria 2276
603 Ga0496103_0116570 3300048906 Bacteria 1699
604 Ga0496104_0003802 3300048907 Bacteria 13057
605 Ga0496104_0004616 3300048907 Bacteria 12004
606 Ga0496104_0014933 3300048907 Bacteria 7021
607 Ga0496104_0096589 3300048907 Bacteria 2827
608 Ga0496105_0192080 3300048908 Bacteria 1669
609 Ga0496106_0021979 3300048909 Bacteria 4739
610 Ga0496106_0023264 3300048909 Bacteria 4603
611 Ga0496106_0047740 3300048909 Bacteria 3223
612 Ga0496106_0095036 3300048909 Bacteria 2305
613 Ga0496106_0241820 3300048909 Bacteria 1442
614 Ga0496107_0035246 3300048910 Bacteria 3587
615 Ga0496107_0059878 3300048910 Bacteria 2756
616 Ga0496108_0004865 3300048911 Bacteria 10846
617 Ga0496108_0006258 3300048911 Bacteria 9643
618 Ga0496108_0009641 3300048911 Bacteria 7827
619 Ga0496108_0022545 3300048911 Bacteria 5177
620 Ga0496108_0211861 3300048911 Bacteria 1682
621 Ga0496108_0217530 3300048911 Bacteria 1659
622 Ga0496109_0002167 3300048912 Bacteria 16318
623 Ga0496109_0002280 3300048912 Bacteria 15950
624 Ga0496109_0003937 3300048912 Bacteria 12408
625 Ga0496109_0017339 3300048912 Bacteria 6310
626 Ga0496110_0003069 3300048913 Bacteria 12660
627 Ga0496110_0012273 3300048913 Bacteria 7041
628 Ga0496110_0023097 3300048913 Bacteria 5289
629 Ga0496110_0059251 3300048913 Bacteria 3374
630 Ga0496110_0191076 3300048913 Bacteria 1859
631 Ga0496111_0009724 3300048914 Bacteria 6428
632 Ga0496111_0012689 3300048914 Bacteria 5711
633 Ga0496111_0049631 3300048914 Bacteria 3026
634 Ga0496111_0226806 3300048914 Bacteria 1388
635 Ga0496112_0002069 3300048915 Bacteria 15908
636 Ga0496112_0025309 3300048915 Bacteria 5698
637 Ga0496112_0031210 3300048915 Bacteria 5165
638 Ga0496113_0003196 3300048916 Bacteria 9760
639 Ga0496113_0004350 3300048916 Bacteria 8681
640 Ga0496113_0004994 3300048916 Bacteria 8223
641 Ga0496113_0006677 3300048916 Bacteria 7341
642 Ga0496114_0010649 3300048917 Bacteria 7319
643 Ga0496114_0439278 3300048917 Bacteria 1156
644 Ga0496117_0000079 3300048920 Bacteria 226960
645 Ga0496117_0000097 3300048920 Bacteria 196340
646 Ga0496117_0000674 3300048920 Bacteria 54521
647 Ga0496117_0091513 3300048920 Bacteria 1956
648 Ga0496118_0001442 3300048921 Bacteria 35788
649 Ga0496118_0042439 3300048921 Bacteria 3588
650 Ga0496119_0000014 3300048922 Bacteria 313816
651 Ga0496119_0011561 3300048922 Bacteria 7285
652 Ga0496119_0016560 3300048922 Bacteria 5601
653 Ga0496119_0144766 3300048922 Bacteria 1279
654 Ga0496120_0000007 3300048923 Bacteria 436796
655 Ga0496120_0000023 3300048923 Bacteria 240991
656 Ga0496120_0002654 3300048923 Bacteria 17651
657 Ga0496120_0003381 3300048923 Bacteria 14608
658 Ga0496120_0003806 3300048923 Bacteria 13292
659 Ga0496121_0000991 3300048924 Bacteria 50787
660 Ga0496121_0043568 3300048924 Bacteria 3885
661 Ga0496122_0000014 3300048925 Bacteria 491410
662 Ga0496122_0000519 3300048925 Bacteria 79822
663 Ga0496122_0010559 3300048925 Bacteria 9490
664 Ga0496122_0043782 3300048925 Bacteria 3503
665 Ga0496123_0000070 3300048926 Bacteria 200108
666 Ga0496123_0015348 3300048926 Bacteria 6289
667 Ga0496123_0128641 3300048926 Bacteria 1408
668 Ga0496124_0035918 3300048927 Bacteria 4330
669 Ga0496125_0000067 3300048928 Bacteria 248871
670 Ga0496125_0002559 3300048928 Bacteria 23425
671 Ga0496125_0004812 3300048928 Bacteria 15349
672 Ga0496126_0000019 3300048929 Bacteria 564723
673 Ga0496126_0000561 3300048929 Bacteria 71365
674 Ga0496126_0077554 3300048929 Bacteria 2945
675 Ga0496126_0131680 3300048929 Bacteria 2160
676 Ga0501031_0056119 3300049568 Bacteria 2566
677 Ga0501031_0110505 3300049568 Bacteria 1795
678 Ga0501032_0007269 3300049569 Bacteria 8101
679 Ga0501033_0118986 3300049570 Bacteria 1918
680 Ga0501034_0000793 3300049571 Bacteria 47013
681 Ga0501034_0020212 3300049571 Bacteria 6799
682 Ga0501036_0026577 3300049572 Bacteria 4888
683 Ga0501036_0056221 3300049572 Bacteria 3334
684 Ga0501038_0016904 3300049574 Bacteria 6603
685 Ga0501038_0187549 3300049574 Bacteria 1666
686 Ga0501040_0044840 3300049576 Bacteria 3015
687 Ga0501040_0082112 3300049576 Bacteria 2234
688 Ga0501041_0006622 3300049577 Bacteria 6785
689 Ga0501043_0003405 3300049579 Bacteria 13080
690 Ga0501046_0024536 3300049580 Bacteria 4944
691 Ga0501047_0000165 3300049581 Bacteria 81037
692 Ga0501047_0007477 3300049581 Bacteria 10282
693 Ga0501047_0046909 3300049581 Bacteria 4174
694 Ga0501048_0045789 3300049582 Bacteria 3123
695 Ga0501048_0180019 3300049582 Unclassified 1498
696 Ga0501067_0001485 3300049583 Bacteria 12754
697 Ga0501067_0029439 3300049583 Bacteria 3043
698 Ga0501067_0029606 3300049583 Bacteria 3034
699 Ga0501068_0000902 3300049584 Bacteria 15526
700 Ga0501068_0003937 3300049584 Bacteria 8078
701 Ga0501069_0002046 3300049585 Bacteria 10122
702 Ga0501069_0007688 3300049585 Bacteria 5655
703 Ga0501070_0000708 3300049586 Bacteria 30530
704 Ga0501070_0005056 3300049586 Bacteria 11248
705 Ga0501070_0022328 3300049586 Bacteria 5301
706 Ga0501070_0146809 3300049586 Bacteria 1947
707 Ga0501071_0000053 3300049587 Bacteria 38500
708 Ga0501071_0007112 3300049587 Bacteria 7314
709 Ga0501071_0010368 3300049587 Bacteria 6242
710 Ga0501071_0068870 3300049587 Unclassified 2576
711 Ga0501072_0000477 3300049588 Bacteria 28757
712 Ga0501072_0025798 3300049588 Bacteria 4579
713 Ga0501072_0051285 3300049588 Bacteria 3249
714 Ga0501072_0072273 3300049588 Bacteria 2726
715 Ga0501073_0133931 3300049589 Bacteria 1717
716 Ga0501073_0204718 3300049589 Bacteria 1364
717 Ga0501074_0000287 3300049590 Bacteria 29149
718 Ga0501074_0029665 3300049590 Bacteria 3963
719 Ga0501074_0040619 3300049590 Bacteria 3369
720 Ga0501075_0026030 3300049591 Bacteria 4302
721 Ga0501075_0089112 3300049591 Bacteria 2339
722 Ga0501076_0036704 3300049592 Bacteria 3841
723 Ga0501076_0043197 3300049592 Bacteria 3550
724 Ga0501076_0158570 3300049592 Bacteria 1843
725 Ga0501077_0001658 3300049593 Bacteria 13391
726 Ga0501077_0010477 3300049593 Bacteria 5769
727 Ga0501223_000962 3300049663 Bacteria 6783
728 Ga0501239_005811 3300049672 Bacteria 1253
729 Ga0501247_002251 3300049677 Unclassified 1990
730 Ga0501079_0015844 3300049741 Bacteria 5760
731 Ga0501079_0025436 3300049741 Bacteria 4540
732 Ga0501079_0037199 3300049741 Bacteria 3750
733 Ga0501079_0059559 3300049741 Bacteria 2945
734 Ga0501080_0007037 3300049742 Bacteria 10157
735 Ga0501080_0018485 3300049742 Bacteria 6449
736 Ga0501080_0297271 3300049742 Unclassified 1465
737 Ga0501081_0012929 3300049743 Bacteria 5492
738 Ga0501081_0063193 3300049743 Bacteria 2569
739 Ga0501083_0000635 3300049744 Bacteria 22726
740 Ga0501083_0003729 3300049744 Bacteria 10699
741 Ga0501083_0005487 3300049744 Bacteria 8983
742 Ga0501083_0042228 3300049744 Bacteria 3092
743 Ga0501083_0198353 3300049744 Bacteria 1309
744 Ga0501263_002151 3300049760 Bacteria 1974
745 Ga0501266_014045 3300049763 Bacteria 1046
746 Ga0501268_001463 3300049765 Bacteria 2950
747 Ga0501272_001851 3300049769 Unclassified 2061
748 Ga0501044_0009183 3300049823 Bacteria 10799
749 Ga0501044_0369473 3300049823 Bacteria 1351
750 Ga0501045_0033215 3300049824 Bacteria 3741
751 nmdc:mga05p37_167942_c1 3300050507 Bacteria 2677
752 nmdc:mga05p37_28873_c1 3300050507 Bacteria 6765
753 nmdc:mga05p37_3225_c1 3300050507 Bacteria 19005
754 nmdc:mga05p37_32381_c1 3300050507 Bacteria 6393
755 nmdc:mga05p37_58464_c2 3300050507 Bacteria 3801
756 nmdc:mga09592_55427_c1 3300050508 Unclassified 3350
757 nmdc:mga06r32_19003_c1 3300050510 Bacteria 6301
758 nmdc:mga06r32_257796_c1 3300050510 Unclassified 1731
759 nmdc:mga06r32_53757_c1 3300050510 Bacteria 3859
760 nmdc:mga08y16_102425_c1 3300050511 Bacteria 2981
761 nmdc:mga08y16_112719_c1 3300050511 Bacteria 2831
762 nmdc:mga08y16_61539_c1 3300050511 Bacteria 3920
763 nmdc:mga08y16_87545_c1 3300050511 Bacteria 3245
764 nmdc:mga0n895_123962_c1 3300050512 Bacteria 2606
765 nmdc:mga0n895_16061_c1 3300050512 Bacteria 6859
766 nmdc:mga0n895_17816_c1 3300050512 Bacteria 6558
767 nmdc:mga0n895_3385_c1 3300050512 Bacteria 12831
768 nmdc:mga0n895_456381_c1 3300050512 Bacteria 1290
769 nmdc:mga0n895_5093_c1 3300050512 Bacteria 10915
770 nmdc:mga0n895_62622_c1 3300050512 Bacteria 3677
771 nmdc:mga0rr50_229819_c1 3300050513 Bacteria 1534
772 nmdc:mga0rr50_34029_c1 3300050513 Bacteria 3646
773 nmdc:mga0rr50_6617_c1 3300050513 Bacteria 7082
774 nmdc:mga08x19_1003_c1 3300050514 Bacteria 17632
775 nmdc:mga08x19_11657_c2 3300050514 Bacteria 3313
776 nmdc:mga08x19_182152_c1 3300050514 Bacteria 1434
777 nmdc:mga08x19_37585_c1 3300050514 Bacteria 3073
778 nmdc:mga08x19_9500_c1 3300050514 Bacteria 5824
779 nmdc:mga0a205_17119_c1 3300050515 Bacteria 6788
780 nmdc:mga0a205_44190_c1 3300050515 Bacteria 4294
781 nmdc:mga0a205_69_c1 3300050515 Bacteria 56310
782 Ga0500643_000361 3300053087 Bacteria 36161
783 Ga0500651_0001925 3300053093 Bacteria 10711
784 Ga0500559_0017308 3300053136 Bacteria 3043
785 Ga0500559_0052949 3300053136 Bacteria 1795
786 Ga0501084_0000720 3300054114 Bacteria 25236
787 Ga0501084_0008307 3300054114 Bacteria 8567
788 Ga0501084_0020155 3300054114 Bacteria 5559
789 Ga0590071_002672 3300059421 Bacteria 4478
790 Ga0590075_004265 3300059424 Bacteria 3383
791 Ga0590077_005469 3300059426 Bacteria 2605
792 Ga0590077_005555 3300059426 Bacteria 2581
793 Ga0501082_0001411 3300060353 Bacteria 21118
794 Ga0501082_0048511 3300060353 Bacteria 3659
795 Ga0501082_0055378 3300060353 Bacteria 3417
796 Ga0501082_0093748 3300060353 Bacteria 2594
797 Ga0501082_0146981 3300060353 Bacteria 2046
798 Ga0501082_0303872 3300060353 Bacteria 1389
799 Ga0530510_0031082 3300061734 Bacteria 3838
800 2524461619 2524023209 Bacteria 6679728
801 2553393246 2551306519 Bacteria 5465154
802 2585328886 2582581315 Bacteria 7318924
803 2595089321 2593339131 Bacteria 5116855
804 2616309792 2615840626 Bacteria 7921970
805 2643737953 2643221543 Bacteria 6628015
806 2644000621 2643221598 Bacteria 4578346
807 2644048710 2643221607 Bacteria 6314006
808 2644201962 2643221636 Bacteria 6583769
809 2644352648 2643221663 Bacteria 3425771
810 2644481512 2643221686 Bacteria 6310811
811 2644550400 2643221699 Bacteria 5731501
812 2644707997 2643221729 Bacteria 6621700
813 2644714726 2643221730 Bacteria 6523787
814 2685152343 2684622632 Bacteria 5380049
815 2698320815 2695420987 Bacteria 6152737
816 2705996280 2703719227 Bacteria 5631989
817 2721507502 2718218445 Bacteria 5113413
818 2739157861 2738541358 Bacteria 5932299
819 2739209980 2738543006 Bacteria 5904091
820 2739268434 2738543017 Bacteria 4271950
821 2757565091 2757320391 Bacteria 4746095
822 2777763952 2775507177 Bacteria 4384303
823 2777838408 2775507192 Bacteria 4622234
824 2819583114 2818991443 Bacteria 6598732
825 2831905229 2831905167 Bacteria 3319172
826 2842303199 2842298080 Bacteria 6123127
827 2842361489 2842357229 Bacteria 6485165
828 2842513648 2842509118 Bacteria 6850950
829 2842907625 2842903701 Bacteria 6986368
830 2857588460 2857586860 Bacteria 4354574
831 2881648396 2881644220 Bacteria 5302661
832 2884794110 2884791551 Bacteria 8511252
833 2889046912 2889042446 Bacteria 7618936
834 2904493816 2904490793 Bacteria 7046938
835 2911141048 2911138879 Bacteria 5811561
836 2916973980 2916971899 Bacteria 4250608
837 2919162895 2919160200 Bacteria 6929020
838 2929238047 2929233124 Bacteria 5948380
839 2931390359 2931384279 Bacteria 7299545
840 2936343470 2936340661 Bacteria 5139038
841 2938922236 2938917290 Bacteria 5914775
842 2939617455 2939615513 Bacteria 2384962
843 2945997417 2945991243 Bacteria 7008369
844 2946053627 2946053406 Bacteria 6978655
845 2947431131 2947426588 Bacteria 5357194
846 2956901638 2956897341 Bacteria 5447711
847 2965765497 2965761152 Bacteria 5806513
848 2977242890 2977240413 Bacteria 3191065
849 2979088035 2979083700 Bacteria 5894929
850 3001272026 3001267043 Bacteria 4823521
851 3006977608 3006973921 Bacteria 4423788
852 3006988406 3006984091 Bacteria 4207523
853 8007376074 8007375930 Bacteria 4080554
854 8007378135 8007375930 Bacteria 4080554
855 8022796969 8022792930 Bacteria 5693794
856 8023443954 8023438354 Bacteria 5779374
857 8023445241 8023444577 Bacteria 5661597
858 8057586799 8057582654 Bacteria 5218944
859 Ga0500618_001022
860 JGI24740J21852_10000067
861 JGI25155J39150_1000021
862 JGI25156J39149_1000022
863 JGI25162J39368_1000768
864 JGI25162J39368_1007079
865 JGI25154J39366_1000048
866 JGI25157J39369_1000025
867 JGI25159J45721_1001956
868 JGI25151J46595_10000200
869 JGI25151J46595_10001902
870 JGI25151J46595_10008914
871 JGI25151J46595_10009147
872 JGI25165J46597_1000866
873 rootH1_10263746
874 Ga0055532_1000126
875 Ga0055536_1001449
876 Ga0055531_10013001
877 Ga0065715_10108125
878 Ga0070658_10000088
879 Ga0070658_10000930
880 Ga0070658_10040249
881 Ga0070658_10056117
882 Ga0070658_10084410
883 Ga0070658_10103327
884 Ga0070658_10219345
885 Ga0070676_10023903
886 Ga0070683_100082114
887 Ga0070690_100054220
888 Ga0070690_100203021
889 Ga0068869_100048558
890 Ga0070666_10029720
891 Ga0070680_100081930
892 Ga0070680_100239569
893 Ga0070682_100071514
894 Ga0068868_100147466
895 Ga0070660_100054524
896 Ga0070692_10009417
897 Ga0070668_100005416
898 Ga0070668_100108007
899 Ga0070669_100110512
900 Ga0070675_100126407
901 Ga0070675_100244615
902 Ga0070675_100301146
903 Ga0070671_100010754
904 Ga0070674_100000051
905 Ga0070674_100051511
906 Ga0070673_100145146
907 Ga0070673_100146664
908 Ga0070659_100019292
909 Ga0070667_100242062
910 Ga0070703_10004280
911 Ga0070709_10000961
912 Ga0070709_10002694
913 Ga0070709_10119210
914 Ga0070714_100013846
915 Ga0070711_100000042
916 Ga0070711_100004639
917 Ga0070705_100002218
918 Ga0070705_100054283
919 Ga0070705_100062832
920 Ga0070705_100064377
921 Ga0070694_100012511
922 Ga0070694_100058655
923 Ga0070694_100059773
924 Ga0070694_100073102
925 Ga0070694_100079917
926 Ga0070694_100201254
927 Ga0070708_100002721
928 Ga0070708_100007399
929 Ga0070708_100012615
930 Ga0070708_100101052
931 Ga0070663_100166477
932 Ga0070678_100010192
933 Ga0070678_100101513
934 Ga0070662_100012673
935 Ga0070681_10040737
936 Ga0070681_10084492
937 Ga0068867_100000105
938 Ga0068867_100038567
939 Ga0068867_100064912
940 Ga0070706_100004195
941 Ga0070706_100018895
942 Ga0070706_100031700
943 Ga0070706_100044665
944 Ga0070706_100058297
945 Ga0070706_100077352
946 Ga0070707_100000424
947 Ga0070707_100012132
948 Ga0070707_100050316
949 Ga0070707_100056206
950 Ga0070707_100169318
951 Ga0070707_100409915
952 Ga0070698_100001017
953 Ga0070698_100007200
954 Ga0070698_100036570
955 Ga0070698_100041965
956 Ga0070698_100089610
957 Ga0070698_100092091
958 Ga0070698_100096235
959 Ga0070699_100000214
960 Ga0070699_100000323
961 Ga0070699_100001300
962 Ga0070699_100005410
963 Ga0070699_100005704
964 Ga0070699_100006606
965 Ga0070699_100054949
966 Ga0070699_100081319
967 Ga0070699_100099817
968 Ga0070699_100132089
969 Ga0070679_100034282
970 Ga0070679_100043973
971 Ga0070679_100132311
972 Ga0070684_100054255
973 Ga0070684_100153434
974 Ga0070684_100219972
975 Ga0070697_100000978
976 Ga0070697_100005606
977 Ga0070697_100008921
978 Ga0070697_100018428
979 Ga0070697_100057993
980 Ga0070697_100095318
981 Ga0070697_100102639
982 Ga0070697_100108894
983 Ga0068853_100000379
984 Ga0068853_100013999
985 Ga0068853_100142862
986 Ga0070672_100163950
987 Ga0070686_100215635
988 Ga0070695_100004478
989 Ga0070695_100004986
990 Ga0070695_100012708
991 Ga0070695_100016650
992 Ga0070695_100017339
993 Ga0070695_100023116
994 Ga0070695_100045700
995 Ga0070696_100001570
996 Ga0070696_100002058
997 Ga0070696_100003170
998 Ga0070696_100004043
999 Ga0070696_100013474
1000 Ga0070696_100198850
1001 Ga0070704_100002951
1002 Ga0070704_100004126
1003 Ga0070704_100006978
1004 Ga0070704_100088720
1005 Ga0070704_100132699
1006 Ga0070704_100258588
1007 Ga0068855_100000173
1008 Ga0068855_100046214
1009 Ga0068855_100349972
1010 Ga0070664_100009642
1011 Ga0070664_100069393
1012 Ga0070664_100088458
1013 Ga0068857_100000037
1014 Ga0068857_100014839
1015 Ga0068854_100000155
1016 Ga0068854_100011752
1017 Ga0068856_100061326
1018 Ga0068856_100189030
1019 Ga0068852_100000060
1020 Ga0068852_100007002
1021 Ga0068852_100016276
1022 Ga0068852_100101952
1023 Ga0068852_100290956
1024 Ga0068859_100014945
1025 Ga0068859_100047934
1026 Ga0068859_100316633
1027 Ga0068864_100038559
1028 Ga0068864_100120885
1029 Ga0068864_100172242
1030 Ga0068864_100172316
1031 Ga0068866_10000089
1032 Ga0068861_100022544
1033 Ga0068861_100184845
1034 Ga0068851_10051817
1035 Ga0068851_10053311
1036 Ga0068870_10022667
1037 Ga0068863_100024078
1038 Ga0068863_100346622
1039 Ga0068858_100002910
1040 Ga0068858_100182716
1041 Ga0068862_100025988
1042 Ga0081455_10021249
1043 Ga0068871_100154425
1044 Ga0075428_100032572
1045 Ga0075428_100140034
1046 Ga0075428_100151453
1047 Ga0075428_100271391
1048 Ga0075428_100285135
1049 Ga0075430_100011922
1050 Ga0075431_100013317
1051 Ga0075431_100067740
1052 Ga0075431_100141528
1053 Ga0075431_100170418
1054 Ga0075431_100221008
1055 Ga0075433_10000417
1056 Ga0075433_10032796
1057 Ga0075433_10039292
1058 Ga0075433_10063335
1059 Ga0075433_10101883
1060 Ga0075433_10156122
1061 Ga0075434_100021972
1062 Ga0075434_100024845
1063 Ga0075434_100025785
1064 Ga0075434_100030166
1065 Ga0075434_100042605
1066 Ga0075434_100350208
1067 Ga0075429_100000245
1068 Ga0075429_100026890
1069 Ga0068865_100024985
1070 Ga0068865_100041162
1071 Ga0075436_100006278
1072 Ga0075436_100012872
1073 Ga0075436_100028747
1074 Ga0075436_100150499
1075 Ga0097620_100014945
1076 Ga0097620_100047935
1077 Ga0097620_100316601
1078 Ga0075435_100030291
1079 Ga0075435_100050811
1080 Ga0099794_10000209
1081 Ga0099794_10023753
1082 Ga0105251_10065619
1083 Ga0105244_10063488
1084 Ga0105244_10090664
1085 Ga0105244_10131485
1086 Ga0105244_10137388
1087 Ga0105250_10015525
1088 Ga0105240_10001752
1089 Ga0105240_10017002
1090 Ga0105240_10206402
1091 Ga0105240_10263024
1092 Ga0111539_10065774
1093 Ga0111539_10128706
1094 Ga0111539_10151820
1095 Ga0111539_10196392
1096 Ga0105245_10008907
1097 Ga0105245_10020091
1098 Ga0105245_10195763
1099 Ga0114129_10000842
1100 Ga0114129_10058540
1101 Ga0114129_10060174
1102 Ga0114129_10060316
1103 Ga0114129_10103781
1104 Ga0114129_10116171
1105 Ga0114129_10118161
1106 Ga0114129_10162690
1107 Ga0105241_10002544
1108 Ga0105241_10003242
1109 Ga0105248_10001920
1110 Ga0105248_10357544
1111 Ga0105237_10000038
1112 Ga0105237_10000378
1113 Ga0105237_10007764
1114 Ga0105238_10003191
1115 Ga0105249_10034132
1116 Ga0105249_10169024
1117 Ga0105239_10000108
1118 Ga0105239_10000232
1119 Ga0105239_10033598
1120 Ga0105239_10035885
1121 Ga0105239_10106815
1122 Ga0105239_10265918
1123 Ga0105246_10025986
1124 Ga0157373_10013102
1125 Ga0157371_10000011
1126 Ga0157371_10012401
1127 Ga0157371_10026023
1128 Ga0157371_10104704
1129 Ga0157370_10001010
1130 Ga0157369_10019197
1131 Ga0157369_10062381
1132 Ga0171463_1009
1133 Ga0157378_10001196
1134 Ga0163162_10021040
1135 Ga0163162_10033518
1136 Ga0163162_10238539
1137 Ga0163162_10583199
1138 Ga0157372_10003085
1139 Ga0157372_10043260
1140 Ga0157372_10094480
1141 Ga0157372_10258575
1142 Ga0157375_10011591
1143 Ga0157375_10035997
1144 Ga0157375_10180905
1145 Ga0157375_10335493
1146 Ga0157375_10623542
1147 Ga0163163_10064971
1148 Ga0157377_10014060
1149 Ga0157379_10022316
1150 Ga0157379_10076534
1151 Ga0157376_10345516
1152 Ga0183363_1132
1153 Ga0163161_10048311
1154 Ga0213874_10022602
1155 Ga0213875_10003417
1156 Ga0209435_100033
1157 Ga0209147_100182
1158 Ga0209147_102454
1159 Ga0209437_100326
1160 Ga0209437_100653
1161 Ga0209646_1000116
1162 Ga0209026_1000103
1163 Ga0209759_1000105
1164 Ga0209233_1000505
1165 Ga0209130_1001456
1166 Ga0209130_1002177
1167 Ga0209130_1002890
1168 Ga0209130_1015391
1169 Ga0209130_1018617
1170 Ga0209676_1000082
1171 Ga0209676_1000204
1172 Ga0209676_1003265
1173 Ga0209025_1000127
1174 Ga0209025_1000302
1175 Ga0209025_1001914
1176 Ga0209025_1002745
1177 Ga0209025_1002785
1178 Ga0209025_1003039
1179 Ga0209025_1004968
1180 Ga0209025_1011227
1181 Ga0209025_1011903
1182 Ga0209025_1012611
1183 Ga0209025_1016191
1184 Ga0209025_1025518
1185 Ga0209257_1000218
1186 Ga0209257_1030103
1187 Ga0207697_10035643
1188 Ga0207696_1004839
1189 Ga0207655_1005330
1190 Ga0207713_1028977
1191 Ga0207653_10000273
1192 Ga0207682_10007409
1193 Ga0207642_10000046
1194 Ga0207642_10084847
1195 Ga0207647_10021374
1196 Ga0207699_10002055
1197 Ga0207699_10014531
1198 Ga0207645_10000126
1199 Ga0207645_10000968
1200 Ga0207643_10007769
1201 Ga0207705_10000138
1202 Ga0207705_10019433
1203 Ga0207705_10051675
1204 Ga0207684_10009386
1205 Ga0207684_10021137
1206 Ga0207684_10035113
1207 Ga0207684_10045424
1208 Ga0207684_10079113
1209 Ga0207707_10015158
1210 Ga0207707_10170807
1211 Ga0207695_10008932
1212 Ga0207671_10000045
1213 Ga0207671_10000222
1214 Ga0207663_10000029
1215 Ga0207663_10021704
1216 Ga0207660_10019170
1217 Ga0207662_10002952
1218 Ga0207657_10027762
1219 Ga0207657_10030969
1220 Ga0207649_10033575
1221 Ga0207652_10015401
1222 Ga0207652_10038090
1223 Ga0207652_10211736
1224 Ga0207646_10001346
1225 Ga0207646_10020973
1226 Ga0207646_10029267
1227 Ga0207646_10031254
1228 Ga0207646_10049773
1229 Ga0207646_10057511
1230 Ga0207646_10063943
1231 Ga0207646_10107380
1232 Ga0207646_10189008
1233 Ga0207694_10002617
1234 Ga0207659_10057311
1235 Ga0207659_10242520
1236 Ga0207659_10243729
1237 Ga0207687_10010124
1238 Ga0207700_10125781
1239 Ga0207706_10000067
1240 Ga0207706_10020426
1241 Ga0207686_10000926
1242 Ga0207709_10005169
1243 Ga0207669_10000915
1244 Ga0207704_10001622
1245 Ga0207665_10003174
1246 Ga0207691_10005018
1247 Ga0207691_10074534
1248 Ga0207691_10109142
1249 Ga0207711_10021889
1250 Ga0207689_10000496
1251 Ga0207661_10114809
1252 Ga0207667_10000001
1253 Ga0207667_10049122
1254 Ga0207667_10186519
1255 Ga0207667_10325125
1256 Ga0207651_10025143
1257 Ga0207712_10018700
1258 Ga0207712_10150951
1259 Ga0207668_10013775
1260 Ga0207668_10026314
1261 Ga0207640_10000041
1262 Ga0207640_10002337
1263 Ga0207703_10002168
1264 Ga0207703_10090185
1265 Ga0207703_10168729
1266 Ga0207639_10000081
1267 Ga0207678_10027682
1268 Ga0207678_10072497
1269 Ga0207708_10019351
1270 Ga0207702_10036451
1271 Ga0207648_10000029
1272 Ga0207648_10007822
1273 Ga0207648_10046939
1274 Ga0207648_10050641
1275 Ga0207676_10027570
1276 Ga0207676_10100109
1277 Ga0207676_10138678
1278 Ga0207676_10286766
1279 Ga0207674_10001824
1280 Ga0207674_10002595
1281 Ga0207674_10043177
1282 Ga0207675_100000705
1283 Ga0207675_100044971
1284 Ga0207675_100115978
1285 Ga0207675_100146479
1286 Ga0207698_10000054
1287 Ga0207698_10052453
1288 Ga0209588_1001809
1289 Ga0209588_1007883
1290 Ga0207428_10057593
1291 Ga0207428_10095113
1292 Ga0268266_10051937
1293 Ga0268266_10090203
1294 Ga0268266_10349850
1295 Ga0268265_10048044
1296 Ga0268264_10008943
1297 Ga0237817_10191
1298 Ga0237817_10591
1299 Ga0316176_1009536
1300 Ga0316183_1210370
1301 Ga0316181_1088391
1302 Ga0265330_10018389
1303 Ga0307408_100039830
1304 Ga0307408_100058864
1305 Ga0307508_10000550
1306 Ga0316576_10024785
1307 Ga0316576_10035664
1308 Ga0307405_10087934
1309 Ga0307405_10199129
1310 Ga0307413_10005211
1311 Ga0307413_10014354
1312 Ga0307413_10026492
1313 Ga0307413_10112056
1314 Ga0307413_10112772
1315 Ga0307410_10014618
1316 Ga0307410_10021932
1317 Ga0307410_10022398
1318 Ga0307410_10022442
1319 Ga0307410_10044409
1320 Ga0307410_10067404
1321 Ga0307406_10001468
1322 Ga0307406_10013208
1323 Ga0307406_10026492
1324 Ga0307406_10076334
1325 Ga0307407_10006903
1326 Ga0307407_10010318
1327 Ga0307407_10016873
1328 Ga0307407_10077520
1329 Ga0307412_10006035
1330 Ga0307412_10077175
1331 Ga0307412_10147550
1332 Ga0307409_100000305
1333 Ga0307409_100005174
1334 Ga0307409_100008138
1335 Ga0307409_100019112
1336 Ga0307409_100044882
1337 Ga0307409_100052330
1338 Ga0307409_100102136
1339 Ga0307409_100421884
1340 Ga0307416_100002315
1341 Ga0307416_100008496
1342 Ga0307416_100034245
1343 Ga0307416_100068670
1344 Ga0307416_100078774
1345 Ga0307414_10018967
1346 Ga0307414_10029882
1347 Ga0307414_10035462
1348 Ga0307414_10039357
1349 Ga0307414_10044072
1350 Ga0307411_10003366
1351 Ga0307411_10007492
1352 Ga0307411_10010346
1353 Ga0307411_10029362
1354 Ga0307411_10078454
1355 Ga0307411_10085752
1356 Ga0307415_100002405
1357 Ga0307415_100074973
1358 Ga0307415_100095485
1359 Ga0307510_10053028
1360 Ga0373926_0011029
1361 Ga0373945_0010236
1362 Ga0373946_0030230
1363 Ga0373931_0028763
1364 Ga0373931_0037595
1365 Ga0373935_0007556
1366 Ga0373927_0002150
1367 Ga0373927_0002540
1368 Ga0373947_0022427
1369 Ga0373937_0078114
1370 Ga0373925_0000150
1371 Ga0373925_0000268
1372 Ga0395899_0040966
1373 Ga0395900_0088212
1374 Ga0395898_0053878
1375 Ga0395905_0000453
1376 Ga0395905_0103433
1377 Ga0436364_0237168
1378 Ga0436364_0258311
1379 Ga0436364_0900741
1380 Ga0395901_0178824
1381 Ga0237819_00335
1382 Ga0237819_00340
1383 Ga0436365_0305623
1384 Ga0436360_0992964
1385 Ga0436363_0497395
1386 Ga0436363_1258012
1387 Ga0451833_0349530
1388 Ga0451837_0409557
1389 Ga0451849_0549757
1390 Ga0451843_0348774
1391 Ga0451855_1464677
1392 Ga0450910_006064
1393 Ga0439435_0052317
1394 Ga0451577_0024930
1395 Ga0451577_0029778
1396 Ga0451577_0125839
1397 Ga0451577_0277939
1398 Ga0451577_0427025
1399 Ga0453683_0017887
1400 Ga0453683_0023779
1401 Ga0453683_0196082
1402 Ga0466963_0083659
1403 Ga0453684_0055788
1404 Ga0453684_0129600
1405 Ga0453684_0200586
1406 Ga0466970_0000677
1407 Ga0466957_0002447
1408 Ga0466959_0015455
1409 Ga0451576_0003765
1410 Ga0451576_0006877
1411 Ga0451576_0031330
1412 Ga0451576_0060358
1413 Ga0451576_0086250
1414 Ga0451576_0113754
1415 Ga0451576_0124593
1416 Ga0451576_0228913
1417 Ga0466958_0042350
1418 Ga0466967_0000146
1419 Ga0466967_0018043
1420 Ga0466967_0034628
1421 Ga0495603_0027760
1422 Ga0495591_026314
1423 Ga0495580_0014204
1424 Ga0495662_0051620
1425 Ga0495585_0105296
1426 Ga0495594_0003876
1427 Ga0495594_0026725
1428 Ga0495618_0003625
1429 Ga0495630_0009445
1430 Ga0495630_0096123
1431 Ga0495643_0028028
1432 Ga0495666_0002314
1433 Ga0495652_0228888
1434 Ga0495665_0066580
1435 Ga0495640_0040386
1436 Ga0495586_0018993
1437 Ga0495598_0034937
1438 Ga0495667_0005248
1439 Ga0495634_0001475
1440 Ga0495659_0033531
1441 Ga0495659_0080591
1442 Ga0495588_0123207
1443 Ga0495647_0074756
1444 Ga0495658_0001709
1445 Ga0495658_0013808
1446 Ga0495613_0027031
1447 Ga0495649_0006214
1448 Ga0495649_0014081
1449 Ga0495581_0058289
1450 Ga0495674_0011641
1451 Ga0495680_0025218
1452 Ga0495687_020690
1453 Ga0495677_0013846
1454 Ga0496102_0020693
1455 Ga0496102_0021351
1456 Ga0496102_0054342
1457 Ga0496102_0095754
1458 Ga0496103_0007312
1459 Ga0496103_0035619
1460 Ga0496103_0064948
1461 Ga0496103_0116570
1462 Ga0496104_0003802
1463 Ga0496104_0004616
1464 Ga0496104_0014933
1465 Ga0496104_0096589
1466 Ga0496105_0192080
1467 Ga0496106_0021979
1468 Ga0496106_0023264
1469 Ga0496106_0047740
1470 Ga0496106_0095036
1471 Ga0496106_0241820
1472 Ga0496107_0035246
1473 Ga0496107_0059878
1474 Ga0496108_0004865
1475 Ga0496108_0006258
1476 Ga0496108_0009641
1477 Ga0496108_0022545
1478 Ga0496108_0211861
1479 Ga0496108_0217530
1480 Ga0496109_0002167
1481 Ga0496109_0002280
1482 Ga0496109_0003937
1483 Ga0496109_0017339
1484 Ga0496110_0003069
1485 Ga0496110_0012273
1486 Ga0496110_0023097
1487 Ga0496110_0059251
1488 Ga0496110_0191076
1489 Ga0496111_0009724
1490 Ga0496111_0012689
1491 Ga0496111_0049631
1492 Ga0496111_0226806
1493 Ga0496112_0002069
1494 Ga0496112_0025309
1495 Ga0496112_0031210
1496 Ga0496113_0003196
1497 Ga0496113_0004350
1498 Ga0496113_0004994
1499 Ga0496113_0006677
1500 Ga0496114_0010649
1501 Ga0496114_0439278
1502 Ga0496117_0000079
1503 Ga0496117_0000097
1504 Ga0496117_0000674
1505 Ga0496117_0091513
1506 Ga0496118_0001442
1507 Ga0496118_0042439
1508 Ga0496119_0000014
1509 Ga0496119_0011561
1510 Ga0496119_0016560
1511 Ga0496119_0144766
1512 Ga0496120_0000007
1513 Ga0496120_0000023
1514 Ga0496120_0002654
1515 Ga0496120_0003381
1516 Ga0496120_0003806
1517 Ga0496121_0000991
1518 Ga0496121_0043568
1519 Ga0496122_0000014
1520 Ga0496122_0000519
1521 Ga0496122_0010559
1522 Ga0496122_0043782
1523 Ga0496123_0000070
1524 Ga0496123_0015348
1525 Ga0496123_0128641
1526 Ga0496124_0035918
1527 Ga0496125_0000067
1528 Ga0496125_0002559
1529 Ga0496125_0004812
1530 Ga0496126_0000019
1531 Ga0496126_0000561
1532 Ga0496126_0077554
1533 Ga0496126_0131680
1534 Ga0501031_0056119
1535 Ga0501031_0110505
1536 Ga0501032_0007269
1537 Ga0501033_0118986
1538 Ga0501034_0000793
1539 Ga0501034_0020212
1540 Ga0501036_0026577
1541 Ga0501036_0056221
1542 Ga0501038_0016904
1543 Ga0501038_0187549
1544 Ga0501040_0044840
1545 Ga0501040_0082112
1546 Ga0501041_0006622
1547 Ga0501043_0003405
1548 Ga0501046_0024536
1549 Ga0501047_0000165
1550 Ga0501047_0007477
1551 Ga0501047_0046909
1552 Ga0501048_0045789
1553 Ga0501048_0180019
1554 Ga0501067_0001485
1555 Ga0501067_0029439
1556 Ga0501067_0029606
1557 Ga0501068_0000902
1558 Ga0501068_0003937
1559 Ga0501069_0002046
1560 Ga0501069_0007688
1561 Ga0501070_0000708
1562 Ga0501070_0005056
1563 Ga0501070_0022328
1564 Ga0501070_0146809
1565 Ga0501071_0000053
1566 Ga0501071_0007112
1567 Ga0501071_0010368
1568 Ga0501071_0068870
1569 Ga0501072_0000477
1570 Ga0501072_0025798
1571 Ga0501072_0051285
1572 Ga0501072_0072273
1573 Ga0501073_0133931
1574 Ga0501073_0204718
1575 Ga0501074_0000287
1576 Ga0501074_0029665
1577 Ga0501074_0040619
1578 Ga0501075_0026030
1579 Ga0501075_0089112
1580 Ga0501076_0036704
1581 Ga0501076_0043197
1582 Ga0501076_0158570
1583 Ga0501077_0001658
1584 Ga0501077_0010477
1585 Ga0501223_000962
1586 Ga0501239_005811
1587 Ga0501247_002251
1588 Ga0501079_0015844
1589 Ga0501079_0025436
1590 Ga0501079_0037199
1591 Ga0501079_0059559
1592 Ga0501080_0007037
1593 Ga0501080_0018485
1594 Ga0501080_0297271
1595 Ga0501081_0012929
1596 Ga0501081_0063193
1597 Ga0501083_0000635
1598 Ga0501083_0003729
1599 Ga0501083_0005487
1600 Ga0501083_0042228
1601 Ga0501083_0198353
1602 Ga0501263_002151
1603 Ga0501266_014045
1604 Ga0501268_001463
1605 Ga0501272_001851
1606 Ga0501044_0009183
1607 Ga0501044_0369473
1608 Ga0501045_0033215
1609 nmdc:mga05p37_167942_c1
1610 nmdc:mga05p37_28873_c1
1611 nmdc:mga05p37_3225_c1
1612 nmdc:mga05p37_32381_c1
1613 nmdc:mga05p37_58464_c2
1614 nmdc:mga09592_55427_c1
1615 nmdc:mga06r32_19003_c1
1616 nmdc:mga06r32_257796_c1
1617 nmdc:mga06r32_53757_c1
1618 nmdc:mga08y16_102425_c1
1619 nmdc:mga08y16_112719_c1
1620 nmdc:mga08y16_61539_c1
1621 nmdc:mga08y16_87545_c1
1622 nmdc:mga0n895_123962_c1
1623 nmdc:mga0n895_16061_c1
1624 nmdc:mga0n895_17816_c1
1625 nmdc:mga0n895_3385_c1
1626 nmdc:mga0n895_456381_c1
1627 nmdc:mga0n895_5093_c1
1628 nmdc:mga0n895_62622_c1
1629 nmdc:mga0rr50_229819_c1
1630 nmdc:mga0rr50_34029_c1
1631 nmdc:mga0rr50_6617_c1
1632 nmdc:mga08x19_1003_c1
1633 nmdc:mga08x19_11657_c2
1634 nmdc:mga08x19_182152_c1
1635 nmdc:mga08x19_37585_c1
1636 nmdc:mga08x19_9500_c1
1637 nmdc:mga0a205_17119_c1
1638 nmdc:mga0a205_44190_c1
1639 nmdc:mga0a205_69_c1
1640 Ga0500643_000361
1641 Ga0500651_0001925
1642 Ga0500559_0017308
1643 Ga0500559_0052949
1644 Ga0501084_0000720
1645 Ga0501084_0008307
1646 Ga0501084_0020155
1647 Ga0590071_002672
1648 Ga0590075_004265
1649 Ga0590077_005469
1650 Ga0590077_005555
1651 Ga0501082_0001411
1652 Ga0501082_0048511
1653 Ga0501082_0055378
1654 Ga0501082_0093748
1655 Ga0501082_0146981
1656 Ga0501082_0303872
1657 Ga0530510_0031082
1658 2524461619
1659 2553393246
1660 2585328886
1661 2595089321
1662 2616309792
1663 2643737953
1664 2644000621
1665 2644048710
1666 2644201962
1667 2644352648
1668 2644481512
1669 2644550400
1670 2644707997
1671 2644714726
1672 2685152343
1673 2698320815
1674 2705996280
1675 2721507502
1676 2739157861
1677 2739209980
1678 2739268434
1679 2757565091
1680 2777763952
1681 2777838408
1682 2819583114
1683 2831905229
1684 2842303199
1685 2842361489
1686 2842513648
1687 2842907625
1688 2857588460
1689 2881648396
1690 2884794110
1691 2889046912
1692 2904493816
1693 2911141048
1694 2916973980
1695 2919162895
1696 2929238047
1697 2931390359
1698 2936343470
1699 2938922236
1700 2939617455
1701 2945997417
1702 2946053627
1703 2947431131
1704 2956901638
1705 2965765497
1706 2977242890
1707 2979088035
1708 3001272026
1709 3006977608
1710 3006988406
1711 8007376074
1712 8007378135
1713 8022796969
1714 8023443954
1715 8023445241
1716 8057586799

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

46

420

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ld9-assembly1.cif.gz_A crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. oryzae in complex with cystathionine 0.9701 3 371
6ld8-assembly1.cif.gz_B crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. oryzae in complex with aminoacrylate and cysteine 0.9653 3 371
8biv-assembly1.cif.gz_A cystathionine gamma-lyase n360s mutant from toxoplasma gondii 0.9591 2 366
1cs1-assembly1.cif.gz_D cystathionine gamma-synthase (cgs) from escherichia coli 0.9578 5 367
8bis-assembly1.cif.gz_A-2 crystal structure of cystathionine gamma-lyase from toxoplasma gondii in complex with dl-propargylglycine 0.9574 2 366
ID Description Score Start End Superfamily
2nmpB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9894 234 367 3.90.1150.10
3ri6B02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9748 235 364 3.90.1150.10
af_P32929_263_402_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9738 234 371 3.90.1150.10
af_O13326_295_429_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9701 235 366 3.90.1150.10
3ndnB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9681 234 364 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A3M1RXG6-F1-model_v4 PLP-dependent transferase 0.9901 191 367 GO:0003962
GO:0004123
GO:0005737
GO:0019343
GO:0019346
GO:0030170
AF-T0JSG8-F1-model_v4 cystathionine gamma-lyase (EC 4.4.1.1) (Gamma-cystathionase) 0.9898 152 288 GO:0003962
GO:0004123
GO:0005737
GO:0019343
GO:0019346
GO:0030170
AF-A0A087TV62-F1-model_v4 cystathionine gamma-lyase (EC 4.4.1.1) (Gamma-cystathionase) 0.9891 155 325 GO:0004123
GO:0005737
GO:0019343
GO:0019346
GO:0030170
GO:0044540
GO:0080146
AF-T0UTK1-F1-model_v4 deleted 0.9885 155 364
AF-A0A6L4ZQW3-F1-model_v4 Cystathionine gamma-synthase 0.9875 174 364 GO:0005737
GO:0016846
GO:0019346
GO:0030170

Map