F483757
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 858 | 404 | 1716 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_001022|Ga0500618_001022_3488_4759 |
| Length | 423 |
| Sequence | MEALTVSNISFAQLATHQSSGDAQRRKRQFQFVKGNSPVSINKDFRTIAAANGIADDTAYGAVTPPLYLSSNFAFRKFEQAQAYEYSRTSNPTRDLLADTLAKLEGGAGAVVTSSGMAAVNLVLSLLKPGDRVIAPHDCYGGTYRLLAALRDKGHFHVEFVDQGNQEHLASALTRGATLVFVETPSNPLMRIVDINAIARQTKSAQARLVVDNTFLSPALQRPIALGADFVIHSTTKYLNGHSDVVGGTVVGANANDVEELKAWANIIGVTGSPFDSYLTLRGIRSLFARIERQQTTAMAVARFLSQHRQVGVVHYPGLPTHPGHELAARQQSGFGAMLSFELEGGLEAVRYFVAGLRIFTLAESLGGVESLVAHPASMTHVGMGAEARHAAGIKEGLLRVSVGLEAEEDLLSDLATSLAKIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 188 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 189 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 190 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 191 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 207 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 227 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 228 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 229 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 230 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 231 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 232 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 287 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 288 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 289 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 290 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 291 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 292 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 319 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 325 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 326 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 327 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 339 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 340 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 343 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 344 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 345 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 347 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 348 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 349 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 350 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 351 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 352 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 353 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 354 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 355 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 356 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 357 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 358 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 359 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 360 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 361 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 362 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 363 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 364 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 365 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 366 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 367 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 368 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 369 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 370 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 371 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 372 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 373 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 374 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 375 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 376 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 377 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 378 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 379 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 380 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 381 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 382 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 383 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 384 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 385 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 386 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 387 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 388 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 389 | 2939615513 | Lactococcus lactis 1925 | Isolate | Rhizosphere |
| 390 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 391 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 392 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 393 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 394 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 395 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 396 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 397 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 398 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 399 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 400 | 8007375930 | Clostridium sp. YIM B02565 | Isolate | Unclassified |
| 401 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 402 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 403 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 404 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.12 |
| Metatranscriptomes | 0 |
| Isolates | 6.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.01 |
| Nodule | 0.58 |
| Rhizoplane | 5.71 |
| Rhizosphere | 78.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500618_001022 | 3300053125 | Bacteria | 14017 |
| 2 | JGI24740J21852_10000067 | 3300001979 | Bacteria | 34146 |
| 3 | JGI25155J39150_1000021 | 3300002704 | Bacteria | 150730 |
| 4 | JGI25156J39149_1000022 | 3300002705 | Bacteria | 150730 |
| 5 | JGI25162J39368_1000768 | 3300002737 | Bacteria | 21685 |
| 6 | JGI25162J39368_1007079 | 3300002737 | Bacteria | 1808 |
| 7 | JGI25154J39366_1000048 | 3300002738 | Bacteria | 126252 |
| 8 | JGI25157J39369_1000025 | 3300002741 | Bacteria | 150726 |
| 9 | JGI25159J45721_1001956 | 3300002987 | Bacteria | 8207 |
| 10 | JGI25151J46595_10000200 | 3300003187 | Bacteria | 73683 |
| 11 | JGI25151J46595_10001902 | 3300003187 | Bacteria | 13270 |
| 12 | JGI25151J46595_10008914 | 3300003187 | Bacteria | 4786 |
| 13 | JGI25151J46595_10009147 | 3300003187 | Bacteria | 4714 |
| 14 | JGI25165J46597_1000866 | 3300003214 | Bacteria | 21685 |
| 15 | rootH1_10263746 | 3300003323 | Bacteria | 2212 |
| 16 | Ga0055532_1000126 | 3300003758 | Bacteria | 76489 |
| 17 | Ga0055536_1001449 | 3300003781 | Bacteria | 14277 |
| 18 | Ga0055531_10013001 | 3300003794 | Bacteria | 3870 |
| 19 | Ga0065715_10108125 | 3300005293 | Bacteria | 2735 |
| 20 | Ga0070658_10000088 | 3300005327 | Bacteria | 85441 |
| 21 | Ga0070658_10000930 | 3300005327 | Bacteria | 25063 |
| 22 | Ga0070658_10040249 | 3300005327 | Bacteria | 3770 |
| 23 | Ga0070658_10056117 | 3300005327 | Bacteria | 3201 |
| 24 | Ga0070658_10084410 | 3300005327 | Unclassified | 2611 |
| 25 | Ga0070658_10103327 | 3300005327 | Bacteria | 2357 |
| 26 | Ga0070658_10219345 | 3300005327 | Bacteria | 1608 |
| 27 | Ga0070676_10023903 | 3300005328 | Unclassified | 3437 |
| 28 | Ga0070683_100082114 | 3300005329 | Bacteria | 3018 |
| 29 | Ga0070690_100054220 | 3300005330 | Bacteria | 2566 |
| 30 | Ga0070690_100203021 | 3300005330 | Bacteria | 1380 |
| 31 | Ga0068869_100048558 | 3300005334 | Bacteria | 3069 |
| 32 | Ga0070666_10029720 | 3300005335 | Bacteria | 3595 |
| 33 | Ga0070680_100081930 | 3300005336 | Bacteria | 2662 |
| 34 | Ga0070680_100239569 | 3300005336 | Bacteria | 1533 |
| 35 | Ga0070682_100071514 | 3300005337 | Unclassified | 2220 |
| 36 | Ga0068868_100147466 | 3300005338 | Unclassified | 1936 |
| 37 | Ga0070660_100054524 | 3300005339 | Bacteria | 3088 |
| 38 | Ga0070692_10009417 | 3300005345 | Bacteria | 4404 |
| 39 | Ga0070668_100005416 | 3300005347 | Bacteria | 9473 |
| 40 | Ga0070668_100108007 | 3300005347 | Bacteria | 2212 |
| 41 | Ga0070669_100110512 | 3300005353 | Bacteria | 2085 |
| 42 | Ga0070675_100126407 | 3300005354 | Bacteria | 2175 |
| 43 | Ga0070675_100244615 | 3300005354 | Bacteria | 1568 |
| 44 | Ga0070675_100301146 | 3300005354 | Bacteria | 1413 |
| 45 | Ga0070671_100010754 | 3300005355 | Bacteria | 7345 |
| 46 | Ga0070674_100000051 | 3300005356 | Bacteria | 51724 |
| 47 | Ga0070674_100051511 | 3300005356 | Bacteria | 2837 |
| 48 | Ga0070673_100145146 | 3300005364 | Unclassified | 2006 |
| 49 | Ga0070673_100146664 | 3300005364 | Bacteria | 1995 |
| 50 | Ga0070659_100019292 | 3300005366 | Bacteria | 5164 |
| 51 | Ga0070667_100242062 | 3300005367 | Bacteria | 1611 |
| 52 | Ga0070703_10004280 | 3300005406 | Bacteria | 4021 |
| 53 | Ga0070709_10000961 | 3300005434 | Bacteria | 15980 |
| 54 | Ga0070709_10002694 | 3300005434 | Bacteria | 9592 |
| 55 | Ga0070709_10119210 | 3300005434 | Bacteria | 1786 |
| 56 | Ga0070714_100013846 | 3300005435 | Bacteria | 6467 |
| 57 | Ga0070711_100000042 | 3300005439 | Bacteria | 84000 |
| 58 | Ga0070711_100004639 | 3300005439 | Bacteria | 8133 |
| 59 | Ga0070705_100002218 | 3300005440 | Bacteria | 9876 |
| 60 | Ga0070705_100054283 | 3300005440 | Bacteria | 2350 |
| 61 | Ga0070705_100062832 | 3300005440 | Bacteria | 2213 |
| 62 | Ga0070705_100064377 | 3300005440 | Bacteria | 2190 |
| 63 | Ga0070694_100012511 | 3300005444 | Bacteria | 5278 |
| 64 | Ga0070694_100058655 | 3300005444 | Bacteria | 2619 |
| 65 | Ga0070694_100059773 | 3300005444 | Bacteria | 2597 |
| 66 | Ga0070694_100073102 | 3300005444 | Bacteria | 2367 |
| 67 | Ga0070694_100079917 | 3300005444 | Bacteria | 2271 |
| 68 | Ga0070694_100201254 | 3300005444 | Unclassified | 1485 |
| 69 | Ga0070708_100002721 | 3300005445 | Bacteria | 13720 |
| 70 | Ga0070708_100007399 | 3300005445 | Bacteria | 8785 |
| 71 | Ga0070708_100012615 | 3300005445 | Bacteria | 6902 |
| 72 | Ga0070708_100101052 | 3300005445 | Bacteria | 2640 |
| 73 | Ga0070663_100166477 | 3300005455 | Bacteria | 1701 |
| 74 | Ga0070678_100010192 | 3300005456 | Bacteria | 5729 |
| 75 | Ga0070678_100101513 | 3300005456 | Bacteria | 2230 |
| 76 | Ga0070662_100012673 | 3300005457 | Bacteria | 5596 |
| 77 | Ga0070681_10040737 | 3300005458 | Bacteria | 4653 |
| 78 | Ga0070681_10084492 | 3300005458 | Bacteria | 3126 |
| 79 | Ga0068867_100000105 | 3300005459 | Bacteria | 53757 |
| 80 | Ga0068867_100038567 | 3300005459 | Bacteria | 3478 |
| 81 | Ga0068867_100064912 | 3300005459 | Bacteria | 2715 |
| 82 | Ga0070706_100004195 | 3300005467 | Bacteria | 13995 |
| 83 | Ga0070706_100018895 | 3300005467 | Bacteria | 6357 |
| 84 | Ga0070706_100031700 | 3300005467 | Bacteria | 4873 |
| 85 | Ga0070706_100044665 | 3300005467 | Bacteria | 4093 |
| 86 | Ga0070706_100058297 | 3300005467 | Bacteria | 3564 |
| 87 | Ga0070706_100077352 | 3300005467 | Bacteria | 3080 |
| 88 | Ga0070707_100000424 | 3300005468 | Bacteria | 41821 |
| 89 | Ga0070707_100012132 | 3300005468 | Bacteria | 8045 |
| 90 | Ga0070707_100050316 | 3300005468 | Bacteria | 3994 |
| 91 | Ga0070707_100056206 | 3300005468 | Bacteria | 3775 |
| 92 | Ga0070707_100169318 | 3300005468 | Bacteria | 2129 |
| 93 | Ga0070707_100409915 | 3300005468 | Bacteria | 1316 |
| 94 | Ga0070698_100001017 | 3300005471 | Bacteria | 30831 |
| 95 | Ga0070698_100007200 | 3300005471 | Bacteria | 12052 |
| 96 | Ga0070698_100036570 | 3300005471 | Bacteria | 5070 |
| 97 | Ga0070698_100041965 | 3300005471 | Bacteria | 4695 |
| 98 | Ga0070698_100089610 | 3300005471 | Bacteria | 3060 |
| 99 | Ga0070698_100092091 | 3300005471 | Bacteria | 3012 |
| 100 | Ga0070698_100096235 | 3300005471 | Bacteria | 2938 |
| 101 | Ga0070699_100000214 | 3300005518 | Bacteria | 57401 |
| 102 | Ga0070699_100000323 | 3300005518 | Bacteria | 46254 |
| 103 | Ga0070699_100001300 | 3300005518 | Bacteria | 23052 |
| 104 | Ga0070699_100005410 | 3300005518 | Bacteria | 11195 |
| 105 | Ga0070699_100005704 | 3300005518 | Bacteria | 10904 |
| 106 | Ga0070699_100006606 | 3300005518 | Bacteria | 10084 |
| 107 | Ga0070699_100054949 | 3300005518 | Bacteria | 3448 |
| 108 | Ga0070699_100081319 | 3300005518 | Bacteria | 2824 |
| 109 | Ga0070699_100099817 | 3300005518 | Bacteria | 2544 |
| 110 | Ga0070699_100132089 | 3300005518 | Bacteria | 2201 |
| 111 | Ga0070679_100034282 | 3300005530 | Bacteria | 5030 |
| 112 | Ga0070679_100043973 | 3300005530 | Bacteria | 4448 |
| 113 | Ga0070679_100132311 | 3300005530 | Bacteria | 2475 |
| 114 | Ga0070684_100054255 | 3300005535 | Bacteria | 3492 |
| 115 | Ga0070684_100153434 | 3300005535 | Bacteria | 2087 |
| 116 | Ga0070684_100219972 | 3300005535 | Unclassified | 1733 |
| 117 | Ga0070697_100000978 | 3300005536 | Bacteria | 21569 |
| 118 | Ga0070697_100005606 | 3300005536 | Bacteria | 9672 |
| 119 | Ga0070697_100008921 | 3300005536 | Bacteria | 7835 |
| 120 | Ga0070697_100018428 | 3300005536 | Bacteria | 5503 |
| 121 | Ga0070697_100057993 | 3300005536 | Bacteria | 3150 |
| 122 | Ga0070697_100095318 | 3300005536 | Bacteria | 2467 |
| 123 | Ga0070697_100102639 | 3300005536 | Bacteria | 2376 |
| 124 | Ga0070697_100108894 | 3300005536 | Bacteria | 2307 |
| 125 | Ga0068853_100000379 | 3300005539 | Bacteria | 30522 |
| 126 | Ga0068853_100013999 | 3300005539 | Bacteria | 6562 |
| 127 | Ga0068853_100142862 | 3300005539 | Bacteria | 2149 |
| 128 | Ga0070672_100163950 | 3300005543 | Bacteria | 1846 |
| 129 | Ga0070686_100215635 | 3300005544 | Bacteria | 1384 |
| 130 | Ga0070695_100004478 | 3300005545 | Bacteria | 8207 |
| 131 | Ga0070695_100004986 | 3300005545 | Bacteria | 7826 |
| 132 | Ga0070695_100012708 | 3300005545 | Bacteria | 5054 |
| 133 | Ga0070695_100016650 | 3300005545 | Bacteria | 4453 |
| 134 | Ga0070695_100017339 | 3300005545 | Bacteria | 4366 |
| 135 | Ga0070695_100023116 | 3300005545 | Bacteria | 3817 |
| 136 | Ga0070695_100045700 | 3300005545 | Bacteria | 2792 |
| 137 | Ga0070696_100001570 | 3300005546 | Bacteria | 14963 |
| 138 | Ga0070696_100002058 | 3300005546 | Bacteria | 13191 |
| 139 | Ga0070696_100003170 | 3300005546 | Bacteria | 10949 |
| 140 | Ga0070696_100004043 | 3300005546 | Bacteria | 9781 |
| 141 | Ga0070696_100013474 | 3300005546 | Bacteria | 5486 |
| 142 | Ga0070696_100198850 | 3300005546 | Bacteria | 1495 |
| 143 | Ga0070704_100002951 | 3300005549 | Bacteria | 9674 |
| 144 | Ga0070704_100004126 | 3300005549 | Bacteria | 8384 |
| 145 | Ga0070704_100006978 | 3300005549 | Bacteria | 6698 |
| 146 | Ga0070704_100088720 | 3300005549 | Bacteria | 2298 |
| 147 | Ga0070704_100132699 | 3300005549 | Bacteria | 1933 |
| 148 | Ga0070704_100258588 | 3300005549 | Bacteria | 1433 |
| 149 | Ga0068855_100000173 | 3300005563 | Bacteria | 82962 |
| 150 | Ga0068855_100046214 | 3300005563 | Bacteria | 5147 |
| 151 | Ga0068855_100349972 | 3300005563 | Bacteria | 1628 |
| 152 | Ga0070664_100009642 | 3300005564 | Bacteria | 7834 |
| 153 | Ga0070664_100069393 | 3300005564 | Bacteria | 3016 |
| 154 | Ga0070664_100088458 | 3300005564 | Unclassified | 2678 |
| 155 | Ga0068857_100000037 | 3300005577 | Bacteria | 72271 |
| 156 | Ga0068857_100014839 | 3300005577 | Bacteria | 6795 |
| 157 | Ga0068854_100000155 | 3300005578 | Bacteria | 46783 |
| 158 | Ga0068854_100011752 | 3300005578 | Bacteria | 5714 |
| 159 | Ga0068856_100061326 | 3300005614 | Bacteria | 3715 |
| 160 | Ga0068856_100189030 | 3300005614 | Bacteria | 2073 |
| 161 | Ga0068852_100000060 | 3300005616 | Bacteria | 73764 |
| 162 | Ga0068852_100007002 | 3300005616 | Bacteria | 8207 |
| 163 | Ga0068852_100016276 | 3300005616 | Bacteria | 5793 |
| 164 | Ga0068852_100101952 | 3300005616 | Bacteria | 2593 |
| 165 | Ga0068852_100290956 | 3300005616 | Bacteria | 1578 |
| 166 | Ga0068859_100014945 | 3300005617 | Bacteria | 7792 |
| 167 | Ga0068859_100047934 | 3300005617 | Bacteria | 4292 |
| 168 | Ga0068859_100316633 | 3300005617 | Bacteria | 1654 |
| 169 | Ga0068864_100038559 | 3300005618 | Bacteria | 4081 |
| 170 | Ga0068864_100120885 | 3300005618 | Bacteria | 2342 |
| 171 | Ga0068864_100172242 | 3300005618 | Bacteria | 1974 |
| 172 | Ga0068864_100172316 | 3300005618 | Bacteria | 1974 |
| 173 | Ga0068866_10000089 | 3300005718 | Bacteria | 37940 |
| 174 | Ga0068861_100022544 | 3300005719 | Bacteria | 4539 |
| 175 | Ga0068861_100184845 | 3300005719 | Bacteria | 1737 |
| 176 | Ga0068851_10051817 | 3300005834 | Bacteria | 2086 |
| 177 | Ga0068851_10053311 | 3300005834 | Unclassified | 2059 |
| 178 | Ga0068870_10022667 | 3300005840 | Bacteria | 3088 |
| 179 | Ga0068863_100024078 | 3300005841 | Bacteria | 5809 |
| 180 | Ga0068863_100346622 | 3300005841 | Bacteria | 1446 |
| 181 | Ga0068858_100002910 | 3300005842 | Bacteria | 17221 |
| 182 | Ga0068858_100182716 | 3300005842 | Unclassified | 1980 |
| 183 | Ga0068862_100025988 | 3300005844 | Bacteria | 4920 |
| 184 | Ga0081455_10021249 | 3300005937 | Bacteria | 6090 |
| 185 | Ga0068871_100154425 | 3300006358 | Bacteria | 1959 |
| 186 | Ga0075428_100032572 | 3300006844 | Bacteria | 5757 |
| 187 | Ga0075428_100140034 | 3300006844 | Bacteria | 2630 |
| 188 | Ga0075428_100151453 | 3300006844 | Bacteria | 2520 |
| 189 | Ga0075428_100271391 | 3300006844 | Bacteria | 1825 |
| 190 | Ga0075428_100285135 | 3300006844 | Bacteria | 1777 |
| 191 | Ga0075430_100011922 | 3300006846 | Bacteria | 7400 |
| 192 | Ga0075431_100013317 | 3300006847 | Bacteria | 8312 |
| 193 | Ga0075431_100067740 | 3300006847 | Bacteria | 3685 |
| 194 | Ga0075431_100141528 | 3300006847 | Bacteria | 2480 |
| 195 | Ga0075431_100170418 | 3300006847 | Bacteria | 2237 |
| 196 | Ga0075431_100221008 | 3300006847 | Bacteria | 1932 |
| 197 | Ga0075433_10000417 | 3300006852 | Bacteria | 27154 |
| 198 | Ga0075433_10032796 | 3300006852 | Bacteria | 4450 |
| 199 | Ga0075433_10039292 | 3300006852 | Bacteria | 4091 |
| 200 | Ga0075433_10063335 | 3300006852 | Bacteria | 3239 |
| 201 | Ga0075433_10101883 | 3300006852 | Bacteria | 2542 |
| 202 | Ga0075433_10156122 | 3300006852 | Bacteria | 2030 |
| 203 | Ga0075434_100021972 | 3300006871 | Bacteria | 6210 |
| 204 | Ga0075434_100024845 | 3300006871 | Bacteria | 5857 |
| 205 | Ga0075434_100025785 | 3300006871 | Bacteria | 5755 |
| 206 | Ga0075434_100030166 | 3300006871 | Bacteria | 5339 |
| 207 | Ga0075434_100042605 | 3300006871 | Bacteria | 4500 |
| 208 | Ga0075434_100350208 | 3300006871 | Bacteria | 1498 |
| 209 | Ga0075429_100000245 | 3300006880 | Bacteria | 37442 |
| 210 | Ga0075429_100026890 | 3300006880 | Bacteria | 4995 |
| 211 | Ga0068865_100024985 | 3300006881 | Bacteria | 3924 |
| 212 | Ga0068865_100041162 | 3300006881 | Bacteria | 3143 |
| 213 | Ga0075436_100006278 | 3300006914 | Bacteria | 8143 |
| 214 | Ga0075436_100012872 | 3300006914 | Bacteria | 5735 |
| 215 | Ga0075436_100028747 | 3300006914 | Bacteria | 3824 |
| 216 | Ga0075436_100150499 | 3300006914 | Bacteria | 1638 |
| 217 | Ga0097620_100014945 | 3300006931 | Bacteria | 7792 |
| 218 | Ga0097620_100047935 | 3300006931 | Bacteria | 4292 |
| 219 | Ga0097620_100316601 | 3300006931 | Bacteria | 1654 |
| 220 | Ga0075435_100030291 | 3300007076 | Bacteria | 4253 |
| 221 | Ga0075435_100050811 | 3300007076 | Bacteria | 3337 |
| 222 | Ga0099794_10000209 | 3300007265 | Bacteria | 21183 |
| 223 | Ga0099794_10023753 | 3300007265 | Bacteria | 2808 |
| 224 | Ga0105251_10065619 | 3300009011 | Bacteria | 1698 |
| 225 | Ga0105244_10063488 | 3300009036 | Bacteria | 1855 |
| 226 | Ga0105244_10090664 | 3300009036 | Bacteria | 1503 |
| 227 | Ga0105244_10131485 | 3300009036 | Bacteria | 1207 |
| 228 | Ga0105244_10137388 | 3300009036 | Bacteria | 1177 |
| 229 | Ga0105250_10015525 | 3300009092 | Bacteria | 3117 |
| 230 | Ga0105240_10001752 | 3300009093 | Bacteria | 36654 |
| 231 | Ga0105240_10017002 | 3300009093 | Bacteria | 9826 |
| 232 | Ga0105240_10206402 | 3300009093 | Bacteria | 2299 |
| 233 | Ga0105240_10263024 | 3300009093 | Bacteria | 1989 |
| 234 | Ga0111539_10065774 | 3300009094 | Bacteria | 4283 |
| 235 | Ga0111539_10128706 | 3300009094 | Bacteria | 2966 |
| 236 | Ga0111539_10151820 | 3300009094 | Bacteria | 2711 |
| 237 | Ga0111539_10196392 | 3300009094 | Bacteria | 2353 |
| 238 | Ga0105245_10008907 | 3300009098 | Bacteria | 8760 |
| 239 | Ga0105245_10020091 | 3300009098 | Bacteria | 5855 |
| 240 | Ga0105245_10195763 | 3300009098 | Bacteria | 1939 |
| 241 | Ga0114129_10000842 | 3300009147 | Bacteria | 39704 |
| 242 | Ga0114129_10058540 | 3300009147 | Bacteria | 5389 |
| 243 | Ga0114129_10060174 | 3300009147 | Bacteria | 5310 |
| 244 | Ga0114129_10060316 | 3300009147 | Bacteria | 5304 |
| 245 | Ga0114129_10103781 | 3300009147 | Bacteria | 3930 |
| 246 | Ga0114129_10116171 | 3300009147 | Bacteria | 3687 |
| 247 | Ga0114129_10118161 | 3300009147 | Bacteria | 3652 |
| 248 | Ga0114129_10162690 | 3300009147 | Bacteria | 3047 |
| 249 | Ga0105241_10002544 | 3300009174 | Bacteria | 13686 |
| 250 | Ga0105241_10003242 | 3300009174 | Bacteria | 12101 |
| 251 | Ga0105248_10001920 | 3300009177 | Bacteria | 23071 |
| 252 | Ga0105248_10357544 | 3300009177 | Bacteria | 1644 |
| 253 | Ga0105237_10000038 | 3300009545 | Bacteria | 190707 |
| 254 | Ga0105237_10000378 | 3300009545 | Bacteria | 63407 |
| 255 | Ga0105237_10007764 | 3300009545 | Bacteria | 11701 |
| 256 | Ga0105238_10003191 | 3300009551 | Bacteria | 16361 |
| 257 | Ga0105249_10034132 | 3300009553 | Bacteria | 4608 |
| 258 | Ga0105249_10169024 | 3300009553 | Bacteria | 2119 |
| 259 | Ga0105239_10000108 | 3300010375 | Bacteria | 116364 |
| 260 | Ga0105239_10000232 | 3300010375 | Bacteria | 82037 |
| 261 | Ga0105239_10033598 | 3300010375 | Bacteria | 5632 |
| 262 | Ga0105239_10035885 | 3300010375 | Bacteria | 5444 |
| 263 | Ga0105239_10106815 | 3300010375 | Unclassified | 3101 |
| 264 | Ga0105239_10265918 | 3300010375 | Unclassified | 1928 |
| 265 | Ga0105246_10025986 | 3300011119 | Bacteria | 3819 |
| 266 | Ga0157373_10013102 | 3300013100 | Bacteria | 6086 |
| 267 | Ga0157371_10000011 | 3300013102 | Bacteria | 377608 |
| 268 | Ga0157371_10012401 | 3300013102 | Bacteria | 6517 |
| 269 | Ga0157371_10026023 | 3300013102 | Bacteria | 4258 |
| 270 | Ga0157371_10104704 | 3300013102 | Bacteria | 2008 |
| 271 | Ga0157370_10001010 | 3300013104 | Bacteria | 35540 |
| 272 | Ga0157369_10019197 | 3300013105 | Bacteria | 7650 |
| 273 | Ga0157369_10062381 | 3300013105 | Bacteria | 4017 |
| 274 | Ga0171463_1009 | 3300013249 | Bacteria | 288284 |
| 275 | Ga0157378_10001196 | 3300013297 | Bacteria | 23552 |
| 276 | Ga0163162_10021040 | 3300013306 | Bacteria | 6417 |
| 277 | Ga0163162_10033518 | 3300013306 | Bacteria | 5105 |
| 278 | Ga0163162_10238539 | 3300013306 | Bacteria | 1949 |
| 279 | Ga0163162_10583199 | 3300013306 | Bacteria | 1245 |
| 280 | Ga0157372_10003085 | 3300013307 | Bacteria | 17940 |
| 281 | Ga0157372_10043260 | 3300013307 | Bacteria | 4986 |
| 282 | Ga0157372_10094480 | 3300013307 | Bacteria | 3405 |
| 283 | Ga0157372_10258575 | 3300013307 | Bacteria | 2022 |
| 284 | Ga0157375_10011591 | 3300013308 | Bacteria | 7789 |
| 285 | Ga0157375_10035997 | 3300013308 | Bacteria | 4730 |
| 286 | Ga0157375_10180905 | 3300013308 | Bacteria | 2260 |
| 287 | Ga0157375_10335493 | 3300013308 | Bacteria | 1677 |
| 288 | Ga0157375_10623542 | 3300013308 | Bacteria | 1236 |
| 289 | Ga0163163_10064971 | 3300014325 | Bacteria | 3621 |
| 290 | Ga0157377_10014060 | 3300014745 | Bacteria | 4067 |
| 291 | Ga0157379_10022316 | 3300014968 | Bacteria | 5608 |
| 292 | Ga0157379_10076534 | 3300014968 | Unclassified | 2996 |
| 293 | Ga0157376_10345516 | 3300014969 | Bacteria | 1422 |
| 294 | Ga0183363_1132 | 3300015690 | Bacteria | 18933 |
| 295 | Ga0163161_10048311 | 3300017792 | Bacteria | 3073 |
| 296 | Ga0213874_10022602 | 3300021377 | Bacteria | 1747 |
| 297 | Ga0213875_10003417 | 3300021388 | Bacteria | 9038 |
| 298 | Ga0209435_100033 | 3300025206 | Bacteria | 150395 |
| 299 | Ga0209147_100182 | 3300025229 | Bacteria | 76541 |
| 300 | Ga0209147_102454 | 3300025229 | Bacteria | 4590 |
| 301 | Ga0209437_100326 | 3300025233 | Bacteria | 60536 |
| 302 | Ga0209437_100653 | 3300025233 | Bacteria | 19877 |
| 303 | Ga0209646_1000116 | 3300025246 | Bacteria | 150395 |
| 304 | Ga0209026_1000103 | 3300025250 | Bacteria | 152843 |
| 305 | Ga0209759_1000105 | 3300025256 | Bacteria | 150395 |
| 306 | Ga0209233_1000505 | 3300025261 | Bacteria | 23256 |
| 307 | Ga0209130_1001456 | 3300025284 | Bacteria | 15598 |
| 308 | Ga0209130_1002177 | 3300025284 | Bacteria | 10330 |
| 309 | Ga0209130_1002890 | 3300025284 | Bacteria | 7926 |
| 310 | Ga0209130_1015391 | 3300025284 | Bacteria | 1887 |
| 311 | Ga0209130_1018617 | 3300025284 | Bacteria | 1626 |
| 312 | Ga0209676_1000082 | 3300025292 | Bacteria | 280400 |
| 313 | Ga0209676_1000204 | 3300025292 | Bacteria | 132896 |
| 314 | Ga0209676_1003265 | 3300025292 | Bacteria | 10197 |
| 315 | Ga0209025_1000127 | 3300025294 | Bacteria | 200766 |
| 316 | Ga0209025_1000302 | 3300025294 | Bacteria | 110301 |
| 317 | Ga0209025_1001914 | 3300025294 | Bacteria | 24196 |
| 318 | Ga0209025_1002745 | 3300025294 | Bacteria | 17818 |
| 319 | Ga0209025_1002785 | 3300025294 | Bacteria | 17647 |
| 320 | Ga0209025_1003039 | 3300025294 | Bacteria | 16550 |
| 321 | Ga0209025_1004968 | 3300025294 | Bacteria | 11126 |
| 322 | Ga0209025_1011227 | 3300025294 | Bacteria | 5937 |
| 323 | Ga0209025_1011903 | 3300025294 | Bacteria | 5662 |
| 324 | Ga0209025_1012611 | 3300025294 | Bacteria | 5401 |
| 325 | Ga0209025_1016191 | 3300025294 | Bacteria | 4424 |
| 326 | Ga0209025_1025518 | 3300025294 | Bacteria | 3004 |
| 327 | Ga0209257_1000218 | 3300025304 | Bacteria | 135855 |
| 328 | Ga0209257_1030103 | 3300025304 | Bacteria | 1757 |
| 329 | Ga0207697_10035643 | 3300025315 | Bacteria | 2037 |
| 330 | Ga0207696_1004839 | 3300025711 | Bacteria | 5711 |
| 331 | Ga0207655_1005330 | 3300025728 | Bacteria | 8787 |
| 332 | Ga0207713_1028977 | 3300025735 | Bacteria | 2488 |
| 333 | Ga0207653_10000273 | 3300025885 | Bacteria | 30551 |
| 334 | Ga0207682_10007409 | 3300025893 | Bacteria | 4372 |
| 335 | Ga0207642_10000046 | 3300025899 | Bacteria | 35514 |
| 336 | Ga0207642_10084847 | 3300025899 | Bacteria | 1548 |
| 337 | Ga0207647_10021374 | 3300025904 | Bacteria | 4320 |
| 338 | Ga0207699_10002055 | 3300025906 | Bacteria | 9504 |
| 339 | Ga0207699_10014531 | 3300025906 | Bacteria | 4061 |
| 340 | Ga0207645_10000126 | 3300025907 | Bacteria | 58037 |
| 341 | Ga0207645_10000968 | 3300025907 | Bacteria | 23749 |
| 342 | Ga0207643_10007769 | 3300025908 | Bacteria | 5760 |
| 343 | Ga0207705_10000138 | 3300025909 | Bacteria | 78969 |
| 344 | Ga0207705_10019433 | 3300025909 | Bacteria | 4859 |
| 345 | Ga0207705_10051675 | 3300025909 | Bacteria | 2958 |
| 346 | Ga0207684_10009386 | 3300025910 | Bacteria | 8641 |
| 347 | Ga0207684_10021137 | 3300025910 | Bacteria | 5556 |
| 348 | Ga0207684_10035113 | 3300025910 | Bacteria | 4258 |
| 349 | Ga0207684_10045424 | 3300025910 | Bacteria | 3726 |
| 350 | Ga0207684_10079113 | 3300025910 | Bacteria | 2797 |
| 351 | Ga0207707_10015158 | 3300025912 | Bacteria | 6710 |
| 352 | Ga0207707_10170807 | 3300025912 | Bacteria | 1900 |
| 353 | Ga0207695_10008932 | 3300025913 | Bacteria | 12475 |
| 354 | Ga0207671_10000045 | 3300025914 | Bacteria | 201245 |
| 355 | Ga0207671_10000222 | 3300025914 | Bacteria | 85244 |
| 356 | Ga0207663_10000029 | 3300025916 | Bacteria | 99755 |
| 357 | Ga0207663_10021704 | 3300025916 | Bacteria | 3659 |
| 358 | Ga0207660_10019170 | 3300025917 | Bacteria | 4569 |
| 359 | Ga0207662_10002952 | 3300025918 | Bacteria | 8646 |
| 360 | Ga0207657_10027762 | 3300025919 | Bacteria | 5177 |
| 361 | Ga0207657_10030969 | 3300025919 | Bacteria | 4850 |
| 362 | Ga0207649_10033575 | 3300025920 | Bacteria | 3067 |
| 363 | Ga0207652_10015401 | 3300025921 | Bacteria | 6211 |
| 364 | Ga0207652_10038090 | 3300025921 | Bacteria | 4073 |
| 365 | Ga0207652_10211736 | 3300025921 | Bacteria | 1745 |
| 366 | Ga0207646_10001346 | 3300025922 | Bacteria | 30514 |
| 367 | Ga0207646_10020973 | 3300025922 | Bacteria | 6044 |
| 368 | Ga0207646_10029267 | 3300025922 | Bacteria | 5008 |
| 369 | Ga0207646_10031254 | 3300025922 | Bacteria | 4822 |
| 370 | Ga0207646_10049773 | 3300025922 | Bacteria | 3752 |
| 371 | Ga0207646_10057511 | 3300025922 | Bacteria | 3474 |
| 372 | Ga0207646_10063943 | 3300025922 | Bacteria | 3284 |
| 373 | Ga0207646_10107380 | 3300025922 | Bacteria | 2504 |
| 374 | Ga0207646_10189008 | 3300025922 | Bacteria | 1860 |
| 375 | Ga0207694_10002617 | 3300025924 | Bacteria | 14600 |
| 376 | Ga0207659_10057311 | 3300025926 | Bacteria | 2793 |
| 377 | Ga0207659_10242520 | 3300025926 | Bacteria | 1459 |
| 378 | Ga0207659_10243729 | 3300025926 | Bacteria | 1455 |
| 379 | Ga0207687_10010124 | 3300025927 | Bacteria | 6165 |
| 380 | Ga0207700_10125781 | 3300025928 | Bacteria | 2086 |
| 381 | Ga0207706_10000067 | 3300025933 | Bacteria | 108077 |
| 382 | Ga0207706_10020426 | 3300025933 | Bacteria | 5955 |
| 383 | Ga0207686_10000926 | 3300025934 | Bacteria | 17531 |
| 384 | Ga0207709_10005169 | 3300025935 | Bacteria | 7439 |
| 385 | Ga0207669_10000915 | 3300025937 | Bacteria | 12508 |
| 386 | Ga0207704_10001622 | 3300025938 | Bacteria | 10107 |
| 387 | Ga0207665_10003174 | 3300025939 | Bacteria | 11012 |
| 388 | Ga0207691_10005018 | 3300025940 | Bacteria | 12764 |
| 389 | Ga0207691_10074534 | 3300025940 | Bacteria | 3061 |
| 390 | Ga0207691_10109142 | 3300025940 | Bacteria | 2462 |
| 391 | Ga0207711_10021889 | 3300025941 | Bacteria | 5340 |
| 392 | Ga0207689_10000496 | 3300025942 | Bacteria | 37082 |
| 393 | Ga0207661_10114809 | 3300025944 | Unclassified | 2284 |
| 394 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 395 | Ga0207667_10049122 | 3300025949 | Bacteria | 4458 |
| 396 | Ga0207667_10186519 | 3300025949 | Bacteria | 2129 |
| 397 | Ga0207667_10325125 | 3300025949 | Bacteria | 1570 |
| 398 | Ga0207651_10025143 | 3300025960 | Bacteria | 3698 |
| 399 | Ga0207712_10018700 | 3300025961 | Bacteria | 4515 |
| 400 | Ga0207712_10150951 | 3300025961 | Bacteria | 1794 |
| 401 | Ga0207668_10013775 | 3300025972 | Bacteria | 4990 |
| 402 | Ga0207668_10026314 | 3300025972 | Bacteria | 3776 |
| 403 | Ga0207640_10000041 | 3300025981 | Bacteria | 105374 |
| 404 | Ga0207640_10002337 | 3300025981 | Bacteria | 10189 |
| 405 | Ga0207703_10002168 | 3300026035 | Bacteria | 17242 |
| 406 | Ga0207703_10090185 | 3300026035 | Bacteria | 2576 |
| 407 | Ga0207703_10168729 | 3300026035 | Unclassified | 1923 |
| 408 | Ga0207639_10000081 | 3300026041 | Bacteria | 82747 |
| 409 | Ga0207678_10027682 | 3300026067 | Bacteria | 4948 |
| 410 | Ga0207678_10072497 | 3300026067 | Bacteria | 2951 |
| 411 | Ga0207708_10019351 | 3300026075 | Bacteria | 5131 |
| 412 | Ga0207702_10036451 | 3300026078 | Bacteria | 4114 |
| 413 | Ga0207648_10000029 | 3300026089 | Bacteria | 130026 |
| 414 | Ga0207648_10007822 | 3300026089 | Bacteria | 10437 |
| 415 | Ga0207648_10046939 | 3300026089 | Bacteria | 3786 |
| 416 | Ga0207648_10050641 | 3300026089 | Bacteria | 3631 |
| 417 | Ga0207676_10027570 | 3300026095 | Bacteria | 4232 |
| 418 | Ga0207676_10100109 | 3300026095 | Bacteria | 2400 |
| 419 | Ga0207676_10138678 | 3300026095 | Bacteria | 2079 |
| 420 | Ga0207676_10286766 | 3300026095 | Bacteria | 1497 |
| 421 | Ga0207674_10001824 | 3300026116 | Bacteria | 27181 |
| 422 | Ga0207674_10002595 | 3300026116 | Bacteria | 22741 |
| 423 | Ga0207674_10043177 | 3300026116 | Bacteria | 4650 |
| 424 | Ga0207675_100000705 | 3300026118 | Bacteria | 33099 |
| 425 | Ga0207675_100044971 | 3300026118 | Bacteria | 4125 |
| 426 | Ga0207675_100115978 | 3300026118 | Bacteria | 2531 |
| 427 | Ga0207675_100146479 | 3300026118 | Bacteria | 2245 |
| 428 | Ga0207698_10000054 | 3300026142 | Bacteria | 82681 |
| 429 | Ga0207698_10052453 | 3300026142 | Bacteria | 3124 |
| 430 | Ga0209588_1001809 | 3300027671 | Bacteria | 5688 |
| 431 | Ga0209588_1007883 | 3300027671 | Bacteria | 3149 |
| 432 | Ga0207428_10057593 | 3300027907 | Bacteria | 3085 |
| 433 | Ga0207428_10095113 | 3300027907 | Bacteria | 2308 |
| 434 | Ga0268266_10051937 | 3300028379 | Bacteria | 3520 |
| 435 | Ga0268266_10090203 | 3300028379 | Bacteria | 2686 |
| 436 | Ga0268266_10349850 | 3300028379 | Unclassified | 1389 |
| 437 | Ga0268265_10048044 | 3300028380 | Unclassified | 3201 |
| 438 | Ga0268264_10008943 | 3300028381 | Bacteria | 8313 |
| 439 | Ga0237817_10191 | 3300030083 | Bacteria | 16329 |
| 440 | Ga0237817_10591 | 3300030083 | Bacteria | 3859 |
| 441 | Ga0316176_1009536 | 3300030732 | Bacteria | 17516 |
| 442 | Ga0316183_1210370 | 3300030742 | Bacteria | 36771 |
| 443 | Ga0316181_1088391 | 3300030744 | Bacteria | 37007 |
| 444 | Ga0265330_10018389 | 3300031235 | Unclassified | 3210 |
| 445 | Ga0307408_100039830 | 3300031548 | Bacteria | 3324 |
| 446 | Ga0307408_100058864 | 3300031548 | Bacteria | 2795 |
| 447 | Ga0307508_10000550 | 3300031616 | Bacteria | 44447 |
| 448 | Ga0316576_10024785 | 3300031727 | Bacteria | 4193 |
| 449 | Ga0316576_10035664 | 3300031727 | Bacteria | 3552 |
| 450 | Ga0307405_10087934 | 3300031731 | Unclassified | 2049 |
| 451 | Ga0307405_10199129 | 3300031731 | Bacteria | 1453 |
| 452 | Ga0307413_10005211 | 3300031824 | Bacteria | 5768 |
| 453 | Ga0307413_10014354 | 3300031824 | Bacteria | 4019 |
| 454 | Ga0307413_10026492 | 3300031824 | Bacteria | 3196 |
| 455 | Ga0307413_10112056 | 3300031824 | Bacteria | 1828 |
| 456 | Ga0307413_10112772 | 3300031824 | Bacteria | 1823 |
| 457 | Ga0307410_10014618 | 3300031852 | Bacteria | 4625 |
| 458 | Ga0307410_10021932 | 3300031852 | Unclassified | 3938 |
| 459 | Ga0307410_10022398 | 3300031852 | Bacteria | 3904 |
| 460 | Ga0307410_10022442 | 3300031852 | Bacteria | 3902 |
| 461 | Ga0307410_10044409 | 3300031852 | Bacteria | 2952 |
| 462 | Ga0307410_10067404 | 3300031852 | Bacteria | 2469 |
| 463 | Ga0307406_10001468 | 3300031901 | Bacteria | 13023 |
| 464 | Ga0307406_10013208 | 3300031901 | Bacteria | 4727 |
| 465 | Ga0307406_10026492 | 3300031901 | Bacteria | 3483 |
| 466 | Ga0307406_10076334 | 3300031901 | Bacteria | 2213 |
| 467 | Ga0307407_10006903 | 3300031903 | Bacteria | 5099 |
| 468 | Ga0307407_10010318 | 3300031903 | Bacteria | 4398 |
| 469 | Ga0307407_10016873 | 3300031903 | Bacteria | 3647 |
| 470 | Ga0307407_10077520 | 3300031903 | Bacteria | 1999 |
| 471 | Ga0307412_10006035 | 3300031911 | Bacteria | 6821 |
| 472 | Ga0307412_10077175 | 3300031911 | Bacteria | 2291 |
| 473 | Ga0307412_10147550 | 3300031911 | Bacteria | 1731 |
| 474 | Ga0307409_100000305 | 3300031995 | Bacteria | 20027 |
| 475 | Ga0307409_100005174 | 3300031995 | Bacteria | 7458 |
| 476 | Ga0307409_100008138 | 3300031995 | Bacteria | 6335 |
| 477 | Ga0307409_100019112 | 3300031995 | Bacteria | 4629 |
| 478 | Ga0307409_100044882 | 3300031995 | Bacteria | 3332 |
| 479 | Ga0307409_100052330 | 3300031995 | Bacteria | 3130 |
| 480 | Ga0307409_100102136 | 3300031995 | Bacteria | 2381 |
| 481 | Ga0307409_100421884 | 3300031995 | Bacteria | 1280 |
| 482 | Ga0307416_100002315 | 3300032002 | Bacteria | 10883 |
| 483 | Ga0307416_100008496 | 3300032002 | Bacteria | 6634 |
| 484 | Ga0307416_100034245 | 3300032002 | Bacteria | 3863 |
| 485 | Ga0307416_100068670 | 3300032002 | Bacteria | 2929 |
| 486 | Ga0307416_100078774 | 3300032002 | Bacteria | 2775 |
| 487 | Ga0307414_10018967 | 3300032004 | Bacteria | 4252 |
| 488 | Ga0307414_10029882 | 3300032004 | Bacteria | 3553 |
| 489 | Ga0307414_10035462 | 3300032004 | Bacteria | 3320 |
| 490 | Ga0307414_10039357 | 3300032004 | Bacteria | 3184 |
| 491 | Ga0307414_10044072 | 3300032004 | Bacteria | 3043 |
| 492 | Ga0307411_10003366 | 3300032005 | Bacteria | 7407 |
| 493 | Ga0307411_10007492 | 3300032005 | Bacteria | 5568 |
| 494 | Ga0307411_10010346 | 3300032005 | Bacteria | 4967 |
| 495 | Ga0307411_10029362 | 3300032005 | Bacteria | 3356 |
| 496 | Ga0307411_10078454 | 3300032005 | Bacteria | 2264 |
| 497 | Ga0307411_10085752 | 3300032005 | Bacteria | 2182 |
| 498 | Ga0307415_100002405 | 3300032126 | Bacteria | 9334 |
| 499 | Ga0307415_100074973 | 3300032126 | Unclassified | 2393 |
| 500 | Ga0307415_100095485 | 3300032126 | Bacteria | 2164 |
| 501 | Ga0307510_10053028 | 3300033180 | Bacteria | 4268 |
| 502 | Ga0373926_0011029 | 3300035083 | Bacteria | 3037 |
| 503 | Ga0373945_0010236 | 3300035116 | Bacteria | 3085 |
| 504 | Ga0373946_0030230 | 3300035171 | Bacteria | 2162 |
| 505 | Ga0373931_0028763 | 3300035691 | Bacteria | 2849 |
| 506 | Ga0373931_0037595 | 3300035691 | Bacteria | 2528 |
| 507 | Ga0373935_0007556 | 3300035692 | Bacteria | 6508 |
| 508 | Ga0373927_0002150 | 3300035695 | Bacteria | 14497 |
| 509 | Ga0373927_0002540 | 3300035695 | Bacteria | 13317 |
| 510 | Ga0373947_0022427 | 3300035725 | Bacteria | 3662 |
| 511 | Ga0373937_0078114 | 3300036401 | Bacteria | 3059 |
| 512 | Ga0373925_0000150 | 3300037068 | Bacteria | 74481 |
| 513 | Ga0373925_0000268 | 3300037068 | Bacteria | 54347 |
| 514 | Ga0395899_0040966 | 3300037312 | Bacteria | 3463 |
| 515 | Ga0395900_0088212 | 3300037418 | Bacteria | 3189 |
| 516 | Ga0395898_0053878 | 3300037466 | Bacteria | 3927 |
| 517 | Ga0395905_0000453 | 3300037471 | Bacteria | 57443 |
| 518 | Ga0395905_0103433 | 3300037471 | Bacteria | 2674 |
| 519 | Ga0436364_0237168 | 3300037853 | Bacteria | 3264 |
| 520 | Ga0436364_0258311 | 3300037853 | Bacteria | 5020 |
| 521 | Ga0436364_0900741 | 3300037853 | Bacteria | 16529 |
| 522 | Ga0395901_0178824 | 3300038443 | Bacteria | 2225 |
| 523 | Ga0237819_00335 | 3300038705 | Bacteria | 17194 |
| 524 | Ga0237819_00340 | 3300038705 | Bacteria | 17018 |
| 525 | Ga0436365_0305623 | 3300039437 | Bacteria | 2617 |
| 526 | Ga0436360_0992964 | 3300039438 | Bacteria | 2611 |
| 527 | Ga0436363_0497395 | 3300039450 | Bacteria | 3831 |
| 528 | Ga0436363_1258012 | 3300039450 | Bacteria | 1645 |
| 529 | Ga0451833_0349530 | 3300041491 | Bacteria | 5339 |
| 530 | Ga0451837_0409557 | 3300041494 | Bacteria | 5309 |
| 531 | Ga0451849_0549757 | 3300041505 | Bacteria | 6030 |
| 532 | Ga0451843_0348774 | 3300041509 | Bacteria | 4663 |
| 533 | Ga0451855_1464677 | 3300041511 | Bacteria | 5905 |
| 534 | Ga0450910_006064 | 3300042147 | Bacteria | 1660 |
| 535 | Ga0439435_0052317 | 3300042436 | Bacteria | 1172 |
| 536 | Ga0451577_0024930 | 3300042876 | Bacteria | 5432 |
| 537 | Ga0451577_0029778 | 3300042876 | Bacteria | 4933 |
| 538 | Ga0451577_0125839 | 3300042876 | Bacteria | 2296 |
| 539 | Ga0451577_0277939 | 3300042876 | Bacteria | 1517 |
| 540 | Ga0451577_0427025 | 3300042876 | Bacteria | 1203 |
| 541 | Ga0453683_0017887 | 3300044673 | Bacteria | 4556 |
| 542 | Ga0453683_0023779 | 3300044673 | Bacteria | 3903 |
| 543 | Ga0453683_0196082 | 3300044673 | Bacteria | 1282 |
| 544 | Ga0466963_0083659 | 3300044694 | Bacteria | 2164 |
| 545 | Ga0453684_0055788 | 3300044712 | Bacteria | 5133 |
| 546 | Ga0453684_0129600 | 3300044712 | Bacteria | 3028 |
| 547 | Ga0453684_0200586 | 3300044712 | Unclassified | 2326 |
| 548 | Ga0466970_0000677 | 3300044765 | Bacteria | 16657 |
| 549 | Ga0466957_0002447 | 3300044842 | Bacteria | 9967 |
| 550 | Ga0466959_0015455 | 3300045049 | Bacteria | 5562 |
| 551 | Ga0451576_0003765 | 3300045051 | Bacteria | 20447 |
| 552 | Ga0451576_0006877 | 3300045051 | Bacteria | 13776 |
| 553 | Ga0451576_0031330 | 3300045051 | Bacteria | 5671 |
| 554 | Ga0451576_0060358 | 3300045051 | Bacteria | 3956 |
| 555 | Ga0451576_0086250 | 3300045051 | Bacteria | 3265 |
| 556 | Ga0451576_0113754 | 3300045051 | Bacteria | 2817 |
| 557 | Ga0451576_0124593 | 3300045051 | Bacteria | 2684 |
| 558 | Ga0451576_0228913 | 3300045051 | Unclassified | 1941 |
| 559 | Ga0466958_0042350 | 3300045836 | Bacteria | 2742 |
| 560 | Ga0466967_0000146 | 3300045976 | Bacteria | 27617 |
| 561 | Ga0466967_0018043 | 3300045976 | Bacteria | 5628 |
| 562 | Ga0466967_0034628 | 3300045976 | Bacteria | 4289 |
| 563 | Ga0495603_0027760 | 3300046455 | Bacteria | 3414 |
| 564 | Ga0495591_026314 | 3300046458 | Bacteria | 1810 |
| 565 | Ga0495580_0014204 | 3300046472 | Bacteria | 6047 |
| 566 | Ga0495662_0051620 | 3300046476 | Bacteria | 1985 |
| 567 | Ga0495585_0105296 | 3300046492 | Bacteria | 1505 |
| 568 | Ga0495594_0003876 | 3300046499 | Bacteria | 7692 |
| 569 | Ga0495594_0026725 | 3300046499 | Bacteria | 3107 |
| 570 | Ga0495618_0003625 | 3300046514 | Bacteria | 9566 |
| 571 | Ga0495630_0009445 | 3300046517 | Bacteria | 7013 |
| 572 | Ga0495630_0096123 | 3300046517 | Bacteria | 2240 |
| 573 | Ga0495643_0028028 | 3300046522 | Bacteria | 3161 |
| 574 | Ga0495666_0002314 | 3300046526 | Bacteria | 9507 |
| 575 | Ga0495652_0228888 | 3300046529 | Bacteria | 1392 |
| 576 | Ga0495665_0066580 | 3300046531 | Bacteria | 1901 |
| 577 | Ga0495640_0040386 | 3300046533 | Bacteria | 3267 |
| 578 | Ga0495586_0018993 | 3300046535 | Bacteria | 3658 |
| 579 | Ga0495598_0034937 | 3300046537 | Bacteria | 1436 |
| 580 | Ga0495667_0005248 | 3300046559 | Bacteria | 8758 |
| 581 | Ga0495634_0001475 | 3300046642 | Bacteria | 20831 |
| 582 | Ga0495659_0033531 | 3300046664 | Bacteria | 1803 |
| 583 | Ga0495659_0080591 | 3300046664 | Unclassified | 1235 |
| 584 | Ga0495588_0123207 | 3300046674 | Bacteria | 1367 |
| 585 | Ga0495647_0074756 | 3300046681 | Bacteria | 1363 |
| 586 | Ga0495658_0001709 | 3300046683 | Bacteria | 11417 |
| 587 | Ga0495658_0013808 | 3300046683 | Bacteria | 4116 |
| 588 | Ga0495613_0027031 | 3300046689 | Bacteria | 4271 |
| 589 | Ga0495649_0006214 | 3300046694 | Bacteria | 7453 |
| 590 | Ga0495649_0014081 | 3300046694 | Bacteria | 4594 |
| 591 | Ga0495581_0058289 | 3300047315 | Bacteria | 2230 |
| 592 | Ga0495674_0011641 | 3300047319 | Bacteria | 8295 |
| 593 | Ga0495680_0025218 | 3300047322 | Bacteria | 4924 |
| 594 | Ga0495687_020690 | 3300047443 | Bacteria | 3203 |
| 595 | Ga0495677_0013846 | 3300047445 | Bacteria | 2937 |
| 596 | Ga0496102_0020693 | 3300048905 | Bacteria | 5814 |
| 597 | Ga0496102_0021351 | 3300048905 | Bacteria | 5726 |
| 598 | Ga0496102_0054342 | 3300048905 | Bacteria | 3651 |
| 599 | Ga0496102_0095754 | 3300048905 | Bacteria | 2752 |
| 600 | Ga0496103_0007312 | 3300048906 | Bacteria | 6581 |
| 601 | Ga0496103_0035619 | 3300048906 | Bacteria | 3048 |
| 602 | Ga0496103_0064948 | 3300048906 | Bacteria | 2276 |
| 603 | Ga0496103_0116570 | 3300048906 | Bacteria | 1699 |
| 604 | Ga0496104_0003802 | 3300048907 | Bacteria | 13057 |
| 605 | Ga0496104_0004616 | 3300048907 | Bacteria | 12004 |
| 606 | Ga0496104_0014933 | 3300048907 | Bacteria | 7021 |
| 607 | Ga0496104_0096589 | 3300048907 | Bacteria | 2827 |
| 608 | Ga0496105_0192080 | 3300048908 | Bacteria | 1669 |
| 609 | Ga0496106_0021979 | 3300048909 | Bacteria | 4739 |
| 610 | Ga0496106_0023264 | 3300048909 | Bacteria | 4603 |
| 611 | Ga0496106_0047740 | 3300048909 | Bacteria | 3223 |
| 612 | Ga0496106_0095036 | 3300048909 | Bacteria | 2305 |
| 613 | Ga0496106_0241820 | 3300048909 | Bacteria | 1442 |
| 614 | Ga0496107_0035246 | 3300048910 | Bacteria | 3587 |
| 615 | Ga0496107_0059878 | 3300048910 | Bacteria | 2756 |
| 616 | Ga0496108_0004865 | 3300048911 | Bacteria | 10846 |
| 617 | Ga0496108_0006258 | 3300048911 | Bacteria | 9643 |
| 618 | Ga0496108_0009641 | 3300048911 | Bacteria | 7827 |
| 619 | Ga0496108_0022545 | 3300048911 | Bacteria | 5177 |
| 620 | Ga0496108_0211861 | 3300048911 | Bacteria | 1682 |
| 621 | Ga0496108_0217530 | 3300048911 | Bacteria | 1659 |
| 622 | Ga0496109_0002167 | 3300048912 | Bacteria | 16318 |
| 623 | Ga0496109_0002280 | 3300048912 | Bacteria | 15950 |
| 624 | Ga0496109_0003937 | 3300048912 | Bacteria | 12408 |
| 625 | Ga0496109_0017339 | 3300048912 | Bacteria | 6310 |
| 626 | Ga0496110_0003069 | 3300048913 | Bacteria | 12660 |
| 627 | Ga0496110_0012273 | 3300048913 | Bacteria | 7041 |
| 628 | Ga0496110_0023097 | 3300048913 | Bacteria | 5289 |
| 629 | Ga0496110_0059251 | 3300048913 | Bacteria | 3374 |
| 630 | Ga0496110_0191076 | 3300048913 | Bacteria | 1859 |
| 631 | Ga0496111_0009724 | 3300048914 | Bacteria | 6428 |
| 632 | Ga0496111_0012689 | 3300048914 | Bacteria | 5711 |
| 633 | Ga0496111_0049631 | 3300048914 | Bacteria | 3026 |
| 634 | Ga0496111_0226806 | 3300048914 | Bacteria | 1388 |
| 635 | Ga0496112_0002069 | 3300048915 | Bacteria | 15908 |
| 636 | Ga0496112_0025309 | 3300048915 | Bacteria | 5698 |
| 637 | Ga0496112_0031210 | 3300048915 | Bacteria | 5165 |
| 638 | Ga0496113_0003196 | 3300048916 | Bacteria | 9760 |
| 639 | Ga0496113_0004350 | 3300048916 | Bacteria | 8681 |
| 640 | Ga0496113_0004994 | 3300048916 | Bacteria | 8223 |
| 641 | Ga0496113_0006677 | 3300048916 | Bacteria | 7341 |
| 642 | Ga0496114_0010649 | 3300048917 | Bacteria | 7319 |
| 643 | Ga0496114_0439278 | 3300048917 | Bacteria | 1156 |
| 644 | Ga0496117_0000079 | 3300048920 | Bacteria | 226960 |
| 645 | Ga0496117_0000097 | 3300048920 | Bacteria | 196340 |
| 646 | Ga0496117_0000674 | 3300048920 | Bacteria | 54521 |
| 647 | Ga0496117_0091513 | 3300048920 | Bacteria | 1956 |
| 648 | Ga0496118_0001442 | 3300048921 | Bacteria | 35788 |
| 649 | Ga0496118_0042439 | 3300048921 | Bacteria | 3588 |
| 650 | Ga0496119_0000014 | 3300048922 | Bacteria | 313816 |
| 651 | Ga0496119_0011561 | 3300048922 | Bacteria | 7285 |
| 652 | Ga0496119_0016560 | 3300048922 | Bacteria | 5601 |
| 653 | Ga0496119_0144766 | 3300048922 | Bacteria | 1279 |
| 654 | Ga0496120_0000007 | 3300048923 | Bacteria | 436796 |
| 655 | Ga0496120_0000023 | 3300048923 | Bacteria | 240991 |
| 656 | Ga0496120_0002654 | 3300048923 | Bacteria | 17651 |
| 657 | Ga0496120_0003381 | 3300048923 | Bacteria | 14608 |
| 658 | Ga0496120_0003806 | 3300048923 | Bacteria | 13292 |
| 659 | Ga0496121_0000991 | 3300048924 | Bacteria | 50787 |
| 660 | Ga0496121_0043568 | 3300048924 | Bacteria | 3885 |
| 661 | Ga0496122_0000014 | 3300048925 | Bacteria | 491410 |
| 662 | Ga0496122_0000519 | 3300048925 | Bacteria | 79822 |
| 663 | Ga0496122_0010559 | 3300048925 | Bacteria | 9490 |
| 664 | Ga0496122_0043782 | 3300048925 | Bacteria | 3503 |
| 665 | Ga0496123_0000070 | 3300048926 | Bacteria | 200108 |
| 666 | Ga0496123_0015348 | 3300048926 | Bacteria | 6289 |
| 667 | Ga0496123_0128641 | 3300048926 | Bacteria | 1408 |
| 668 | Ga0496124_0035918 | 3300048927 | Bacteria | 4330 |
| 669 | Ga0496125_0000067 | 3300048928 | Bacteria | 248871 |
| 670 | Ga0496125_0002559 | 3300048928 | Bacteria | 23425 |
| 671 | Ga0496125_0004812 | 3300048928 | Bacteria | 15349 |
| 672 | Ga0496126_0000019 | 3300048929 | Bacteria | 564723 |
| 673 | Ga0496126_0000561 | 3300048929 | Bacteria | 71365 |
| 674 | Ga0496126_0077554 | 3300048929 | Bacteria | 2945 |
| 675 | Ga0496126_0131680 | 3300048929 | Bacteria | 2160 |
| 676 | Ga0501031_0056119 | 3300049568 | Bacteria | 2566 |
| 677 | Ga0501031_0110505 | 3300049568 | Bacteria | 1795 |
| 678 | Ga0501032_0007269 | 3300049569 | Bacteria | 8101 |
| 679 | Ga0501033_0118986 | 3300049570 | Bacteria | 1918 |
| 680 | Ga0501034_0000793 | 3300049571 | Bacteria | 47013 |
| 681 | Ga0501034_0020212 | 3300049571 | Bacteria | 6799 |
| 682 | Ga0501036_0026577 | 3300049572 | Bacteria | 4888 |
| 683 | Ga0501036_0056221 | 3300049572 | Bacteria | 3334 |
| 684 | Ga0501038_0016904 | 3300049574 | Bacteria | 6603 |
| 685 | Ga0501038_0187549 | 3300049574 | Bacteria | 1666 |
| 686 | Ga0501040_0044840 | 3300049576 | Bacteria | 3015 |
| 687 | Ga0501040_0082112 | 3300049576 | Bacteria | 2234 |
| 688 | Ga0501041_0006622 | 3300049577 | Bacteria | 6785 |
| 689 | Ga0501043_0003405 | 3300049579 | Bacteria | 13080 |
| 690 | Ga0501046_0024536 | 3300049580 | Bacteria | 4944 |
| 691 | Ga0501047_0000165 | 3300049581 | Bacteria | 81037 |
| 692 | Ga0501047_0007477 | 3300049581 | Bacteria | 10282 |
| 693 | Ga0501047_0046909 | 3300049581 | Bacteria | 4174 |
| 694 | Ga0501048_0045789 | 3300049582 | Bacteria | 3123 |
| 695 | Ga0501048_0180019 | 3300049582 | Unclassified | 1498 |
| 696 | Ga0501067_0001485 | 3300049583 | Bacteria | 12754 |
| 697 | Ga0501067_0029439 | 3300049583 | Bacteria | 3043 |
| 698 | Ga0501067_0029606 | 3300049583 | Bacteria | 3034 |
| 699 | Ga0501068_0000902 | 3300049584 | Bacteria | 15526 |
| 700 | Ga0501068_0003937 | 3300049584 | Bacteria | 8078 |
| 701 | Ga0501069_0002046 | 3300049585 | Bacteria | 10122 |
| 702 | Ga0501069_0007688 | 3300049585 | Bacteria | 5655 |
| 703 | Ga0501070_0000708 | 3300049586 | Bacteria | 30530 |
| 704 | Ga0501070_0005056 | 3300049586 | Bacteria | 11248 |
| 705 | Ga0501070_0022328 | 3300049586 | Bacteria | 5301 |
| 706 | Ga0501070_0146809 | 3300049586 | Bacteria | 1947 |
| 707 | Ga0501071_0000053 | 3300049587 | Bacteria | 38500 |
| 708 | Ga0501071_0007112 | 3300049587 | Bacteria | 7314 |
| 709 | Ga0501071_0010368 | 3300049587 | Bacteria | 6242 |
| 710 | Ga0501071_0068870 | 3300049587 | Unclassified | 2576 |
| 711 | Ga0501072_0000477 | 3300049588 | Bacteria | 28757 |
| 712 | Ga0501072_0025798 | 3300049588 | Bacteria | 4579 |
| 713 | Ga0501072_0051285 | 3300049588 | Bacteria | 3249 |
| 714 | Ga0501072_0072273 | 3300049588 | Bacteria | 2726 |
| 715 | Ga0501073_0133931 | 3300049589 | Bacteria | 1717 |
| 716 | Ga0501073_0204718 | 3300049589 | Bacteria | 1364 |
| 717 | Ga0501074_0000287 | 3300049590 | Bacteria | 29149 |
| 718 | Ga0501074_0029665 | 3300049590 | Bacteria | 3963 |
| 719 | Ga0501074_0040619 | 3300049590 | Bacteria | 3369 |
| 720 | Ga0501075_0026030 | 3300049591 | Bacteria | 4302 |
| 721 | Ga0501075_0089112 | 3300049591 | Bacteria | 2339 |
| 722 | Ga0501076_0036704 | 3300049592 | Bacteria | 3841 |
| 723 | Ga0501076_0043197 | 3300049592 | Bacteria | 3550 |
| 724 | Ga0501076_0158570 | 3300049592 | Bacteria | 1843 |
| 725 | Ga0501077_0001658 | 3300049593 | Bacteria | 13391 |
| 726 | Ga0501077_0010477 | 3300049593 | Bacteria | 5769 |
| 727 | Ga0501223_000962 | 3300049663 | Bacteria | 6783 |
| 728 | Ga0501239_005811 | 3300049672 | Bacteria | 1253 |
| 729 | Ga0501247_002251 | 3300049677 | Unclassified | 1990 |
| 730 | Ga0501079_0015844 | 3300049741 | Bacteria | 5760 |
| 731 | Ga0501079_0025436 | 3300049741 | Bacteria | 4540 |
| 732 | Ga0501079_0037199 | 3300049741 | Bacteria | 3750 |
| 733 | Ga0501079_0059559 | 3300049741 | Bacteria | 2945 |
| 734 | Ga0501080_0007037 | 3300049742 | Bacteria | 10157 |
| 735 | Ga0501080_0018485 | 3300049742 | Bacteria | 6449 |
| 736 | Ga0501080_0297271 | 3300049742 | Unclassified | 1465 |
| 737 | Ga0501081_0012929 | 3300049743 | Bacteria | 5492 |
| 738 | Ga0501081_0063193 | 3300049743 | Bacteria | 2569 |
| 739 | Ga0501083_0000635 | 3300049744 | Bacteria | 22726 |
| 740 | Ga0501083_0003729 | 3300049744 | Bacteria | 10699 |
| 741 | Ga0501083_0005487 | 3300049744 | Bacteria | 8983 |
| 742 | Ga0501083_0042228 | 3300049744 | Bacteria | 3092 |
| 743 | Ga0501083_0198353 | 3300049744 | Bacteria | 1309 |
| 744 | Ga0501263_002151 | 3300049760 | Bacteria | 1974 |
| 745 | Ga0501266_014045 | 3300049763 | Bacteria | 1046 |
| 746 | Ga0501268_001463 | 3300049765 | Bacteria | 2950 |
| 747 | Ga0501272_001851 | 3300049769 | Unclassified | 2061 |
| 748 | Ga0501044_0009183 | 3300049823 | Bacteria | 10799 |
| 749 | Ga0501044_0369473 | 3300049823 | Bacteria | 1351 |
| 750 | Ga0501045_0033215 | 3300049824 | Bacteria | 3741 |
| 751 | nmdc:mga05p37_167942_c1 | 3300050507 | Bacteria | 2677 |
| 752 | nmdc:mga05p37_28873_c1 | 3300050507 | Bacteria | 6765 |
| 753 | nmdc:mga05p37_3225_c1 | 3300050507 | Bacteria | 19005 |
| 754 | nmdc:mga05p37_32381_c1 | 3300050507 | Bacteria | 6393 |
| 755 | nmdc:mga05p37_58464_c2 | 3300050507 | Bacteria | 3801 |
| 756 | nmdc:mga09592_55427_c1 | 3300050508 | Unclassified | 3350 |
| 757 | nmdc:mga06r32_19003_c1 | 3300050510 | Bacteria | 6301 |
| 758 | nmdc:mga06r32_257796_c1 | 3300050510 | Unclassified | 1731 |
| 759 | nmdc:mga06r32_53757_c1 | 3300050510 | Bacteria | 3859 |
| 760 | nmdc:mga08y16_102425_c1 | 3300050511 | Bacteria | 2981 |
| 761 | nmdc:mga08y16_112719_c1 | 3300050511 | Bacteria | 2831 |
| 762 | nmdc:mga08y16_61539_c1 | 3300050511 | Bacteria | 3920 |
| 763 | nmdc:mga08y16_87545_c1 | 3300050511 | Bacteria | 3245 |
| 764 | nmdc:mga0n895_123962_c1 | 3300050512 | Bacteria | 2606 |
| 765 | nmdc:mga0n895_16061_c1 | 3300050512 | Bacteria | 6859 |
| 766 | nmdc:mga0n895_17816_c1 | 3300050512 | Bacteria | 6558 |
| 767 | nmdc:mga0n895_3385_c1 | 3300050512 | Bacteria | 12831 |
| 768 | nmdc:mga0n895_456381_c1 | 3300050512 | Bacteria | 1290 |
| 769 | nmdc:mga0n895_5093_c1 | 3300050512 | Bacteria | 10915 |
| 770 | nmdc:mga0n895_62622_c1 | 3300050512 | Bacteria | 3677 |
| 771 | nmdc:mga0rr50_229819_c1 | 3300050513 | Bacteria | 1534 |
| 772 | nmdc:mga0rr50_34029_c1 | 3300050513 | Bacteria | 3646 |
| 773 | nmdc:mga0rr50_6617_c1 | 3300050513 | Bacteria | 7082 |
| 774 | nmdc:mga08x19_1003_c1 | 3300050514 | Bacteria | 17632 |
| 775 | nmdc:mga08x19_11657_c2 | 3300050514 | Bacteria | 3313 |
| 776 | nmdc:mga08x19_182152_c1 | 3300050514 | Bacteria | 1434 |
| 777 | nmdc:mga08x19_37585_c1 | 3300050514 | Bacteria | 3073 |
| 778 | nmdc:mga08x19_9500_c1 | 3300050514 | Bacteria | 5824 |
| 779 | nmdc:mga0a205_17119_c1 | 3300050515 | Bacteria | 6788 |
| 780 | nmdc:mga0a205_44190_c1 | 3300050515 | Bacteria | 4294 |
| 781 | nmdc:mga0a205_69_c1 | 3300050515 | Bacteria | 56310 |
| 782 | Ga0500643_000361 | 3300053087 | Bacteria | 36161 |
| 783 | Ga0500651_0001925 | 3300053093 | Bacteria | 10711 |
| 784 | Ga0500559_0017308 | 3300053136 | Bacteria | 3043 |
| 785 | Ga0500559_0052949 | 3300053136 | Bacteria | 1795 |
| 786 | Ga0501084_0000720 | 3300054114 | Bacteria | 25236 |
| 787 | Ga0501084_0008307 | 3300054114 | Bacteria | 8567 |
| 788 | Ga0501084_0020155 | 3300054114 | Bacteria | 5559 |
| 789 | Ga0590071_002672 | 3300059421 | Bacteria | 4478 |
| 790 | Ga0590075_004265 | 3300059424 | Bacteria | 3383 |
| 791 | Ga0590077_005469 | 3300059426 | Bacteria | 2605 |
| 792 | Ga0590077_005555 | 3300059426 | Bacteria | 2581 |
| 793 | Ga0501082_0001411 | 3300060353 | Bacteria | 21118 |
| 794 | Ga0501082_0048511 | 3300060353 | Bacteria | 3659 |
| 795 | Ga0501082_0055378 | 3300060353 | Bacteria | 3417 |
| 796 | Ga0501082_0093748 | 3300060353 | Bacteria | 2594 |
| 797 | Ga0501082_0146981 | 3300060353 | Bacteria | 2046 |
| 798 | Ga0501082_0303872 | 3300060353 | Bacteria | 1389 |
| 799 | Ga0530510_0031082 | 3300061734 | Bacteria | 3838 |
| 800 | 2524461619 | 2524023209 | Bacteria | 6679728 |
| 801 | 2553393246 | 2551306519 | Bacteria | 5465154 |
| 802 | 2585328886 | 2582581315 | Bacteria | 7318924 |
| 803 | 2595089321 | 2593339131 | Bacteria | 5116855 |
| 804 | 2616309792 | 2615840626 | Bacteria | 7921970 |
| 805 | 2643737953 | 2643221543 | Bacteria | 6628015 |
| 806 | 2644000621 | 2643221598 | Bacteria | 4578346 |
| 807 | 2644048710 | 2643221607 | Bacteria | 6314006 |
| 808 | 2644201962 | 2643221636 | Bacteria | 6583769 |
| 809 | 2644352648 | 2643221663 | Bacteria | 3425771 |
| 810 | 2644481512 | 2643221686 | Bacteria | 6310811 |
| 811 | 2644550400 | 2643221699 | Bacteria | 5731501 |
| 812 | 2644707997 | 2643221729 | Bacteria | 6621700 |
| 813 | 2644714726 | 2643221730 | Bacteria | 6523787 |
| 814 | 2685152343 | 2684622632 | Bacteria | 5380049 |
| 815 | 2698320815 | 2695420987 | Bacteria | 6152737 |
| 816 | 2705996280 | 2703719227 | Bacteria | 5631989 |
| 817 | 2721507502 | 2718218445 | Bacteria | 5113413 |
| 818 | 2739157861 | 2738541358 | Bacteria | 5932299 |
| 819 | 2739209980 | 2738543006 | Bacteria | 5904091 |
| 820 | 2739268434 | 2738543017 | Bacteria | 4271950 |
| 821 | 2757565091 | 2757320391 | Bacteria | 4746095 |
| 822 | 2777763952 | 2775507177 | Bacteria | 4384303 |
| 823 | 2777838408 | 2775507192 | Bacteria | 4622234 |
| 824 | 2819583114 | 2818991443 | Bacteria | 6598732 |
| 825 | 2831905229 | 2831905167 | Bacteria | 3319172 |
| 826 | 2842303199 | 2842298080 | Bacteria | 6123127 |
| 827 | 2842361489 | 2842357229 | Bacteria | 6485165 |
| 828 | 2842513648 | 2842509118 | Bacteria | 6850950 |
| 829 | 2842907625 | 2842903701 | Bacteria | 6986368 |
| 830 | 2857588460 | 2857586860 | Bacteria | 4354574 |
| 831 | 2881648396 | 2881644220 | Bacteria | 5302661 |
| 832 | 2884794110 | 2884791551 | Bacteria | 8511252 |
| 833 | 2889046912 | 2889042446 | Bacteria | 7618936 |
| 834 | 2904493816 | 2904490793 | Bacteria | 7046938 |
| 835 | 2911141048 | 2911138879 | Bacteria | 5811561 |
| 836 | 2916973980 | 2916971899 | Bacteria | 4250608 |
| 837 | 2919162895 | 2919160200 | Bacteria | 6929020 |
| 838 | 2929238047 | 2929233124 | Bacteria | 5948380 |
| 839 | 2931390359 | 2931384279 | Bacteria | 7299545 |
| 840 | 2936343470 | 2936340661 | Bacteria | 5139038 |
| 841 | 2938922236 | 2938917290 | Bacteria | 5914775 |
| 842 | 2939617455 | 2939615513 | Bacteria | 2384962 |
| 843 | 2945997417 | 2945991243 | Bacteria | 7008369 |
| 844 | 2946053627 | 2946053406 | Bacteria | 6978655 |
| 845 | 2947431131 | 2947426588 | Bacteria | 5357194 |
| 846 | 2956901638 | 2956897341 | Bacteria | 5447711 |
| 847 | 2965765497 | 2965761152 | Bacteria | 5806513 |
| 848 | 2977242890 | 2977240413 | Bacteria | 3191065 |
| 849 | 2979088035 | 2979083700 | Bacteria | 5894929 |
| 850 | 3001272026 | 3001267043 | Bacteria | 4823521 |
| 851 | 3006977608 | 3006973921 | Bacteria | 4423788 |
| 852 | 3006988406 | 3006984091 | Bacteria | 4207523 |
| 853 | 8007376074 | 8007375930 | Bacteria | 4080554 |
| 854 | 8007378135 | 8007375930 | Bacteria | 4080554 |
| 855 | 8022796969 | 8022792930 | Bacteria | 5693794 |
| 856 | 8023443954 | 8023438354 | Bacteria | 5779374 |
| 857 | 8023445241 | 8023444577 | Bacteria | 5661597 |
| 858 | 8057586799 | 8057582654 | Bacteria | 5218944 |
| 859 | Ga0500618_001022 | |||
| 860 | JGI24740J21852_10000067 | |||
| 861 | JGI25155J39150_1000021 | |||
| 862 | JGI25156J39149_1000022 | |||
| 863 | JGI25162J39368_1000768 | |||
| 864 | JGI25162J39368_1007079 | |||
| 865 | JGI25154J39366_1000048 | |||
| 866 | JGI25157J39369_1000025 | |||
| 867 | JGI25159J45721_1001956 | |||
| 868 | JGI25151J46595_10000200 | |||
| 869 | JGI25151J46595_10001902 | |||
| 870 | JGI25151J46595_10008914 | |||
| 871 | JGI25151J46595_10009147 | |||
| 872 | JGI25165J46597_1000866 | |||
| 873 | rootH1_10263746 | |||
| 874 | Ga0055532_1000126 | |||
| 875 | Ga0055536_1001449 | |||
| 876 | Ga0055531_10013001 | |||
| 877 | Ga0065715_10108125 | |||
| 878 | Ga0070658_10000088 | |||
| 879 | Ga0070658_10000930 | |||
| 880 | Ga0070658_10040249 | |||
| 881 | Ga0070658_10056117 | |||
| 882 | Ga0070658_10084410 | |||
| 883 | Ga0070658_10103327 | |||
| 884 | Ga0070658_10219345 | |||
| 885 | Ga0070676_10023903 | |||
| 886 | Ga0070683_100082114 | |||
| 887 | Ga0070690_100054220 | |||
| 888 | Ga0070690_100203021 | |||
| 889 | Ga0068869_100048558 | |||
| 890 | Ga0070666_10029720 | |||
| 891 | Ga0070680_100081930 | |||
| 892 | Ga0070680_100239569 | |||
| 893 | Ga0070682_100071514 | |||
| 894 | Ga0068868_100147466 | |||
| 895 | Ga0070660_100054524 | |||
| 896 | Ga0070692_10009417 | |||
| 897 | Ga0070668_100005416 | |||
| 898 | Ga0070668_100108007 | |||
| 899 | Ga0070669_100110512 | |||
| 900 | Ga0070675_100126407 | |||
| 901 | Ga0070675_100244615 | |||
| 902 | Ga0070675_100301146 | |||
| 903 | Ga0070671_100010754 | |||
| 904 | Ga0070674_100000051 | |||
| 905 | Ga0070674_100051511 | |||
| 906 | Ga0070673_100145146 | |||
| 907 | Ga0070673_100146664 | |||
| 908 | Ga0070659_100019292 | |||
| 909 | Ga0070667_100242062 | |||
| 910 | Ga0070703_10004280 | |||
| 911 | Ga0070709_10000961 | |||
| 912 | Ga0070709_10002694 | |||
| 913 | Ga0070709_10119210 | |||
| 914 | Ga0070714_100013846 | |||
| 915 | Ga0070711_100000042 | |||
| 916 | Ga0070711_100004639 | |||
| 917 | Ga0070705_100002218 | |||
| 918 | Ga0070705_100054283 | |||
| 919 | Ga0070705_100062832 | |||
| 920 | Ga0070705_100064377 | |||
| 921 | Ga0070694_100012511 | |||
| 922 | Ga0070694_100058655 | |||
| 923 | Ga0070694_100059773 | |||
| 924 | Ga0070694_100073102 | |||
| 925 | Ga0070694_100079917 | |||
| 926 | Ga0070694_100201254 | |||
| 927 | Ga0070708_100002721 | |||
| 928 | Ga0070708_100007399 | |||
| 929 | Ga0070708_100012615 | |||
| 930 | Ga0070708_100101052 | |||
| 931 | Ga0070663_100166477 | |||
| 932 | Ga0070678_100010192 | |||
| 933 | Ga0070678_100101513 | |||
| 934 | Ga0070662_100012673 | |||
| 935 | Ga0070681_10040737 | |||
| 936 | Ga0070681_10084492 | |||
| 937 | Ga0068867_100000105 | |||
| 938 | Ga0068867_100038567 | |||
| 939 | Ga0068867_100064912 | |||
| 940 | Ga0070706_100004195 | |||
| 941 | Ga0070706_100018895 | |||
| 942 | Ga0070706_100031700 | |||
| 943 | Ga0070706_100044665 | |||
| 944 | Ga0070706_100058297 | |||
| 945 | Ga0070706_100077352 | |||
| 946 | Ga0070707_100000424 | |||
| 947 | Ga0070707_100012132 | |||
| 948 | Ga0070707_100050316 | |||
| 949 | Ga0070707_100056206 | |||
| 950 | Ga0070707_100169318 | |||
| 951 | Ga0070707_100409915 | |||
| 952 | Ga0070698_100001017 | |||
| 953 | Ga0070698_100007200 | |||
| 954 | Ga0070698_100036570 | |||
| 955 | Ga0070698_100041965 | |||
| 956 | Ga0070698_100089610 | |||
| 957 | Ga0070698_100092091 | |||
| 958 | Ga0070698_100096235 | |||
| 959 | Ga0070699_100000214 | |||
| 960 | Ga0070699_100000323 | |||
| 961 | Ga0070699_100001300 | |||
| 962 | Ga0070699_100005410 | |||
| 963 | Ga0070699_100005704 | |||
| 964 | Ga0070699_100006606 | |||
| 965 | Ga0070699_100054949 | |||
| 966 | Ga0070699_100081319 | |||
| 967 | Ga0070699_100099817 | |||
| 968 | Ga0070699_100132089 | |||
| 969 | Ga0070679_100034282 | |||
| 970 | Ga0070679_100043973 | |||
| 971 | Ga0070679_100132311 | |||
| 972 | Ga0070684_100054255 | |||
| 973 | Ga0070684_100153434 | |||
| 974 | Ga0070684_100219972 | |||
| 975 | Ga0070697_100000978 | |||
| 976 | Ga0070697_100005606 | |||
| 977 | Ga0070697_100008921 | |||
| 978 | Ga0070697_100018428 | |||
| 979 | Ga0070697_100057993 | |||
| 980 | Ga0070697_100095318 | |||
| 981 | Ga0070697_100102639 | |||
| 982 | Ga0070697_100108894 | |||
| 983 | Ga0068853_100000379 | |||
| 984 | Ga0068853_100013999 | |||
| 985 | Ga0068853_100142862 | |||
| 986 | Ga0070672_100163950 | |||
| 987 | Ga0070686_100215635 | |||
| 988 | Ga0070695_100004478 | |||
| 989 | Ga0070695_100004986 | |||
| 990 | Ga0070695_100012708 | |||
| 991 | Ga0070695_100016650 | |||
| 992 | Ga0070695_100017339 | |||
| 993 | Ga0070695_100023116 | |||
| 994 | Ga0070695_100045700 | |||
| 995 | Ga0070696_100001570 | |||
| 996 | Ga0070696_100002058 | |||
| 997 | Ga0070696_100003170 | |||
| 998 | Ga0070696_100004043 | |||
| 999 | Ga0070696_100013474 | |||
| 1000 | Ga0070696_100198850 | |||
| 1001 | Ga0070704_100002951 | |||
| 1002 | Ga0070704_100004126 | |||
| 1003 | Ga0070704_100006978 | |||
| 1004 | Ga0070704_100088720 | |||
| 1005 | Ga0070704_100132699 | |||
| 1006 | Ga0070704_100258588 | |||
| 1007 | Ga0068855_100000173 | |||
| 1008 | Ga0068855_100046214 | |||
| 1009 | Ga0068855_100349972 | |||
| 1010 | Ga0070664_100009642 | |||
| 1011 | Ga0070664_100069393 | |||
| 1012 | Ga0070664_100088458 | |||
| 1013 | Ga0068857_100000037 | |||
| 1014 | Ga0068857_100014839 | |||
| 1015 | Ga0068854_100000155 | |||
| 1016 | Ga0068854_100011752 | |||
| 1017 | Ga0068856_100061326 | |||
| 1018 | Ga0068856_100189030 | |||
| 1019 | Ga0068852_100000060 | |||
| 1020 | Ga0068852_100007002 | |||
| 1021 | Ga0068852_100016276 | |||
| 1022 | Ga0068852_100101952 | |||
| 1023 | Ga0068852_100290956 | |||
| 1024 | Ga0068859_100014945 | |||
| 1025 | Ga0068859_100047934 | |||
| 1026 | Ga0068859_100316633 | |||
| 1027 | Ga0068864_100038559 | |||
| 1028 | Ga0068864_100120885 | |||
| 1029 | Ga0068864_100172242 | |||
| 1030 | Ga0068864_100172316 | |||
| 1031 | Ga0068866_10000089 | |||
| 1032 | Ga0068861_100022544 | |||
| 1033 | Ga0068861_100184845 | |||
| 1034 | Ga0068851_10051817 | |||
| 1035 | Ga0068851_10053311 | |||
| 1036 | Ga0068870_10022667 | |||
| 1037 | Ga0068863_100024078 | |||
| 1038 | Ga0068863_100346622 | |||
| 1039 | Ga0068858_100002910 | |||
| 1040 | Ga0068858_100182716 | |||
| 1041 | Ga0068862_100025988 | |||
| 1042 | Ga0081455_10021249 | |||
| 1043 | Ga0068871_100154425 | |||
| 1044 | Ga0075428_100032572 | |||
| 1045 | Ga0075428_100140034 | |||
| 1046 | Ga0075428_100151453 | |||
| 1047 | Ga0075428_100271391 | |||
| 1048 | Ga0075428_100285135 | |||
| 1049 | Ga0075430_100011922 | |||
| 1050 | Ga0075431_100013317 | |||
| 1051 | Ga0075431_100067740 | |||
| 1052 | Ga0075431_100141528 | |||
| 1053 | Ga0075431_100170418 | |||
| 1054 | Ga0075431_100221008 | |||
| 1055 | Ga0075433_10000417 | |||
| 1056 | Ga0075433_10032796 | |||
| 1057 | Ga0075433_10039292 | |||
| 1058 | Ga0075433_10063335 | |||
| 1059 | Ga0075433_10101883 | |||
| 1060 | Ga0075433_10156122 | |||
| 1061 | Ga0075434_100021972 | |||
| 1062 | Ga0075434_100024845 | |||
| 1063 | Ga0075434_100025785 | |||
| 1064 | Ga0075434_100030166 | |||
| 1065 | Ga0075434_100042605 | |||
| 1066 | Ga0075434_100350208 | |||
| 1067 | Ga0075429_100000245 | |||
| 1068 | Ga0075429_100026890 | |||
| 1069 | Ga0068865_100024985 | |||
| 1070 | Ga0068865_100041162 | |||
| 1071 | Ga0075436_100006278 | |||
| 1072 | Ga0075436_100012872 | |||
| 1073 | Ga0075436_100028747 | |||
| 1074 | Ga0075436_100150499 | |||
| 1075 | Ga0097620_100014945 | |||
| 1076 | Ga0097620_100047935 | |||
| 1077 | Ga0097620_100316601 | |||
| 1078 | Ga0075435_100030291 | |||
| 1079 | Ga0075435_100050811 | |||
| 1080 | Ga0099794_10000209 | |||
| 1081 | Ga0099794_10023753 | |||
| 1082 | Ga0105251_10065619 | |||
| 1083 | Ga0105244_10063488 | |||
| 1084 | Ga0105244_10090664 | |||
| 1085 | Ga0105244_10131485 | |||
| 1086 | Ga0105244_10137388 | |||
| 1087 | Ga0105250_10015525 | |||
| 1088 | Ga0105240_10001752 | |||
| 1089 | Ga0105240_10017002 | |||
| 1090 | Ga0105240_10206402 | |||
| 1091 | Ga0105240_10263024 | |||
| 1092 | Ga0111539_10065774 | |||
| 1093 | Ga0111539_10128706 | |||
| 1094 | Ga0111539_10151820 | |||
| 1095 | Ga0111539_10196392 | |||
| 1096 | Ga0105245_10008907 | |||
| 1097 | Ga0105245_10020091 | |||
| 1098 | Ga0105245_10195763 | |||
| 1099 | Ga0114129_10000842 | |||
| 1100 | Ga0114129_10058540 | |||
| 1101 | Ga0114129_10060174 | |||
| 1102 | Ga0114129_10060316 | |||
| 1103 | Ga0114129_10103781 | |||
| 1104 | Ga0114129_10116171 | |||
| 1105 | Ga0114129_10118161 | |||
| 1106 | Ga0114129_10162690 | |||
| 1107 | Ga0105241_10002544 | |||
| 1108 | Ga0105241_10003242 | |||
| 1109 | Ga0105248_10001920 | |||
| 1110 | Ga0105248_10357544 | |||
| 1111 | Ga0105237_10000038 | |||
| 1112 | Ga0105237_10000378 | |||
| 1113 | Ga0105237_10007764 | |||
| 1114 | Ga0105238_10003191 | |||
| 1115 | Ga0105249_10034132 | |||
| 1116 | Ga0105249_10169024 | |||
| 1117 | Ga0105239_10000108 | |||
| 1118 | Ga0105239_10000232 | |||
| 1119 | Ga0105239_10033598 | |||
| 1120 | Ga0105239_10035885 | |||
| 1121 | Ga0105239_10106815 | |||
| 1122 | Ga0105239_10265918 | |||
| 1123 | Ga0105246_10025986 | |||
| 1124 | Ga0157373_10013102 | |||
| 1125 | Ga0157371_10000011 | |||
| 1126 | Ga0157371_10012401 | |||
| 1127 | Ga0157371_10026023 | |||
| 1128 | Ga0157371_10104704 | |||
| 1129 | Ga0157370_10001010 | |||
| 1130 | Ga0157369_10019197 | |||
| 1131 | Ga0157369_10062381 | |||
| 1132 | Ga0171463_1009 | |||
| 1133 | Ga0157378_10001196 | |||
| 1134 | Ga0163162_10021040 | |||
| 1135 | Ga0163162_10033518 | |||
| 1136 | Ga0163162_10238539 | |||
| 1137 | Ga0163162_10583199 | |||
| 1138 | Ga0157372_10003085 | |||
| 1139 | Ga0157372_10043260 | |||
| 1140 | Ga0157372_10094480 | |||
| 1141 | Ga0157372_10258575 | |||
| 1142 | Ga0157375_10011591 | |||
| 1143 | Ga0157375_10035997 | |||
| 1144 | Ga0157375_10180905 | |||
| 1145 | Ga0157375_10335493 | |||
| 1146 | Ga0157375_10623542 | |||
| 1147 | Ga0163163_10064971 | |||
| 1148 | Ga0157377_10014060 | |||
| 1149 | Ga0157379_10022316 | |||
| 1150 | Ga0157379_10076534 | |||
| 1151 | Ga0157376_10345516 | |||
| 1152 | Ga0183363_1132 | |||
| 1153 | Ga0163161_10048311 | |||
| 1154 | Ga0213874_10022602 | |||
| 1155 | Ga0213875_10003417 | |||
| 1156 | Ga0209435_100033 | |||
| 1157 | Ga0209147_100182 | |||
| 1158 | Ga0209147_102454 | |||
| 1159 | Ga0209437_100326 | |||
| 1160 | Ga0209437_100653 | |||
| 1161 | Ga0209646_1000116 | |||
| 1162 | Ga0209026_1000103 | |||
| 1163 | Ga0209759_1000105 | |||
| 1164 | Ga0209233_1000505 | |||
| 1165 | Ga0209130_1001456 | |||
| 1166 | Ga0209130_1002177 | |||
| 1167 | Ga0209130_1002890 | |||
| 1168 | Ga0209130_1015391 | |||
| 1169 | Ga0209130_1018617 | |||
| 1170 | Ga0209676_1000082 | |||
| 1171 | Ga0209676_1000204 | |||
| 1172 | Ga0209676_1003265 | |||
| 1173 | Ga0209025_1000127 | |||
| 1174 | Ga0209025_1000302 | |||
| 1175 | Ga0209025_1001914 | |||
| 1176 | Ga0209025_1002745 | |||
| 1177 | Ga0209025_1002785 | |||
| 1178 | Ga0209025_1003039 | |||
| 1179 | Ga0209025_1004968 | |||
| 1180 | Ga0209025_1011227 | |||
| 1181 | Ga0209025_1011903 | |||
| 1182 | Ga0209025_1012611 | |||
| 1183 | Ga0209025_1016191 | |||
| 1184 | Ga0209025_1025518 | |||
| 1185 | Ga0209257_1000218 | |||
| 1186 | Ga0209257_1030103 | |||
| 1187 | Ga0207697_10035643 | |||
| 1188 | Ga0207696_1004839 | |||
| 1189 | Ga0207655_1005330 | |||
| 1190 | Ga0207713_1028977 | |||
| 1191 | Ga0207653_10000273 | |||
| 1192 | Ga0207682_10007409 | |||
| 1193 | Ga0207642_10000046 | |||
| 1194 | Ga0207642_10084847 | |||
| 1195 | Ga0207647_10021374 | |||
| 1196 | Ga0207699_10002055 | |||
| 1197 | Ga0207699_10014531 | |||
| 1198 | Ga0207645_10000126 | |||
| 1199 | Ga0207645_10000968 | |||
| 1200 | Ga0207643_10007769 | |||
| 1201 | Ga0207705_10000138 | |||
| 1202 | Ga0207705_10019433 | |||
| 1203 | Ga0207705_10051675 | |||
| 1204 | Ga0207684_10009386 | |||
| 1205 | Ga0207684_10021137 | |||
| 1206 | Ga0207684_10035113 | |||
| 1207 | Ga0207684_10045424 | |||
| 1208 | Ga0207684_10079113 | |||
| 1209 | Ga0207707_10015158 | |||
| 1210 | Ga0207707_10170807 | |||
| 1211 | Ga0207695_10008932 | |||
| 1212 | Ga0207671_10000045 | |||
| 1213 | Ga0207671_10000222 | |||
| 1214 | Ga0207663_10000029 | |||
| 1215 | Ga0207663_10021704 | |||
| 1216 | Ga0207660_10019170 | |||
| 1217 | Ga0207662_10002952 | |||
| 1218 | Ga0207657_10027762 | |||
| 1219 | Ga0207657_10030969 | |||
| 1220 | Ga0207649_10033575 | |||
| 1221 | Ga0207652_10015401 | |||
| 1222 | Ga0207652_10038090 | |||
| 1223 | Ga0207652_10211736 | |||
| 1224 | Ga0207646_10001346 | |||
| 1225 | Ga0207646_10020973 | |||
| 1226 | Ga0207646_10029267 | |||
| 1227 | Ga0207646_10031254 | |||
| 1228 | Ga0207646_10049773 | |||
| 1229 | Ga0207646_10057511 | |||
| 1230 | Ga0207646_10063943 | |||
| 1231 | Ga0207646_10107380 | |||
| 1232 | Ga0207646_10189008 | |||
| 1233 | Ga0207694_10002617 | |||
| 1234 | Ga0207659_10057311 | |||
| 1235 | Ga0207659_10242520 | |||
| 1236 | Ga0207659_10243729 | |||
| 1237 | Ga0207687_10010124 | |||
| 1238 | Ga0207700_10125781 | |||
| 1239 | Ga0207706_10000067 | |||
| 1240 | Ga0207706_10020426 | |||
| 1241 | Ga0207686_10000926 | |||
| 1242 | Ga0207709_10005169 | |||
| 1243 | Ga0207669_10000915 | |||
| 1244 | Ga0207704_10001622 | |||
| 1245 | Ga0207665_10003174 | |||
| 1246 | Ga0207691_10005018 | |||
| 1247 | Ga0207691_10074534 | |||
| 1248 | Ga0207691_10109142 | |||
| 1249 | Ga0207711_10021889 | |||
| 1250 | Ga0207689_10000496 | |||
| 1251 | Ga0207661_10114809 | |||
| 1252 | Ga0207667_10000001 | |||
| 1253 | Ga0207667_10049122 | |||
| 1254 | Ga0207667_10186519 | |||
| 1255 | Ga0207667_10325125 | |||
| 1256 | Ga0207651_10025143 | |||
| 1257 | Ga0207712_10018700 | |||
| 1258 | Ga0207712_10150951 | |||
| 1259 | Ga0207668_10013775 | |||
| 1260 | Ga0207668_10026314 | |||
| 1261 | Ga0207640_10000041 | |||
| 1262 | Ga0207640_10002337 | |||
| 1263 | Ga0207703_10002168 | |||
| 1264 | Ga0207703_10090185 | |||
| 1265 | Ga0207703_10168729 | |||
| 1266 | Ga0207639_10000081 | |||
| 1267 | Ga0207678_10027682 | |||
| 1268 | Ga0207678_10072497 | |||
| 1269 | Ga0207708_10019351 | |||
| 1270 | Ga0207702_10036451 | |||
| 1271 | Ga0207648_10000029 | |||
| 1272 | Ga0207648_10007822 | |||
| 1273 | Ga0207648_10046939 | |||
| 1274 | Ga0207648_10050641 | |||
| 1275 | Ga0207676_10027570 | |||
| 1276 | Ga0207676_10100109 | |||
| 1277 | Ga0207676_10138678 | |||
| 1278 | Ga0207676_10286766 | |||
| 1279 | Ga0207674_10001824 | |||
| 1280 | Ga0207674_10002595 | |||
| 1281 | Ga0207674_10043177 | |||
| 1282 | Ga0207675_100000705 | |||
| 1283 | Ga0207675_100044971 | |||
| 1284 | Ga0207675_100115978 | |||
| 1285 | Ga0207675_100146479 | |||
| 1286 | Ga0207698_10000054 | |||
| 1287 | Ga0207698_10052453 | |||
| 1288 | Ga0209588_1001809 | |||
| 1289 | Ga0209588_1007883 | |||
| 1290 | Ga0207428_10057593 | |||
| 1291 | Ga0207428_10095113 | |||
| 1292 | Ga0268266_10051937 | |||
| 1293 | Ga0268266_10090203 | |||
| 1294 | Ga0268266_10349850 | |||
| 1295 | Ga0268265_10048044 | |||
| 1296 | Ga0268264_10008943 | |||
| 1297 | Ga0237817_10191 | |||
| 1298 | Ga0237817_10591 | |||
| 1299 | Ga0316176_1009536 | |||
| 1300 | Ga0316183_1210370 | |||
| 1301 | Ga0316181_1088391 | |||
| 1302 | Ga0265330_10018389 | |||
| 1303 | Ga0307408_100039830 | |||
| 1304 | Ga0307408_100058864 | |||
| 1305 | Ga0307508_10000550 | |||
| 1306 | Ga0316576_10024785 | |||
| 1307 | Ga0316576_10035664 | |||
| 1308 | Ga0307405_10087934 | |||
| 1309 | Ga0307405_10199129 | |||
| 1310 | Ga0307413_10005211 | |||
| 1311 | Ga0307413_10014354 | |||
| 1312 | Ga0307413_10026492 | |||
| 1313 | Ga0307413_10112056 | |||
| 1314 | Ga0307413_10112772 | |||
| 1315 | Ga0307410_10014618 | |||
| 1316 | Ga0307410_10021932 | |||
| 1317 | Ga0307410_10022398 | |||
| 1318 | Ga0307410_10022442 | |||
| 1319 | Ga0307410_10044409 | |||
| 1320 | Ga0307410_10067404 | |||
| 1321 | Ga0307406_10001468 | |||
| 1322 | Ga0307406_10013208 | |||
| 1323 | Ga0307406_10026492 | |||
| 1324 | Ga0307406_10076334 | |||
| 1325 | Ga0307407_10006903 | |||
| 1326 | Ga0307407_10010318 | |||
| 1327 | Ga0307407_10016873 | |||
| 1328 | Ga0307407_10077520 | |||
| 1329 | Ga0307412_10006035 | |||
| 1330 | Ga0307412_10077175 | |||
| 1331 | Ga0307412_10147550 | |||
| 1332 | Ga0307409_100000305 | |||
| 1333 | Ga0307409_100005174 | |||
| 1334 | Ga0307409_100008138 | |||
| 1335 | Ga0307409_100019112 | |||
| 1336 | Ga0307409_100044882 | |||
| 1337 | Ga0307409_100052330 | |||
| 1338 | Ga0307409_100102136 | |||
| 1339 | Ga0307409_100421884 | |||
| 1340 | Ga0307416_100002315 | |||
| 1341 | Ga0307416_100008496 | |||
| 1342 | Ga0307416_100034245 | |||
| 1343 | Ga0307416_100068670 | |||
| 1344 | Ga0307416_100078774 | |||
| 1345 | Ga0307414_10018967 | |||
| 1346 | Ga0307414_10029882 | |||
| 1347 | Ga0307414_10035462 | |||
| 1348 | Ga0307414_10039357 | |||
| 1349 | Ga0307414_10044072 | |||
| 1350 | Ga0307411_10003366 | |||
| 1351 | Ga0307411_10007492 | |||
| 1352 | Ga0307411_10010346 | |||
| 1353 | Ga0307411_10029362 | |||
| 1354 | Ga0307411_10078454 | |||
| 1355 | Ga0307411_10085752 | |||
| 1356 | Ga0307415_100002405 | |||
| 1357 | Ga0307415_100074973 | |||
| 1358 | Ga0307415_100095485 | |||
| 1359 | Ga0307510_10053028 | |||
| 1360 | Ga0373926_0011029 | |||
| 1361 | Ga0373945_0010236 | |||
| 1362 | Ga0373946_0030230 | |||
| 1363 | Ga0373931_0028763 | |||
| 1364 | Ga0373931_0037595 | |||
| 1365 | Ga0373935_0007556 | |||
| 1366 | Ga0373927_0002150 | |||
| 1367 | Ga0373927_0002540 | |||
| 1368 | Ga0373947_0022427 | |||
| 1369 | Ga0373937_0078114 | |||
| 1370 | Ga0373925_0000150 | |||
| 1371 | Ga0373925_0000268 | |||
| 1372 | Ga0395899_0040966 | |||
| 1373 | Ga0395900_0088212 | |||
| 1374 | Ga0395898_0053878 | |||
| 1375 | Ga0395905_0000453 | |||
| 1376 | Ga0395905_0103433 | |||
| 1377 | Ga0436364_0237168 | |||
| 1378 | Ga0436364_0258311 | |||
| 1379 | Ga0436364_0900741 | |||
| 1380 | Ga0395901_0178824 | |||
| 1381 | Ga0237819_00335 | |||
| 1382 | Ga0237819_00340 | |||
| 1383 | Ga0436365_0305623 | |||
| 1384 | Ga0436360_0992964 | |||
| 1385 | Ga0436363_0497395 | |||
| 1386 | Ga0436363_1258012 | |||
| 1387 | Ga0451833_0349530 | |||
| 1388 | Ga0451837_0409557 | |||
| 1389 | Ga0451849_0549757 | |||
| 1390 | Ga0451843_0348774 | |||
| 1391 | Ga0451855_1464677 | |||
| 1392 | Ga0450910_006064 | |||
| 1393 | Ga0439435_0052317 | |||
| 1394 | Ga0451577_0024930 | |||
| 1395 | Ga0451577_0029778 | |||
| 1396 | Ga0451577_0125839 | |||
| 1397 | Ga0451577_0277939 | |||
| 1398 | Ga0451577_0427025 | |||
| 1399 | Ga0453683_0017887 | |||
| 1400 | Ga0453683_0023779 | |||
| 1401 | Ga0453683_0196082 | |||
| 1402 | Ga0466963_0083659 | |||
| 1403 | Ga0453684_0055788 | |||
| 1404 | Ga0453684_0129600 | |||
| 1405 | Ga0453684_0200586 | |||
| 1406 | Ga0466970_0000677 | |||
| 1407 | Ga0466957_0002447 | |||
| 1408 | Ga0466959_0015455 | |||
| 1409 | Ga0451576_0003765 | |||
| 1410 | Ga0451576_0006877 | |||
| 1411 | Ga0451576_0031330 | |||
| 1412 | Ga0451576_0060358 | |||
| 1413 | Ga0451576_0086250 | |||
| 1414 | Ga0451576_0113754 | |||
| 1415 | Ga0451576_0124593 | |||
| 1416 | Ga0451576_0228913 | |||
| 1417 | Ga0466958_0042350 | |||
| 1418 | Ga0466967_0000146 | |||
| 1419 | Ga0466967_0018043 | |||
| 1420 | Ga0466967_0034628 | |||
| 1421 | Ga0495603_0027760 | |||
| 1422 | Ga0495591_026314 | |||
| 1423 | Ga0495580_0014204 | |||
| 1424 | Ga0495662_0051620 | |||
| 1425 | Ga0495585_0105296 | |||
| 1426 | Ga0495594_0003876 | |||
| 1427 | Ga0495594_0026725 | |||
| 1428 | Ga0495618_0003625 | |||
| 1429 | Ga0495630_0009445 | |||
| 1430 | Ga0495630_0096123 | |||
| 1431 | Ga0495643_0028028 | |||
| 1432 | Ga0495666_0002314 | |||
| 1433 | Ga0495652_0228888 | |||
| 1434 | Ga0495665_0066580 | |||
| 1435 | Ga0495640_0040386 | |||
| 1436 | Ga0495586_0018993 | |||
| 1437 | Ga0495598_0034937 | |||
| 1438 | Ga0495667_0005248 | |||
| 1439 | Ga0495634_0001475 | |||
| 1440 | Ga0495659_0033531 | |||
| 1441 | Ga0495659_0080591 | |||
| 1442 | Ga0495588_0123207 | |||
| 1443 | Ga0495647_0074756 | |||
| 1444 | Ga0495658_0001709 | |||
| 1445 | Ga0495658_0013808 | |||
| 1446 | Ga0495613_0027031 | |||
| 1447 | Ga0495649_0006214 | |||
| 1448 | Ga0495649_0014081 | |||
| 1449 | Ga0495581_0058289 | |||
| 1450 | Ga0495674_0011641 | |||
| 1451 | Ga0495680_0025218 | |||
| 1452 | Ga0495687_020690 | |||
| 1453 | Ga0495677_0013846 | |||
| 1454 | Ga0496102_0020693 | |||
| 1455 | Ga0496102_0021351 | |||
| 1456 | Ga0496102_0054342 | |||
| 1457 | Ga0496102_0095754 | |||
| 1458 | Ga0496103_0007312 | |||
| 1459 | Ga0496103_0035619 | |||
| 1460 | Ga0496103_0064948 | |||
| 1461 | Ga0496103_0116570 | |||
| 1462 | Ga0496104_0003802 | |||
| 1463 | Ga0496104_0004616 | |||
| 1464 | Ga0496104_0014933 | |||
| 1465 | Ga0496104_0096589 | |||
| 1466 | Ga0496105_0192080 | |||
| 1467 | Ga0496106_0021979 | |||
| 1468 | Ga0496106_0023264 | |||
| 1469 | Ga0496106_0047740 | |||
| 1470 | Ga0496106_0095036 | |||
| 1471 | Ga0496106_0241820 | |||
| 1472 | Ga0496107_0035246 | |||
| 1473 | Ga0496107_0059878 | |||
| 1474 | Ga0496108_0004865 | |||
| 1475 | Ga0496108_0006258 | |||
| 1476 | Ga0496108_0009641 | |||
| 1477 | Ga0496108_0022545 | |||
| 1478 | Ga0496108_0211861 | |||
| 1479 | Ga0496108_0217530 | |||
| 1480 | Ga0496109_0002167 | |||
| 1481 | Ga0496109_0002280 | |||
| 1482 | Ga0496109_0003937 | |||
| 1483 | Ga0496109_0017339 | |||
| 1484 | Ga0496110_0003069 | |||
| 1485 | Ga0496110_0012273 | |||
| 1486 | Ga0496110_0023097 | |||
| 1487 | Ga0496110_0059251 | |||
| 1488 | Ga0496110_0191076 | |||
| 1489 | Ga0496111_0009724 | |||
| 1490 | Ga0496111_0012689 | |||
| 1491 | Ga0496111_0049631 | |||
| 1492 | Ga0496111_0226806 | |||
| 1493 | Ga0496112_0002069 | |||
| 1494 | Ga0496112_0025309 | |||
| 1495 | Ga0496112_0031210 | |||
| 1496 | Ga0496113_0003196 | |||
| 1497 | Ga0496113_0004350 | |||
| 1498 | Ga0496113_0004994 | |||
| 1499 | Ga0496113_0006677 | |||
| 1500 | Ga0496114_0010649 | |||
| 1501 | Ga0496114_0439278 | |||
| 1502 | Ga0496117_0000079 | |||
| 1503 | Ga0496117_0000097 | |||
| 1504 | Ga0496117_0000674 | |||
| 1505 | Ga0496117_0091513 | |||
| 1506 | Ga0496118_0001442 | |||
| 1507 | Ga0496118_0042439 | |||
| 1508 | Ga0496119_0000014 | |||
| 1509 | Ga0496119_0011561 | |||
| 1510 | Ga0496119_0016560 | |||
| 1511 | Ga0496119_0144766 | |||
| 1512 | Ga0496120_0000007 | |||
| 1513 | Ga0496120_0000023 | |||
| 1514 | Ga0496120_0002654 | |||
| 1515 | Ga0496120_0003381 | |||
| 1516 | Ga0496120_0003806 | |||
| 1517 | Ga0496121_0000991 | |||
| 1518 | Ga0496121_0043568 | |||
| 1519 | Ga0496122_0000014 | |||
| 1520 | Ga0496122_0000519 | |||
| 1521 | Ga0496122_0010559 | |||
| 1522 | Ga0496122_0043782 | |||
| 1523 | Ga0496123_0000070 | |||
| 1524 | Ga0496123_0015348 | |||
| 1525 | Ga0496123_0128641 | |||
| 1526 | Ga0496124_0035918 | |||
| 1527 | Ga0496125_0000067 | |||
| 1528 | Ga0496125_0002559 | |||
| 1529 | Ga0496125_0004812 | |||
| 1530 | Ga0496126_0000019 | |||
| 1531 | Ga0496126_0000561 | |||
| 1532 | Ga0496126_0077554 | |||
| 1533 | Ga0496126_0131680 | |||
| 1534 | Ga0501031_0056119 | |||
| 1535 | Ga0501031_0110505 | |||
| 1536 | Ga0501032_0007269 | |||
| 1537 | Ga0501033_0118986 | |||
| 1538 | Ga0501034_0000793 | |||
| 1539 | Ga0501034_0020212 | |||
| 1540 | Ga0501036_0026577 | |||
| 1541 | Ga0501036_0056221 | |||
| 1542 | Ga0501038_0016904 | |||
| 1543 | Ga0501038_0187549 | |||
| 1544 | Ga0501040_0044840 | |||
| 1545 | Ga0501040_0082112 | |||
| 1546 | Ga0501041_0006622 | |||
| 1547 | Ga0501043_0003405 | |||
| 1548 | Ga0501046_0024536 | |||
| 1549 | Ga0501047_0000165 | |||
| 1550 | Ga0501047_0007477 | |||
| 1551 | Ga0501047_0046909 | |||
| 1552 | Ga0501048_0045789 | |||
| 1553 | Ga0501048_0180019 | |||
| 1554 | Ga0501067_0001485 | |||
| 1555 | Ga0501067_0029439 | |||
| 1556 | Ga0501067_0029606 | |||
| 1557 | Ga0501068_0000902 | |||
| 1558 | Ga0501068_0003937 | |||
| 1559 | Ga0501069_0002046 | |||
| 1560 | Ga0501069_0007688 | |||
| 1561 | Ga0501070_0000708 | |||
| 1562 | Ga0501070_0005056 | |||
| 1563 | Ga0501070_0022328 | |||
| 1564 | Ga0501070_0146809 | |||
| 1565 | Ga0501071_0000053 | |||
| 1566 | Ga0501071_0007112 | |||
| 1567 | Ga0501071_0010368 | |||
| 1568 | Ga0501071_0068870 | |||
| 1569 | Ga0501072_0000477 | |||
| 1570 | Ga0501072_0025798 | |||
| 1571 | Ga0501072_0051285 | |||
| 1572 | Ga0501072_0072273 | |||
| 1573 | Ga0501073_0133931 | |||
| 1574 | Ga0501073_0204718 | |||
| 1575 | Ga0501074_0000287 | |||
| 1576 | Ga0501074_0029665 | |||
| 1577 | Ga0501074_0040619 | |||
| 1578 | Ga0501075_0026030 | |||
| 1579 | Ga0501075_0089112 | |||
| 1580 | Ga0501076_0036704 | |||
| 1581 | Ga0501076_0043197 | |||
| 1582 | Ga0501076_0158570 | |||
| 1583 | Ga0501077_0001658 | |||
| 1584 | Ga0501077_0010477 | |||
| 1585 | Ga0501223_000962 | |||
| 1586 | Ga0501239_005811 | |||
| 1587 | Ga0501247_002251 | |||
| 1588 | Ga0501079_0015844 | |||
| 1589 | Ga0501079_0025436 | |||
| 1590 | Ga0501079_0037199 | |||
| 1591 | Ga0501079_0059559 | |||
| 1592 | Ga0501080_0007037 | |||
| 1593 | Ga0501080_0018485 | |||
| 1594 | Ga0501080_0297271 | |||
| 1595 | Ga0501081_0012929 | |||
| 1596 | Ga0501081_0063193 | |||
| 1597 | Ga0501083_0000635 | |||
| 1598 | Ga0501083_0003729 | |||
| 1599 | Ga0501083_0005487 | |||
| 1600 | Ga0501083_0042228 | |||
| 1601 | Ga0501083_0198353 | |||
| 1602 | Ga0501263_002151 | |||
| 1603 | Ga0501266_014045 | |||
| 1604 | Ga0501268_001463 | |||
| 1605 | Ga0501272_001851 | |||
| 1606 | Ga0501044_0009183 | |||
| 1607 | Ga0501044_0369473 | |||
| 1608 | Ga0501045_0033215 | |||
| 1609 | nmdc:mga05p37_167942_c1 | |||
| 1610 | nmdc:mga05p37_28873_c1 | |||
| 1611 | nmdc:mga05p37_3225_c1 | |||
| 1612 | nmdc:mga05p37_32381_c1 | |||
| 1613 | nmdc:mga05p37_58464_c2 | |||
| 1614 | nmdc:mga09592_55427_c1 | |||
| 1615 | nmdc:mga06r32_19003_c1 | |||
| 1616 | nmdc:mga06r32_257796_c1 | |||
| 1617 | nmdc:mga06r32_53757_c1 | |||
| 1618 | nmdc:mga08y16_102425_c1 | |||
| 1619 | nmdc:mga08y16_112719_c1 | |||
| 1620 | nmdc:mga08y16_61539_c1 | |||
| 1621 | nmdc:mga08y16_87545_c1 | |||
| 1622 | nmdc:mga0n895_123962_c1 | |||
| 1623 | nmdc:mga0n895_16061_c1 | |||
| 1624 | nmdc:mga0n895_17816_c1 | |||
| 1625 | nmdc:mga0n895_3385_c1 | |||
| 1626 | nmdc:mga0n895_456381_c1 | |||
| 1627 | nmdc:mga0n895_5093_c1 | |||
| 1628 | nmdc:mga0n895_62622_c1 | |||
| 1629 | nmdc:mga0rr50_229819_c1 | |||
| 1630 | nmdc:mga0rr50_34029_c1 | |||
| 1631 | nmdc:mga0rr50_6617_c1 | |||
| 1632 | nmdc:mga08x19_1003_c1 | |||
| 1633 | nmdc:mga08x19_11657_c2 | |||
| 1634 | nmdc:mga08x19_182152_c1 | |||
| 1635 | nmdc:mga08x19_37585_c1 | |||
| 1636 | nmdc:mga08x19_9500_c1 | |||
| 1637 | nmdc:mga0a205_17119_c1 | |||
| 1638 | nmdc:mga0a205_44190_c1 | |||
| 1639 | nmdc:mga0a205_69_c1 | |||
| 1640 | Ga0500643_000361 | |||
| 1641 | Ga0500651_0001925 | |||
| 1642 | Ga0500559_0017308 | |||
| 1643 | Ga0500559_0052949 | |||
| 1644 | Ga0501084_0000720 | |||
| 1645 | Ga0501084_0008307 | |||
| 1646 | Ga0501084_0020155 | |||
| 1647 | Ga0590071_002672 | |||
| 1648 | Ga0590075_004265 | |||
| 1649 | Ga0590077_005469 | |||
| 1650 | Ga0590077_005555 | |||
| 1651 | Ga0501082_0001411 | |||
| 1652 | Ga0501082_0048511 | |||
| 1653 | Ga0501082_0055378 | |||
| 1654 | Ga0501082_0093748 | |||
| 1655 | Ga0501082_0146981 | |||
| 1656 | Ga0501082_0303872 | |||
| 1657 | Ga0530510_0031082 | |||
| 1658 | 2524461619 | |||
| 1659 | 2553393246 | |||
| 1660 | 2585328886 | |||
| 1661 | 2595089321 | |||
| 1662 | 2616309792 | |||
| 1663 | 2643737953 | |||
| 1664 | 2644000621 | |||
| 1665 | 2644048710 | |||
| 1666 | 2644201962 | |||
| 1667 | 2644352648 | |||
| 1668 | 2644481512 | |||
| 1669 | 2644550400 | |||
| 1670 | 2644707997 | |||
| 1671 | 2644714726 | |||
| 1672 | 2685152343 | |||
| 1673 | 2698320815 | |||
| 1674 | 2705996280 | |||
| 1675 | 2721507502 | |||
| 1676 | 2739157861 | |||
| 1677 | 2739209980 | |||
| 1678 | 2739268434 | |||
| 1679 | 2757565091 | |||
| 1680 | 2777763952 | |||
| 1681 | 2777838408 | |||
| 1682 | 2819583114 | |||
| 1683 | 2831905229 | |||
| 1684 | 2842303199 | |||
| 1685 | 2842361489 | |||
| 1686 | 2842513648 | |||
| 1687 | 2842907625 | |||
| 1688 | 2857588460 | |||
| 1689 | 2881648396 | |||
| 1690 | 2884794110 | |||
| 1691 | 2889046912 | |||
| 1692 | 2904493816 | |||
| 1693 | 2911141048 | |||
| 1694 | 2916973980 | |||
| 1695 | 2919162895 | |||
| 1696 | 2929238047 | |||
| 1697 | 2931390359 | |||
| 1698 | 2936343470 | |||
| 1699 | 2938922236 | |||
| 1700 | 2939617455 | |||
| 1701 | 2945997417 | |||
| 1702 | 2946053627 | |||
| 1703 | 2947431131 | |||
| 1704 | 2956901638 | |||
| 1705 | 2965765497 | |||
| 1706 | 2977242890 | |||
| 1707 | 2979088035 | |||
| 1708 | 3001272026 | |||
| 1709 | 3006977608 | |||
| 1710 | 3006988406 | |||
| 1711 | 8007376074 | |||
| 1712 | 8007378135 | |||
| 1713 | 8022796969 | |||
| 1714 | 8023443954 | |||
| 1715 | 8023445241 | |||
| 1716 | 8057586799 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ld9-assembly1.cif.gz_A | crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. oryzae in complex with cystathionine | 0.9701 | 3 | 371 |
| 6ld8-assembly1.cif.gz_B | crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. oryzae in complex with aminoacrylate and cysteine | 0.9653 | 3 | 371 |
| 8biv-assembly1.cif.gz_A | cystathionine gamma-lyase n360s mutant from toxoplasma gondii | 0.9591 | 2 | 366 |
| 1cs1-assembly1.cif.gz_D | cystathionine gamma-synthase (cgs) from escherichia coli | 0.9578 | 5 | 367 |
| 8bis-assembly1.cif.gz_A-2 | crystal structure of cystathionine gamma-lyase from toxoplasma gondii in complex with dl-propargylglycine | 0.9574 | 2 | 366 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2nmpB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9894 | 234 | 367 | 3.90.1150.10 |
| 3ri6B02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9748 | 235 | 364 | 3.90.1150.10 |
| af_P32929_263_402_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9738 | 234 | 371 | 3.90.1150.10 |
| af_O13326_295_429_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9701 | 235 | 366 | 3.90.1150.10 |
| 3ndnB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9681 | 234 | 364 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1RXG6-F1-model_v4 | PLP-dependent transferase | 0.9901 | 191 | 367 |
GO:0003962
GO:0004123 GO:0005737 GO:0019343 GO:0019346 GO:0030170 |
| AF-T0JSG8-F1-model_v4 | cystathionine gamma-lyase (EC 4.4.1.1) (Gamma-cystathionase) | 0.9898 | 152 | 288 |
GO:0003962
GO:0004123 GO:0005737 GO:0019343 GO:0019346 GO:0030170 |
| AF-A0A087TV62-F1-model_v4 | cystathionine gamma-lyase (EC 4.4.1.1) (Gamma-cystathionase) | 0.9891 | 155 | 325 |
GO:0004123
GO:0005737 GO:0019343 GO:0019346 GO:0030170 GO:0044540 GO:0080146 |
| AF-T0UTK1-F1-model_v4 | deleted | 0.9885 | 155 | 364 |
|
| AF-A0A6L4ZQW3-F1-model_v4 | Cystathionine gamma-synthase | 0.9875 | 174 | 364 |
GO:0005737
GO:0016846 GO:0019346 GO:0030170 |