F483758

General Info

Members Datasets Scaffolds Average Seq Length
858 666 1716 193

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0018858|Ga0500568_0018858_1056_1736
Length 226
Sequence MGHDADHHHLHHGADAAGAEAQHFHRGGKREVTAVEGAARSRHQIFWFSACLAVLVAQIVIEYLLGRVPICTCGYVKLWEGSVNSSGNSQHLSDWYTPSHIIHGFLFYGLAHLVLRGKPLAMKLLLAVLIESGWELLENSPLIIDRYRTATISLDYYGDSIINSAMDTTFMAVGFFFAWRAPVALTVAIAIFFELFTGYVIRDNLTLNVLMLIWPVEAIKVWQGGV

Samples

Sample ID Description Type Environment
1 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
83 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
84 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
152 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
153 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
154 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
155 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
203 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
239 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
240 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
241 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
242 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
243 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
244 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
248 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
253 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
254 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
257 2509276019 Ensifer aridi TW10 Isolate Nodule
258 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
259 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
260 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
261 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
262 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
263 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
264 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
265 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
266 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
267 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
268 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
269 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
270 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
271 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
272 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
273 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
274 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
275 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
276 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
277 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
278 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
279 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
280 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
281 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
282 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
283 2516143018 Ensifer sp. BR816 Isolate Nodule
284 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
285 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
286 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
287 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
288 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
289 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
290 2519899620 Rhizobium sp. Pop5 Isolate Nodule
291 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
292 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
293 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
294 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
295 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
296 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
297 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
298 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
299 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
300 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
301 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
302 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
303 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
304 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
305 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
306 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
307 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
308 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
309 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
310 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
311 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
312 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
313 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
314 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
315 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
316 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
317 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
318 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
319 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
320 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
321 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
322 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
323 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
324 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
325 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
326 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
327 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
328 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
329 2643221557 Ensifer sp. Root558 Isolate Unclassified
330 2643221599 Rhizobium sp. Root708 Isolate Unclassified
331 2643221610 Ensifer sp. Root74 Isolate Unclassified
332 2643221618 Ensifer sp. Root231 Isolate Unclassified
333 2643221626 Ensifer sp. Root31 Isolate Unclassified
334 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
335 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
336 2643221655 Ensifer sp. Root1252 Isolate Unclassified
337 2643221659 Ensifer sp. Root127 Isolate Unclassified
338 2643221668 Ensifer sp. Root423 Isolate Unclassified
339 2643221675 Ensifer sp. Root1298 Isolate Unclassified
340 2643221680 Ensifer sp. Root1312 Isolate Unclassified
341 2643221698 Ensifer sp. Root142 Isolate Unclassified
342 2643221712 Ensifer sp. Root258 Isolate Unclassified
343 2643221723 Ensifer sp. Root278 Isolate Unclassified
344 2643221726 Ensifer sp. Root954 Isolate Unclassified
345 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
346 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
347 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
348 2718217882 Rhizobium sp. N741 Isolate Nodule
349 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
350 2718218009 Rhizobium sp. N561 Isolate Nodule
351 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
352 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
353 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
354 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
355 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
356 2718218363 Rhizobium sp. N113 Isolate Nodule
357 2718218365 Rhizobium sp. N731 Isolate Nodule
358 2718218366 Rhizobium sp. N621 Isolate Nodule
359 2721755514 Rhizobium sp. N6212 Isolate Nodule
360 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
361 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
362 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
363 2721755810 Rhizobium sp. N871 Isolate Nodule
364 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
365 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
366 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
367 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
368 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
369 2728369365 Rhizobium sp. N1341 Isolate Nodule
370 2728369397 Rhizobium sp. N1314 Isolate Nodule
371 2738541293 Rhizobium sp. GV031 Isolate Unclassified
372 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
373 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
374 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
375 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
376 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
377 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
378 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
379 2791355256 Rhizobium sp. M10 Isolate Nodule
380 2791355260 Rhizobium sp. L9 Isolate Nodule
381 2791355261 Rhizobium sp. J15 Isolate Nodule
382 2791355262 Rhizobium sp. M1 Isolate Nodule
383 2791355264 Rhizobium sp. S9 Isolate Nodule
384 2791355265 Rhizobium sp. H4 Isolate Nodule
385 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
386 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
387 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
388 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
389 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
390 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
391 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
392 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
393 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
394 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
395 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
396 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
397 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
398 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
399 2838048938 Rhizobium pisi 27/80 Isolate Nodule
400 2838061910 Rhizobium phaseoli L15 Isolate Nodule
401 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
402 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
403 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
404 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
405 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
406 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
407 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
408 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
409 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
410 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
411 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
412 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
413 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
414 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
415 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
416 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
417 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
418 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
419 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
420 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
421 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
422 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
423 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
424 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
425 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
426 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
427 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
428 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
429 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
430 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
431 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
432 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
433 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
434 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
435 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
436 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
437 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
438 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
439 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
440 2844163670 Ensifer sp. 1H6 Isolate Unclassified
441 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
442 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
443 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
444 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
445 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
446 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
447 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
448 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
449 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
450 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
451 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
452 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
453 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
454 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
455 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
456 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
457 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
458 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
459 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
460 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
461 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
462 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
463 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
464 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
465 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
466 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
467 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
468 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
469 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
470 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
471 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
472 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
473 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
474 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
475 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
476 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
477 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
478 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
479 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
480 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
481 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
482 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
483 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
484 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
485 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
486 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
487 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
488 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
489 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
490 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
491 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
492 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
493 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
494 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
495 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
496 2933599457 Rhizobium phaseoli M3 Isolate Nodule
497 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
498 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
499 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
500 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
501 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
502 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
503 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
504 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
505 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
506 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
507 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
508 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
509 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
510 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
511 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
512 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
513 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
514 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
515 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
516 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
517 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
518 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
519 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
520 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
521 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
522 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
523 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
524 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
525 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
526 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
527 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
528 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
529 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
530 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
531 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
532 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
533 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
534 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
535 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
536 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
537 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
538 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
539 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
540 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
541 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
542 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
543 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
544 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
545 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
546 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
547 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
548 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
549 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
550 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
551 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
552 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
553 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
554 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
555 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
556 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
557 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
558 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
559 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
560 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
561 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
562 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
563 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
564 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
565 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
566 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
567 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
568 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
569 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
570 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
571 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
572 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
573 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
574 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
575 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
576 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
577 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
578 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
579 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
580 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
581 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
582 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
583 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
584 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
585 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
586 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
587 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
588 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
589 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
590 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
591 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
592 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
593 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
594 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
595 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
596 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
597 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
598 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
599 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
600 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
601 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
602 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
603 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
604 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
605 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
606 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
607 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
608 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
609 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
610 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
611 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
612 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
613 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
614 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
615 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
616 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
617 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
618 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
619 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
620 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
621 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
622 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
623 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
624 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
625 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
626 2996887358 Rhizobium sp. R711 Isolate Nodule
627 2996893221 Rhizobium sp. R635 Isolate Nodule
628 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
629 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
630 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
631 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
632 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
633 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
634 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
635 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
636 8005258706 Rhizobium sp. R693 Isolate Nodule
637 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
638 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
639 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
640 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
641 8005321885 Rhizobium sp. R72 Isolate Nodule
642 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
643 8005382845 Rhizobium sp. R634 Isolate Nodule
644 8005395548 Rhizobium sp. R339 Isolate Nodule
645 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
646 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
647 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
648 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
649 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
650 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
651 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
652 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
653 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
654 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
655 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
656 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
657 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
658 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
659 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
660 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
661 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
662 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
663 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
664 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
665 8056382006 Rhizobium croatiense 13T Isolate Nodule
666 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.98
Metatranscriptomes 0
Isolates 48.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.46
Nodule 39.74
Rhizoplane 1.52
Rhizosphere 25.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500568_0018858 3300053139 Bacteria 3009
2 JGI24740J21852_10000013 3300001979 Bacteria 62177
3 JGI25155J39150_1000010 3300002704 Bacteria 207717
4 JGI25156J39149_1000102 3300002705 Bacteria 62463
5 JGI25162J39368_1002159 3300002737 Bacteria 8202
6 JGI25162J39368_1002243 3300002737 Bacteria 7888
7 JGI25154J39366_1000096 3300002738 Bacteria 79168
8 JGI25158J39367_1000116 3300002739 Bacteria 18332
9 JGI25157J39369_1000009 3300002741 Bacteria 207868
10 JGI25152J39213_1000706 3300002773 Bacteria 17323
11 JGI25152J39213_1007127 3300002773 Bacteria 2934
12 JGI25152J39213_1007848 3300002773 Bacteria 2713
13 JGI25152J39213_1008840 3300002773 Bacteria 2457
14 JGI25152J39213_1012669 3300002773 Bacteria 1794
15 JGI25150J39212_1000476 3300002774 Bacteria 17314
16 JGI25150J39212_1002674 3300002774 Bacteria 4348
17 JGI25159J45721_1000017 3300002987 Bacteria 136127
18 JGI25159J45721_1002450 3300002987 Bacteria 7046
19 JGI25151J46595_10001324 3300003187 Bacteria 17314
20 JGI25151J46595_10030328 3300003187 Bacteria 2129
21 JGI25151J46595_10049041 3300003187 Bacteria 1452
22 JGI25151J46595_10082245 3300003187 Bacteria 927
23 JGI25151J46595_10091008 3300003187 Bacteria 849
24 JGI25165J46597_1001449 3300003214 Bacteria 12524
25 JGI25165J46597_1002377 3300003214 Bacteria 6266
26 JGI25165J46597_1009692 3300003214 Bacteria 1437
27 JGI25153J46596_10007490 3300003215 Bacteria 5356
28 JGI25153J46596_10020908 3300003215 Bacteria 2457
29 JGI25153J46596_10027254 3300003215 Bacteria 2006
30 JGI25153J46596_10029782 3300003215 Bacteria 1868
31 JGI25153J46596_10031300 3300003215 Bacteria 1794
32 rootH2_10036173 3300003320 Bacteria 2212
33 rootH1_10077152 3300003323 Bacteria 1126
34 JGI25160J50197_1000027 3300003354 Bacteria 182809
35 JGI25160J50197_1005614 3300003354 Bacteria 5197
36 JGI25161J50226_1000327 3300003374 Bacteria 25949
37 JGI25161J50226_1000501 3300003374 Bacteria 17353
38 Ga0055526_1001473 3300003771 Bacteria 16693
39 Ga0055526_1007862 3300003771 Bacteria 5447
40 Ga0055526_1008010 3300003771 Bacteria 5352
41 Ga0055526_1010107 3300003771 Bacteria 4430
42 Ga0055524_1002650 3300003775 Bacteria 9086
43 Ga0055524_1003843 3300003775 Bacteria 7130
44 Ga0055524_1004200 3300003775 Bacteria 6711
45 Ga0055524_1005420 3300003775 Bacteria 5698
46 Ga0055524_1019722 3300003775 Bacteria 2295
47 Ga0055524_1024992 3300003775 Bacteria 1880
48 Ga0055524_1026436 3300003775 Bacteria 1793
49 Ga0055536_1001323 3300003781 Bacteria 15170
50 Ga0055528_1000099 3300003790 Bacteria 68463
51 Ga0055528_1002777 3300003790 Bacteria 9169
52 Ga0055528_1003641 3300003790 Bacteria 7651
53 Ga0055530_10012308 3300003791 Bacteria 2994
54 Ga0055531_10021365 3300003794 Bacteria 2513
55 Ga0055531_10070288 3300003794 Bacteria 811
56 Ga0058692_1013788 3300003856 Bacteria 1870
57 Ga0055543_1000030 3300004625 Bacteria 130849
58 Ga0055543_1000062 3300004625 Bacteria 98034
59 Ga0065165_1000122 3300005262 Bacteria 132524
60 Ga0065165_1009930 3300005262 Bacteria 4192
61 Ga0065165_1016892 3300005262 Bacteria 2712
62 Ga0065165_1024067 3300005262 Bacteria 2053
63 Ga0070658_10300960 3300005327 Bacteria 1367
64 Ga0070670_100000116 3300005331 Bacteria 74586
65 Ga0070666_10234458 3300005335 Bacteria 1297
66 Ga0070668_100509774 3300005347 Bacteria 1042
67 Ga0070669_100203183 3300005353 Bacteria 1560
68 Ga0070675_100504686 3300005354 Bacteria 1090
69 Ga0070671_100007506 3300005355 Bacteria 8715
70 Ga0070667_100288411 3300005367 Bacteria 1475
71 Ga0070700_100101754 3300005441 Bacteria 1894
72 Ga0068867_100106810 3300005459 Bacteria 2145
73 Ga0068853_100380672 3300005539 Bacteria 1318
74 Ga0070665_100520214 3300005548 Bacteria 1201
75 Ga0068854_100102539 3300005578 Bacteria 2147
76 Ga0068856_100187406 3300005614 Bacteria 2083
77 Ga0070702_100008268 3300005615 Bacteria 5030
78 Ga0068859_100352685 3300005617 Bacteria 1566
79 Ga0068861_100021921 3300005719 Bacteria 4596
80 Ga0068851_10019658 3300005834 Bacteria 3265
81 Ga0068858_100231005 3300005842 Bacteria 1754
82 Ga0068862_100022876 3300005844 Bacteria 5232
83 Ga0075365_10000498 3300006038 Bacteria 14945
84 Ga0075365_10357341 3300006038 Bacteria 1030
85 Ga0075368_10027222 3300006042 Bacteria 2204
86 Ga0075362_10168511 3300006177 Bacteria 1057
87 Ga0075367_10004009 3300006178 Bacteria 7117
88 Ga0075367_10208516 3300006178 Bacteria 1222
89 Ga0075369_10002071 3300006186 Bacteria 7079
90 Ga0075369_10139210 3300006186 Bacteria 1106
91 Ga0075370_10011795 3300006353 Bacteria 4601
92 Ga0075370_10209238 3300006353 Bacteria 1151
93 Ga0068871_100660497 3300006358 Bacteria 955
94 Ga0068865_100089107 3300006881 Bacteria 2234
95 Ga0097620_100352674 3300006931 Bacteria 1566
96 Ga0105251_10017043 3300009011 Bacteria 3903
97 Ga0105250_10029222 3300009092 Bacteria 2218
98 Ga0105250_10264039 3300009092 Bacteria 738
99 Ga0105240_10000013 3300009093 Bacteria 483458
100 Ga0111539_10078411 3300009094 Bacteria 3886
101 Ga0111539_10087317 3300009094 Bacteria 3664
102 Ga0105245_10000318 3300009098 Bacteria 45618
103 Ga0105247_10151798 3300009101 Bacteria 1527
104 Ga0105243_10020943 3300009148 Bacteria 4962
105 Ga0105248_10119214 3300009177 Bacteria 2976
106 Ga0105237_10012810 3300009545 Bacteria 8820
107 Ga0105237_10768513 3300009545 Bacteria 970
108 Ga0105237_10994329 3300009545 Bacteria 846
109 Ga0105238_10446000 3300009551 Bacteria 1291
110 Ga0105249_10129204 3300009553 Bacteria 2410
111 Ga0123341_1077843 3300009765 Bacteria 1341
112 Ga0105239_10000820 3300010375 Bacteria 44190
113 Ga0105246_10046692 3300011119 Bacteria 2955
114 Ga0157370_10005427 3300013104 Bacteria 14303
115 Ga0157369_10835614 3300013105 Bacteria 946
116 Ga0157378_10025049 3300013297 Bacteria 5256
117 Ga0157378_10393336 3300013297 Bacteria 1364
118 Ga0157375_10357049 3300013308 Bacteria 1627
119 Ga0163163_10609719 3300014325 Bacteria 1155
120 Ga0157380_10388760 3300014326 Bacteria 1319
121 Ga0182008_10083407 3300014497 Bacteria 1574
122 Ga0157376_10245906 3300014969 Bacteria 1669
123 Ga0182007_10002575 3300015262 Bacteria 8925
124 Ga0182005_1004658 3300015265 Bacteria 4386
125 Ga0163161_10042233 3300017792 Bacteria 3279
126 Ga0163161_10076548 3300017792 Bacteria 2456
127 Ga0214544_1000288 3300021320 Bacteria 85073
128 Ga0214542_1000008 3300021321 Bacteria 278895
129 Ga0214542_1029224 3300021321 Bacteria 2282
130 Ga0214543_1000015 3300021327 Bacteria 305679
131 Ga0214543_1000031 3300021327 Bacteria 206436
132 Ga0209435_100009 3300025206 Bacteria 476614
133 Ga0209760_103523 3300025207 Bacteria 1385
134 Ga0209436_100018 3300025208 Bacteria 113499
135 Ga0209436_100664 3300025208 Bacteria 14651
136 Ga0209672_103233 3300025228 Bacteria 3465
137 Ga0207427_114073 3300025231 Bacteria 773
138 Ga0209437_100057 3300025233 Bacteria 362922
139 Ga0209437_100107 3300025233 Bacteria 218656
140 Ga0209437_104595 3300025233 Bacteria 2415
141 Ga0207425_1000553 3300025245 Bacteria 22329
142 Ga0207425_1002143 3300025245 Bacteria 7234
143 Ga0207425_1009172 3300025245 Bacteria 2477
144 Ga0207425_1020102 3300025245 Bacteria 1431
145 Ga0207425_1040725 3300025245 Bacteria 885
146 Ga0209646_1000018 3300025246 Bacteria 476716
147 Ga0209646_1015814 3300025246 Bacteria 1123
148 Ga0209026_1000068 3300025250 Bacteria 207601
149 Ga0209677_104031 3300025253 Bacteria 4425
150 Ga0209759_1000007 3300025256 Bacteria 476614
151 Ga0209129_1000118 3300025258 Bacteria 139972
152 Ga0209129_1000717 3300025258 Bacteria 21402
153 Ga0209129_1000971 3300025258 Bacteria 17232
154 Ga0209129_1003196 3300025258 Bacteria 7326
155 Ga0209129_1003252 3300025258 Bacteria 7210
156 Ga0209129_1004160 3300025258 Bacteria 5843
157 Ga0209129_1015557 3300025258 Bacteria 1562
158 Ga0209233_1000130 3300025261 Bacteria 205687
159 Ga0209233_1000358 3300025261 Bacteria 41919
160 Ga0209233_1000531 3300025261 Bacteria 21804
161 Ga0209673_1000033 3300025273 Bacteria 335369
162 Ga0209673_1000050 3300025273 Bacteria 285287
163 Ga0209673_1004625 3300025273 Bacteria 7285
164 Ga0209673_1005860 3300025273 Bacteria 6081
165 Ga0209673_1037831 3300025273 Bacteria 1413
166 Ga0209130_1000009 3300025284 Bacteria 498952
167 Ga0209130_1000027 3300025284 Bacteria 327700
168 Ga0209130_1008796 3300025284 Bacteria 2942
169 Ga0209130_1030926 3300025284 Bacteria 1102
170 Ga0209675_1028441 3300025291 Bacteria 1359
171 Ga0209676_1000406 3300025292 Bacteria 77603
172 Ga0209025_1000241 3300025294 Bacteria 128329
173 Ga0209025_1002217 3300025294 Bacteria 21448
174 Ga0209025_1002221 3300025294 Bacteria 21395
175 Ga0209025_1005633 3300025294 Bacteria 10106
176 Ga0209025_1013935 3300025294 Bacteria 5003
177 Ga0209025_1015409 3300025294 Bacteria 4609
178 Ga0209025_1027717 3300025294 Bacteria 2800
179 Ga0209025_1105110 3300025294 Bacteria 882
180 Ga0209564_1000111 3300025295 Bacteria 212210
181 Ga0209564_1000782 3300025295 Bacteria 44138
182 Ga0209564_1003367 3300025295 Bacteria 11059
183 Ga0209758_1001085 3300025297 Bacteria 35309
184 Ga0209758_1001086 3300025297 Bacteria 35300
185 Ga0209758_1001953 3300025297 Bacteria 22290
186 Ga0209758_1002520 3300025297 Bacteria 18534
187 Ga0209758_1015745 3300025297 Bacteria 3893
188 Ga0209758_1044585 3300025297 Bacteria 1619
189 Ga0209050_1000572 3300025298 Bacteria 59716
190 Ga0209256_1001743 3300025299 Bacteria 20757
191 Ga0209256_1003544 3300025299 Bacteria 10827
192 Ga0209256_1003766 3300025299 Bacteria 10227
193 Ga0209256_1007283 3300025299 Bacteria 5513
194 Ga0209256_1007659 3300025299 Bacteria 5251
195 Ga0209256_1012473 3300025299 Bacteria 3250
196 Ga0209256_1040854 3300025299 Bacteria 1182
197 Ga0207426_1000041 3300025302 Bacteria 433536
198 Ga0207426_1000072 3300025302 Bacteria 327700
199 Ga0207426_1001232 3300025302 Bacteria 22539
200 Ga0209051_1001068 3300025303 Bacteria 25445
201 Ga0209051_1006368 3300025303 Bacteria 6674
202 Ga0209051_1009487 3300025303 Bacteria 5011
203 Ga0209051_1081467 3300025303 Bacteria 932
204 Ga0209257_1002707 3300025304 Bacteria 16894
205 Ga0209257_1020143 3300025304 Bacteria 2478
206 Ga0209257_1029438 3300025304 Bacteria 1789
207 Ga0209257_1045375 3300025304 Bacteria 1276
208 Ga0207656_10028222 3300025321 Bacteria 2302
209 Ga0207680_10387845 3300025903 Bacteria 986
210 Ga0207695_10000044 3300025913 Bacteria 440819
211 Ga0207671_10000400 3300025914 Bacteria 60604
212 Ga0207681_10021367 3300025923 Bacteria 4113
213 Ga0207681_10891874 3300025923 Bacteria 744
214 Ga0207650_10000691 3300025925 Bacteria 26420
215 Ga0207687_10000398 3300025927 Bacteria 29475
216 Ga0207709_10008378 3300025935 Bacteria 5719
217 Ga0207709_10043700 3300025935 Bacteria 2703
218 Ga0207669_10054812 3300025937 Bacteria 2411
219 Ga0207704_10083333 3300025938 Bacteria 2075
220 Ga0207712_10072186 3300025961 Bacteria 2485
221 Ga0207668_10003241 3300025972 Bacteria 9540
222 Ga0207668_10115428 3300025972 Bacteria 2023
223 Ga0207640_10124181 3300025981 Bacteria 1855
224 Ga0207658_10238775 3300025986 Bacteria 1538
225 Ga0207703_10541700 3300026035 Bacteria 1097
226 Ga0207678_10652719 3300026067 Bacteria 924
227 Ga0207702_10170624 3300026078 Bacteria 1995
228 Ga0207675_100037533 3300026118 Bacteria 4519
229 Ga0207698_11128353 3300026142 Bacteria 797
230 Ga0209281_1000144 3300027111 Bacteria 172471
231 Ga0209371_1003285 3300027312 Bacteria 8011
232 Ga0268266_10004208 3300028379 Bacteria 13852
233 Ga0268265_10027018 3300028380 Bacteria 4091
234 Ga0268264_10501188 3300028381 Bacteria 1184
235 Ga0307515_10001330 3300028794 Bacteria 55993
236 Ga0268256_1003721 3300030500 Bacteria 6713
237 Ga0307513_10005665 3300031456 Bacteria 16445
238 Ga0307509_10046214 3300031507 Bacteria 4688
239 Ga0307408_100049613 3300031548 Bacteria 3015
240 Ga0307405_10003191 3300031731 Bacteria 7467
241 Ga0307405_10043558 3300031731 Bacteria 2740
242 Ga0307410_10026303 3300031852 Bacteria 3662
243 Ga0307406_10001146 3300031901 Bacteria 14816
244 Ga0307407_10471978 3300031903 Bacteria 915
245 Ga0307412_10049133 3300031911 Bacteria 2778
246 Ga0307412_10091473 3300031911 Bacteria 2130
247 Ga0307409_100152956 3300031995 Bacteria 2006
248 Ga0307416_100195516 3300032002 Bacteria 1913
249 Ga0307416_100412784 3300032002 Bacteria 1391
250 Ga0439436_0031360 3300041404 Bacteria 1543
251 Ga0439436_0039888 3300041404 Bacteria 1347
252 Ga0439438_076479 3300041405 Bacteria 824
253 Ga0439465_0003192 3300041413 Bacteria 5345
254 Ga0439465_0021316 3300041413 Bacteria 2031
255 Ga0439465_0024058 3300041413 Bacteria 1919
256 Ga0439465_0033814 3300041413 Bacteria 1635
257 Ga0439465_0040129 3300041413 Bacteria 1512
258 Ga0439465_0070310 3300041413 Bacteria 1172
259 Ga0451802_1942730 3300041460 Bacteria 873
260 Ga0451807_2434037 3300041486 Bacteria 831
261 Ga0451837_0113530 3300041494 Bacteria 2478
262 Ga0451837_0640748 3300041494 Bacteria 912
263 Ga0451841_0606347 3300041498 Bacteria 832
264 Ga0451845_0072877 3300041501 Bacteria 2403
265 Ga0451847_0157273 3300041503 Bacteria 1342
266 Ga0439433_0095868 3300041999 Bacteria 733
267 Ga0439449_0001259 3300042007 Bacteria 9917
268 Ga0439449_0011037 3300042007 Bacteria 3407
269 Ga0450919_018777 3300042121 Bacteria 781
270 Ga0439434_0007818 3300042435 Bacteria 3135
271 Ga0466971_0150338 3300044719 Bacteria 1087
272 Ga0466957_0045595 3300044842 Bacteria 2659
273 Ga0466959_0321279 3300045049 Bacteria 1058
274 Ga0466958_0071590 3300045836 Bacteria 2123
275 Ga0495592_0027176 3300046454 Bacteria 4338
276 Ga0495603_0160518 3300046455 Bacteria 1304
277 Ga0495629_0012949 3300046459 Bacteria 6032
278 Ga0495638_0003269 3300046460 Bacteria 12786
279 Ga0495605_0002525 3300046474 Bacteria 11283
280 Ga0495662_0002948 3300046476 Bacteria 8590
281 Ga0495664_0069731 3300046477 Bacteria 2099
282 Ga0495585_0079696 3300046492 Bacteria 1776
283 Ga0495585_0382759 3300046492 Bacteria 679
284 Ga0495607_0043296 3300046501 Bacteria 2663
285 Ga0495583_0020888 3300046506 Bacteria 3378
286 Ga0495583_0030217 3300046506 Bacteria 2641
287 Ga0495606_0002721 3300046507 Bacteria 19935
288 Ga0495606_0065112 3300046507 Bacteria 2317
289 Ga0495606_0067996 3300046507 Bacteria 2255
290 Ga0495606_0069944 3300046507 Bacteria 2215
291 Ga0495610_0018390 3300046512 Bacteria 3950
292 Ga0495610_0025605 3300046512 Bacteria 3162
293 Ga0495610_0028473 3300046512 Bacteria 2954
294 Ga0495616_0020903 3300046513 Bacteria 3554
295 Ga0495620_0071384 3300046515 Bacteria 1420
296 Ga0495620_0103809 3300046515 Bacteria 1131
297 Ga0495620_0134729 3300046515 Bacteria 968
298 Ga0495631_0002242 3300046518 Bacteria 11099
299 Ga0495632_0009845 3300046519 Bacteria 5718
300 Ga0495632_0018201 3300046519 Bacteria 3860
301 Ga0495632_0028409 3300046519 Bacteria 2919
302 Ga0495632_0066458 3300046519 Bacteria 1740
303 Ga0495643_0009187 3300046522 Bacteria 6169
304 Ga0495643_0080205 3300046522 Bacteria 1699
305 Ga0495643_0133875 3300046522 Bacteria 1242
306 Ga0495644_0156944 3300046523 Bacteria 872
307 Ga0495663_0032664 3300046525 Bacteria 1551
308 Ga0495654_0036910 3300046530 Bacteria 2454
309 Ga0495654_0150171 3300046530 Bacteria 1031
310 Ga0495587_0043343 3300046536 Bacteria 2680
311 Ga0495597_0117664 3300046542 Bacteria 1110
312 Ga0495597_0122656 3300046542 Bacteria 1082
313 Ga0495622_0056449 3300046557 Bacteria 1821
314 Ga0495633_0038878 3300046558 Bacteria 2271
315 Ga0495633_0043486 3300046558 Bacteria 2131
316 Ga0495656_0017308 3300046615 Bacteria 2749
317 Ga0495668_0006323 3300046616 Bacteria 7788
318 Ga0495668_0033189 3300046616 Bacteria 2901
319 Ga0495668_0086219 3300046616 Bacteria 1722
320 Ga0495668_0393635 3300046616 Bacteria 761
321 Ga0495625_0004490 3300046660 Bacteria 13166
322 Ga0495625_0030505 3300046660 Bacteria 4021
323 Ga0495661_0173689 3300046665 Bacteria 1147
324 Ga0495588_0176320 3300046674 Bacteria 1130
325 Ga0495657_0040807 3300046675 Bacteria 3180
326 Ga0495624_0076566 3300046690 Bacteria 2076
327 Ga0495670_0077090 3300046691 Bacteria 1694
328 Ga0495671_0015746 3300046692 Bacteria 4045
329 Ga0495649_0070475 3300046694 Bacteria 1874
330 Ga0495660_0210913 3300046810 Bacteria 921
331 Ga0495604_0030094 3300047317 Bacteria 4315
332 Ga0495636_0075163 3300047318 Bacteria 1448
333 Ga0495683_0118278 3300047323 Bacteria 1260
334 Ga0495687_052212 3300047443 Bacteria 1730
335 Ga0495677_0096983 3300047445 Bacteria 1114
336 Ga0495673_0060008 3300047469 Bacteria 1633
337 Ga0495686_0015554 3300047472 Bacteria 5189
338 Ga0495686_0022064 3300047472 Bacteria 4216
339 Ga0495686_0034308 3300047472 Bacteria 3269
340 Ga0495686_0038018 3300047472 Bacteria 3081
341 Ga0495686_0224123 3300047472 Bacteria 1068
342 Ga0495686_0265488 3300047472 Bacteria 959
343 Ga0496100_0351798 3300048903 Bacteria 1113
344 Ga0496103_0064585 3300048906 Bacteria 2282
345 Ga0496106_0004976 3300048909 Bacteria 9835
346 Ga0496106_0384312 3300048909 Bacteria 1128
347 Ga0496107_0046967 3300048910 Bacteria 3108
348 Ga0496109_0170455 3300048912 Bacteria 2042
349 Ga0496114_0080244 3300048917 Bacteria 2755
350 Ga0496116_0004254 3300048919 Bacteria 13732
351 Ga0496116_0043890 3300048919 Bacteria 3041
352 Ga0496116_0046733 3300048919 Bacteria 2919
353 Ga0496116_0312108 3300048919 Bacteria 741
354 Ga0496117_0002097 3300048920 Bacteria 26238
355 Ga0496117_0019389 3300048920 Bacteria 5587
356 Ga0496117_0022854 3300048920 Bacteria 5007
357 Ga0496117_0359750 3300048920 Bacteria 748
358 Ga0496118_0000606 3300048921 Bacteria 59016
359 Ga0496118_0002291 3300048921 Bacteria 26051
360 Ga0496118_0018393 3300048921 Bacteria 6308
361 Ga0496118_0041571 3300048921 Bacteria 3638
362 Ga0496118_0080335 3300048921 Bacteria 2295
363 Ga0496118_0097285 3300048921 Bacteria 2003
364 Ga0496118_0404497 3300048921 Bacteria 708
365 Ga0496119_0006994 3300048922 Bacteria 10276
366 Ga0496119_0063845 3300048922 Bacteria 2189
367 Ga0496121_0017407 3300048924 Bacteria 7344
368 Ga0496121_0018473 3300048924 Bacteria 7028
369 Ga0496121_0027371 3300048924 Bacteria 5336
370 Ga0496121_0038490 3300048924 Bacteria 4233
371 Ga0496121_0044056 3300048924 Bacteria 3855
372 Ga0496121_0050403 3300048924 Bacteria 3518
373 Ga0496121_0067368 3300048924 Bacteria 2902
374 Ga0496121_0103185 3300048924 Bacteria 2194
375 Ga0496121_0153978 3300048924 Bacteria 1688
376 Ga0496122_0009143 3300048925 Bacteria 10499
377 Ga0496122_0021693 3300048925 Bacteria 5738
378 Ga0496122_0022747 3300048925 Bacteria 5560
379 Ga0496122_0137693 3300048925 Bacteria 1534
380 Ga0496122_0157446 3300048925 Bacteria 1391
381 Ga0496122_0214912 3300048925 Bacteria 1109
382 Ga0496123_0008746 3300048926 Bacteria 9243
383 Ga0496123_0037961 3300048926 Bacteria 3393
384 Ga0496123_0072166 3300048926 Bacteria 2149
385 Ga0496123_0255241 3300048926 Bacteria 862
386 Ga0496124_0006102 3300048927 Bacteria 13250
387 Ga0496124_0021210 3300048927 Bacteria 5989
388 Ga0496124_0088136 3300048927 Bacteria 2537
389 Ga0496124_0089409 3300048927 Bacteria 2515
390 Ga0496124_0123928 3300048927 Bacteria 2061
391 Ga0496124_0197867 3300048927 Bacteria 1531
392 Ga0496125_0027541 3300048928 Bacteria 5150
393 Ga0496125_0027792 3300048928 Bacteria 5120
394 Ga0496125_0223750 3300048928 Bacteria 1210
395 Ga0496125_0414032 3300048928 Bacteria 783
396 Ga0496126_0143939 3300048929 Bacteria 2049
397 Ga0496126_0151149 3300048929 Bacteria 1990
398 Ga0496126_0270304 3300048929 Bacteria 1411
399 Ga0496126_0837315 3300048929 Bacteria 703
400 Ga0495678_006181 3300049459 Bacteria 6412
401 Ga0495678_025159 3300049459 Bacteria 2561
402 Ga0501032_0087494 3300049569 Bacteria 2069
403 Ga0501032_0108822 3300049569 Bacteria 1835
404 Ga0501034_0355085 3300049571 Bacteria 1393
405 Ga0501036_0269710 3300049572 Bacteria 1425
406 Ga0501037_0226858 3300049573 Bacteria 1312
407 Ga0501047_0181563 3300049581 Bacteria 1971
408 Ga0501068_0179507 3300049584 Bacteria 1338
409 Ga0501073_0189847 3300049589 Bacteria 1422
410 Ga0501044_0179878 3300049823 Bacteria 2082
411 nmdc:mga00v17_401984_c1 3300050491 Bacteria 890
412 nmdc:mga06z11_323144_c1 3300050494 Bacteria 921
413 nmdc:mga07m45_278923_c1 3300050496 Bacteria 972
414 nmdc:mga07m45_346612_c1 3300050496 Bacteria 863
415 nmdc:mga08y16_93195_c1 3300050511 Bacteria 3138
416 nmdc:mga0sz30_32333_c1 3300050516 Bacteria 2170
417 Ga0495601_0086094 3300053077 Bacteria 2019
418 Ga0500610_0012502 3300053079 Bacteria 3914
419 Ga0495619_0085068 3300053085 Bacteria 2135
420 Ga0500578_0067685 3300053086 Bacteria 2277
421 Ga0500578_0255107 3300053086 Bacteria 1055
422 Ga0500644_0146997 3300053088 Bacteria 941
423 Ga0500641_0086745 3300053096 Bacteria 1333
424 Ga0500557_055562 3300053105 Bacteria 1277
425 Ga0500569_015174 3300053109 Bacteria 1924
426 Ga0500569_089159 3300053109 Bacteria 997
427 Ga0500569_112320 3300053109 Bacteria 901
428 Ga0500618_002740 3300053125 Bacteria 6410
429 Ga0500618_019083 3300053125 Bacteria 1690
430 Ga0500658_0000309 3300053134 Bacteria 21891
431 Ga0500658_0018303 3300053134 Bacteria 2625
432 Ga0500559_0041933 3300053136 Bacteria 1995
433 Ga0500568_0008863 3300053139 Bacteria 4817
434 Ga0500568_0018252 3300053139 Bacteria 3075
435 Ga0500573_0000290 3300053140 Bacteria 21357
436 Ga0500573_0000334 3300053140 Bacteria 19960
437 Ga0500588_0202363 3300053146 Bacteria 736
438 Ga0500590_017695 3300053148 Bacteria 3684
439 Ga0500604_0009869 3300053151 Bacteria 2546
440 Ga0500616_0007819 3300053153 Bacteria 6733
441 Ga0500616_0020147 3300053153 Bacteria 3750
442 Ga0500622_0003318 3300053156 Bacteria 10874
443 Ga0500624_000002 3300053157 Bacteria 257900
444 Ga0500627_0159258 3300053158 Bacteria 1019
445 Ga0500636_0238701 3300053177 Bacteria 935
446 Ga0501082_0107843 3300060353 Bacteria 2410
447 2509109585 2508501122 Bacteria 6292184
448 2509378091 2509276019 Bacteria 6802256
449 2510135234 2510065019 Bacteria 6903379
450 2510306719 2510065057 Bacteria 6649661
451 2511183986 2510917028 Bacteria 6185411
452 2511194590 2510917030 Bacteria 7460662
453 2511498490 2511231052 Bacteria 6974333
454 2512534631 2512047086 Bacteria 6850303
455 2513571618 2513237084 Bacteria 7231967
456 2513578652 2513237085 Bacteria 7695351
457 2513583652 2513237086 Bacteria 7265287
458 2513596817 2513237088 Bacteria 6927906
459 2513601920 2513237089 Bacteria 6553624
460 2513615725 2513237091 Bacteria 6900273
461 2513630163 2513237093 Bacteria 7545552
462 2513867468 2513237138 Bacteria 7368160
463 2513884980 2513237140 Bacteria 7076289
464 2513905190 2513237143 Bacteria 6664116
465 2513912367 2513237144 Bacteria 7530820
466 2513928448 2513237146 Bacteria 7166346
467 2513988040 2513237156 Bacteria 6402557
468 2514003480 2513237160 Bacteria 6650282
469 2515114392 2515075009 Bacteria 7288508
470 2515611063 2515154107 Bacteria 6795637
471 2515635395 2515154113 Bacteria 7807172
472 2515643197 2515154114 Bacteria 7848616
473 2515741576 2515154134 Bacteria 7220242
474 2516205573 2516143018 Bacteria 6951533
475 2516894770 2516653046 Bacteria 6989037
476 2517038042 2516653077 Bacteria 7555578
477 2517078306 2516653085 Bacteria 7346596
478 2517097065 2517093000 Bacteria 7412387
479 2517408551 2517287029 Bacteria 6905599
480 2517571435 2517487022 Bacteria 7227575
481 2520376399 2519899620 Bacteria 6499161
482 2524450419 2524023207 Bacteria 6813453
483 2535519009 2534681796 Bacteria 7146037
484 2551676624 2551306084 Bacteria 8942552
485 2551680248 2551306084 Bacteria 8942552
486 2551685078 2551306085 Bacteria 7347181
487 2551694478 2551306086 Bacteria 6843938
488 2551697730 2551306087 Bacteria 7351905
489 2551708357 2551306089 Bacteria 7162724
490 2551717608 2551306090 Bacteria 7953713
491 2551731609 2551306091 Bacteria 7086830
492 2551736193 2551306092 Bacteria 6992595
493 2551746080 2551306093 Bacteria 7064773
494 2558867408 2558860100 Bacteria 8458965
495 2561467078 2558860983 Bacteria 4133860
496 2585201750 2582581294 Bacteria 6626667
497 2585223911 2582581298 Bacteria 7315509
498 2585228753 2582581299 Bacteria 6518058
499 2585257360 2582581304 Bacteria 5831370
500 2585271651 2582581307 Bacteria 6597605
501 2585280712 2582581308 Bacteria 7413247
502 2585326497 2582581315 Bacteria 7318924
503 2585334160 2582581316 Bacteria 7774528
504 2585396086 2582581866 Bacteria 6859583
505 2585399736 2582581867 Bacteria 7184437
506 2585531646 2585427527 Bacteria 7273426
507 2585549134 2585427529 Bacteria 7395659
508 2585551407 2585427530 Bacteria 7383882
509 2585563109 2585427531 Bacteria 6992870
510 2585820823 2585427590 Bacteria 6824633
511 2585844863 2585427594 Bacteria 6180594
512 2585907327 2585427609 Bacteria 6667127
513 2587982679 2585428125 Bacteria 6662905
514 2599335113 2599185156 Bacteria 5403036
515 2599420160 2599185170 Bacteria 7295545
516 2600193361 2599185352 Bacteria 7228948
517 2616296327 2615840624 Bacteria 6557588
518 2616306743 2615840626 Bacteria 7921970
519 2616557589 2615840698 Bacteria 7319877
520 2617383261 2617270742 Bacteria 6808054
521 2643808059 2643221557 Bacteria 7184309
522 2644002458 2643221599 Bacteria 6292121
523 2644068752 2643221610 Bacteria 7480339
524 2644110158 2643221618 Bacteria 7717186
525 2644150434 2643221626 Bacteria 8069654
526 2644194836 2643221634 Bacteria 6705461
527 2644240516 2643221643 Bacteria 5749658
528 2644313038 2643221655 Bacteria 7722067
529 2644336586 2643221659 Bacteria 7890716
530 2644379493 2643221668 Bacteria 7306521
531 2644419822 2643221675 Bacteria 7473456
532 2644453179 2643221680 Bacteria 7473610
533 2644546233 2643221698 Bacteria 7756764
534 2644618768 2643221712 Bacteria 7729434
535 2644677087 2643221723 Bacteria 7095460
536 2644688793 2643221726 Bacteria 7455827
537 2657682400 2657244999 Bacteria 5946535
538 2671113485 2667528174 Bacteria 6435400
539 2692319952 2690316117 Bacteria 6800650
540 2719182951 2718217882 Bacteria 6556348
541 2719667296 2718217997 Bacteria 6740740
542 2719733668 2718218009 Bacteria 6478651
543 2720493716 2718218199 Bacteria 6740745
544 2720615169 2718218232 Bacteria 6720332
545 2720621964 2718218233 Bacteria 6662049
546 2720633314 2718218235 Bacteria 6630699
547 2720777012 2718218269 Bacteria 6906114
548 2721149063 2718218363 Bacteria 6524337
549 2721160461 2718218365 Bacteria 6274507
550 2721165876 2718218366 Bacteria 6425255
551 2722842046 2721755514 Bacteria 6424414
552 2723028610 2721755556 Bacteria 6745503
553 2723562214 2721755684 Bacteria 6859907
554 2723568917 2721755685 Bacteria 6704835
555 2724046424 2721755810 Bacteria 6479005
556 2724091619 2721755819 Bacteria 6906405
557 2724106182 2721755822 Bacteria 6726041
558 2724111988 2721755823 Bacteria 6752556
559 2725947525 2724679232 Bacteria 7646494
560 2730109546 2728369352 Bacteria 6745171
561 2730166186 2728369365 Bacteria 6555560
562 2730300093 2728369397 Bacteria 6274511
563 2738801181 2738541293 Bacteria 7065685
564 2753462456 2751185821 Bacteria 6189929
565 2766064280 2765235942 Bacteria 7445910
566 2778173741 2775507266 Bacteria 7392367
567 2792582250 2791355082 Bacteria 5973319
568 2792621902 2791355091 Bacteria 6135441
569 2792628841 2791355092 Bacteria 6248105
570 2792639985 2791355094 Bacteria 7011481
571 2793295640 2791355256 Bacteria 6798008
572 2793320708 2791355260 Bacteria 6598818
573 2793327271 2791355261 Bacteria 6661293
574 2793332225 2791355262 Bacteria 6774204
575 2793346588 2791355264 Bacteria 6429314
576 2793353873 2791355265 Bacteria 6539969
577 2802717198 2802428858 Bacteria 6636079
578 2802724813 2802428859 Bacteria 6667919
579 2802729564 2802428860 Bacteria 6525526
580 2802736910 2802428861 Bacteria 6534206
581 2802743315 2802428862 Bacteria 6633353
582 2802749559 2802428863 Bacteria 6410669
583 2804753707 2802429268 Bacteria 6094027
584 2805926203 2802429605 Bacteria 6875453
585 2819611234 2818991448 Bacteria 6772224
586 2819638837 2818991453 Bacteria 7181617
587 2838018344 2838016132 Bacteria 6577831
588 2838024027 2838022645 Bacteria 6494267
589 2838030923 2838029111 Bacteria 6603031
590 2838040366 2838035591 Bacteria 7166484
591 2838050794 2838048938 Bacteria 6044578
592 2838062560 2838061910 Bacteria 6794874
593 2838072111 2838068647 Bacteria 6208656
594 2838078175 2838074704 Bacteria 6785777
595 2838667780 2838661181 Bacteria 7385261
596 2838672152 2838668709 Bacteria 6671819
597 2838690269 2838686498 Bacteria 7807632
598 2838704978 2838701080 Bacteria 6669771
599 2838732044 2838729681 Bacteria 7400765
600 2838744940 2838742623 Bacteria 7396178
601 2841855998 2841851746 Bacteria 7532261
602 2842116867 2842110456 Bacteria 7656360
603 2842148786 2842146304 Bacteria 5957337
604 2842161168 2842156927 Bacteria 6894975
605 2842166680 2842163707 Bacteria 6916235
606 2842184784 2842180545 Bacteria 6888678
607 2842201620 2842198810 Bacteria 6608673
608 2842232366 2842229732 Bacteria 7475766
609 2842246782 2842243621 Bacteria 7421798
610 2842254659 2842250916 Bacteria 6579627
611 2842261117 2842257432 Bacteria 7401195
612 2842269626 2842264693 Bacteria 6472963
613 2842274289 2842271015 Bacteria 7807131
614 2842288506 2842285085 Bacteria 6011953
615 2842305868 2842304105 Bacteria 7023636
616 2842311398 2842311132 Bacteria 6616990
617 2842406148 2842402390 Bacteria 6681310
618 2842412733 2842409023 Bacteria 6687331
619 2842419388 2842415677 Bacteria 6596907
620 2842425743 2842422224 Bacteria 6239196
621 2842433612 2842428310 Bacteria 6767288
622 2842439940 2842434925 Bacteria 6502746
623 2842446569 2842441272 Bacteria 6769273
624 2842448793 2842447887 Bacteria 6754142
625 2842467922 2842462802 Bacteria 6588055
626 2842474549 2842469257 Bacteria 6752936
627 2842477655 2842475841 Bacteria 6603183
628 2842484961 2842482326 Bacteria 7212537
629 2842491152 2842489311 Bacteria 6620893
630 2842504472 2842502639 Bacteria 6604161
631 2842926303 2842922631 Bacteria 5824079
632 2844166246 2844163670 Bacteria 7266046
633 2844457032 2844454524 Bacteria 7952546
634 2847420824 2847417321 Bacteria 6913799
635 2848995650 2848992105 Bacteria 6810864
636 2850082647 2850079185 Bacteria 6848280
637 2855827398 2855825444 Bacteria 6785811
638 2855842776 2855839649 Bacteria 7135830
639 2855878187 2855872281 Bacteria 6964271
640 2857519561 2857516855 Bacteria 7787325
641 2858802114 2858800743 Bacteria 6603254
642 2896390204 2896384573 Bacteria 7700774
643 2913300192 2913295892 Bacteria 6333755
644 2915982411 2915980308 Bacteria 6624279
645 2915992774 2915986958 Bacteria 6739310
646 2915999337 2915993759 Bacteria 7016183
647 2916002821 2916000859 Bacteria 6865702
648 2916010604 2916007675 Bacteria 6898660
649 2916018156 2916014648 Bacteria 6946486
650 2916023832 2916021584 Bacteria 6854472
651 2916034386 2916028427 Bacteria 6748433
652 2916040399 2916035215 Bacteria 6755766
653 2916045407 2916041962 Bacteria 6820487
654 2916050743 2916048683 Bacteria 6543552
655 2916056762 2916055098 Bacteria 6758838
656 2916064997 2916061851 Bacteria 6737736
657 2916073582 2916068649 Bacteria 6943657
658 2916080606 2916076590 Bacteria 6596108
659 2919105374 2919100787 Bacteria 7710546
660 2919411058 2919408235 Bacteria 6149349
661 2920760331 2920760137 Bacteria 7427611
662 2921207994 2921201388 Bacteria 6926299
663 2921215121 2921208531 Bacteria 6745326
664 2921249040 2921244191 Bacteria 6568419
665 2921252921 2921250672 Bacteria 6677771
666 2921260230 2921257292 Bacteria 6808382
667 2921266337 2921263974 Bacteria 6864552
668 2921286992 2921282425 Bacteria 6826397
669 2921296109 2921289301 Bacteria 7316391
670 2921303388 2921296804 Bacteria 7176999
671 2923559503 2923556063 Bacteria 6793593
672 2924149537 2924144063 Bacteria 6883928
673 2924157562 2924150972 Bacteria 7169444
674 2924163228 2924158325 Bacteria 7188855
675 2924169664 2924165586 Bacteria 7260590
676 2924174209 2924172951 Bacteria 6749356
677 2924181858 2924179722 Bacteria 6843264
678 2924187841 2924186466 Bacteria 6876637
679 2924193583 2924193448 Bacteria 6955718
680 2924201767 2924200457 Bacteria 6757188
681 2924207692 2924207177 Bacteria 6917007
682 2924219002 2924214083 Bacteria 7080103
683 2924225845 2924221636 Bacteria 7113495
684 2924235321 2924228884 Bacteria 6633132
685 2933017014 2933016740 Bacteria 6355406
686 2933572373 2933570622 Bacteria 7023390
687 2933593128 2933586486 Bacteria 7667493
688 2933603036 2933599457 Bacteria 5858799
689 2935903648 2935901341 Bacteria 7341747
690 2936369876 2936367885 Bacteria 7324495
691 2936379061 2936375103 Bacteria 6652732
692 2936998951 2936996657 Bacteria 6298727
693 2937006626 2937002841 Bacteria 6934057
694 2937015560 2937009748 Bacteria 6746052
695 2937017819 2937016420 Bacteria 6782579
696 2937023277 2937023124 Bacteria 6815156
697 2937031841 2937029754 Bacteria 6424026
698 2937036228 2937036028 Bacteria 6846469
699 2937048426 2937042894 Bacteria 6741576
700 2937050998 2937049772 Bacteria 6757901
701 2937060056 2937056579 Bacteria 7107896
702 2937065784 2937063883 Bacteria 7199456
703 2937077390 2937071275 Bacteria 6984483
704 2937082064 2937078374 Bacteria 6610289
705 2937090002 2937084907 Bacteria 6618516
706 2937098079 2937091812 Bacteria 6979387
707 2937101281 2937098957 Bacteria 7249374
708 2937109122 2937106411 Bacteria 6947143
709 2937114144 2937113482 Bacteria 6505872
710 2937120146 2937119839 Bacteria 6597547
711 2937127729 2937126314 Bacteria 6771275
712 2941501358 2941499720 Bacteria 7599444
713 2957381811 2957375807 Bacteria 6425588
714 2957384587 2957382221 Bacteria 6737050
715 2957395293 2957388812 Bacteria 6778072
716 2957396065 2957395598 Bacteria 6822399
717 2957404444 2957402308 Bacteria 6741770
718 2957411810 2957408893 Bacteria 6558585
719 2957416552 2957415311 Bacteria 6991633
720 2957428732 2957422303 Bacteria 7172205
721 2957432013 2957430029 Bacteria 7022557
722 2957442070 2957437181 Bacteria 6568994
723 2957450305 2957443900 Bacteria 6869977
724 2957451367 2957450854 Bacteria 6765715
725 2957460902 2957457609 Bacteria 6967680
726 2957470934 2957464669 Bacteria 6568877
727 2957474154 2957471148 Bacteria 6797643
728 2957479370 2957478035 Bacteria 6756658
729 2957489726 2957484790 Bacteria 6703082
730 2957494533 2957491536 Bacteria 6695180
731 2957504939 2957498199 Bacteria 7126688
732 2957512223 2957505466 Bacteria 7253085
733 2960585374 2960584000 Bacteria 6864594
734 2960592252 2960591022 Bacteria 6622873
735 2960597995 2960597568 Bacteria 6550735
736 2960609780 2960603979 Bacteria 6898737
737 2960613316 2960610863 Bacteria 6691244
738 2960618316 2960617483 Bacteria 6727748
739 2960629375 2960624210 Bacteria 6875384
740 2960633796 2960631154 Bacteria 6732508
741 2960643779 2960637947 Bacteria 7296468
742 2960647557 2960645483 Bacteria 7211087
743 2960659398 2960652885 Bacteria 7083688
744 2960666843 2960660292 Bacteria 7041660
745 2960673192 2960667422 Bacteria 6763020
746 2960674606 2960674078 Bacteria 6609048
747 2960682359 2960680706 Bacteria 6624464
748 2960688320 2960687367 Bacteria 6535474
749 2960698215 2960693952 Bacteria 6749742
750 2964609519 2964607997 Bacteria 7101408
751 2964617067 2964615318 Bacteria 6809089
752 2964627107 2964621998 Bacteria 6834995
753 2964633247 2964628898 Bacteria 7083044
754 2964641596 2964636051 Bacteria 7091832
755 2964648838 2964643177 Bacteria 6820887
756 2964656298 2964649959 Bacteria 6675118
757 2964659603 2964656573 Bacteria 7100150
758 2964669303 2964663802 Bacteria 7019362
759 2964673368 2964670856 Bacteria 6851364
760 2964681260 2964678106 Bacteria 6792020
761 2964686140 2964685014 Bacteria 6839111
762 2964695045 2964691889 Bacteria 6802758
763 2964702445 2964698721 Bacteria 6765331
764 2964705928 2964705432 Bacteria 7114648
765 2964712758 2964712639 Bacteria 6695970
766 2964726707 2964719344 Bacteria 7286602
767 2967670607 2967664464 Bacteria 6948836
768 2967678285 2967671571 Bacteria 7021409
769 2967681726 2967678726 Bacteria 7264382
770 2967690231 2967686174 Bacteria 6678622
771 2967699302 2967693043 Bacteria 6804451
772 2967705980 2967699805 Bacteria 6854538
773 2967713292 2967706974 Bacteria 7186053
774 2967718991 2967714385 Bacteria 7000047
775 2967723890 2967721400 Bacteria 7073753
776 2967730842 2967728569 Bacteria 6641507
777 2967738366 2967735183 Bacteria 6827012
778 2967748307 2967742019 Bacteria 6794534
779 2967753961 2967748971 Bacteria 6733771
780 2967757437 2967755722 Bacteria 6814706
781 2967764233 2967762386 Bacteria 6923502
782 2967775610 2967769361 Bacteria 6587838
783 2967776590 2967775926 Bacteria 6738189
784 2970023622 2970019648 Bacteria 7072033
785 2970029554 2970026789 Bacteria 6785236
786 2970040559 2970033650 Bacteria 7118744
787 2970044921 2970040964 Bacteria 6731123
788 2970049480 2970047711 Bacteria 7088379
789 2970058934 2970054988 Bacteria 6611507
790 2970062047 2970061556 Bacteria 7099761
791 2970070262 2970068827 Bacteria 7123112
792 2970082677 2970076120 Bacteria 6697332
793 2970086261 2970082768 Bacteria 6183754
794 2970092841 2970088815 Bacteria 6933825
795 2970096718 2970095765 Bacteria 6936963
796 2970107018 2970102677 Bacteria 6812532
797 2970112987 2970109326 Bacteria 6863976
798 2970116841 2970116247 Bacteria 6501857
799 2970133619 2970129317 Bacteria 6806560
800 2970139754 2970136068 Bacteria 7207982
801 2970143585 2970143518 Bacteria 6446480
802 2970152930 2970149975 Bacteria 6779706
803 2970158010 2970156795 Bacteria 7168044
804 2970170852 2970164137 Bacteria 6861252
805 2970181237 2970177841 Bacteria 6768001
806 2970185467 2970184632 Bacteria 7054431
807 2970192205 2970191845 Bacteria 7032787
808 2977519725 2977516862 Bacteria 6940108
809 2977525202 2977523885 Bacteria 6960446
810 2977535065 2977530762 Bacteria 6951399
811 2977544568 2977537788 Bacteria 6929320
812 2977550610 2977544691 Bacteria 6875412
813 2977553186 2977551784 Bacteria 7125765
814 2977562172 2977558990 Bacteria 6863948
815 2977571213 2977565890 Bacteria 6901543
816 2977573736 2977572785 Bacteria 6763888
817 2977582937 2977579622 Bacteria 6772100
818 2996890227 2996887358 Bacteria 5795980
819 2996895267 2996893221 Bacteria 5823108
820 3005415784 3005409236 Bacteria 7188837
821 3005421630 3005416602 Bacteria 7064308
822 3005449646 3005445848 Bacteria 6906074
823 3005455929 3005452660 Bacteria 5889319
824 643827419 643692032 Bacteria 6891900
825 648737214 648276728 Bacteria 6968865
826 8003995356 8003992118 Bacteria 7266902
827 8004003097 8003999396 Bacteria 7063185
828 8005262411 8005258706 Bacteria 6184835
829 8005286762 8005282627 Bacteria 6675747
830 8005305949 8005301065 Bacteria 6614431
831 8005313685 8005307578 Bacteria 7395396
832 8005319665 8005314921 Bacteria 7072929
833 8005324754 8005321885 Bacteria 5795980
834 8005381581 8005376324 Bacteria 6590079
835 8005387785 8005382845 Bacteria 6732062
836 8005400821 8005395548 Bacteria 6806915
837 8005431092 8005430974 Bacteria 6689030
838 8005465083 8005460587 Bacteria 7157962
839 8005490287 8005484373 Bacteria 6297373
840 8005497660 8005497431 Bacteria 6477605
841 8005546658 8005542996 Bacteria 7077758
842 8005561158 8005556819 Bacteria 6908598
843 8005565783 8005563573 Bacteria 7153261
844 8005623394 8005619151 Bacteria 7030230
845 8005631026 8005626139 Bacteria 6534237
846 8005646943 8005645114 Bacteria 6950293
847 8005669065 8005668836 Bacteria 6953162
848 8005688092 8005682033 Bacteria 6726518
849 8005694352 8005688590 Bacteria 6610080
850 8018128897 8018127388 Bacteria 7351159
851 8018153348 8018150411 Bacteria 5549903
852 8018165103 8018163183 Bacteria 7277977
853 8024490837 8024486573 Bacteria 6540512
854 8045868830 8045864390 Bacteria 5043873
855 8046767218 8046767195 Bacteria 7547379
856 8049296305 8049293176 Bacteria 6128433
857 8056385232 8056382006 Bacteria 6408074
858 8057879274 8057874678 Bacteria 7494653
859 Ga0500568_0018858
860 JGI24740J21852_10000013
861 JGI25155J39150_1000010
862 JGI25156J39149_1000102
863 JGI25162J39368_1002159
864 JGI25162J39368_1002243
865 JGI25154J39366_1000096
866 JGI25158J39367_1000116
867 JGI25157J39369_1000009
868 JGI25152J39213_1000706
869 JGI25152J39213_1007127
870 JGI25152J39213_1007848
871 JGI25152J39213_1008840
872 JGI25152J39213_1012669
873 JGI25150J39212_1000476
874 JGI25150J39212_1002674
875 JGI25159J45721_1000017
876 JGI25159J45721_1002450
877 JGI25151J46595_10001324
878 JGI25151J46595_10030328
879 JGI25151J46595_10049041
880 JGI25151J46595_10082245
881 JGI25151J46595_10091008
882 JGI25165J46597_1001449
883 JGI25165J46597_1002377
884 JGI25165J46597_1009692
885 JGI25153J46596_10007490
886 JGI25153J46596_10020908
887 JGI25153J46596_10027254
888 JGI25153J46596_10029782
889 JGI25153J46596_10031300
890 rootH2_10036173
891 rootH1_10077152
892 JGI25160J50197_1000027
893 JGI25160J50197_1005614
894 JGI25161J50226_1000327
895 JGI25161J50226_1000501
896 Ga0055526_1001473
897 Ga0055526_1007862
898 Ga0055526_1008010
899 Ga0055526_1010107
900 Ga0055524_1002650
901 Ga0055524_1003843
902 Ga0055524_1004200
903 Ga0055524_1005420
904 Ga0055524_1019722
905 Ga0055524_1024992
906 Ga0055524_1026436
907 Ga0055536_1001323
908 Ga0055528_1000099
909 Ga0055528_1002777
910 Ga0055528_1003641
911 Ga0055530_10012308
912 Ga0055531_10021365
913 Ga0055531_10070288
914 Ga0058692_1013788
915 Ga0055543_1000030
916 Ga0055543_1000062
917 Ga0065165_1000122
918 Ga0065165_1009930
919 Ga0065165_1016892
920 Ga0065165_1024067
921 Ga0070658_10300960
922 Ga0070670_100000116
923 Ga0070666_10234458
924 Ga0070668_100509774
925 Ga0070669_100203183
926 Ga0070675_100504686
927 Ga0070671_100007506
928 Ga0070667_100288411
929 Ga0070700_100101754
930 Ga0068867_100106810
931 Ga0068853_100380672
932 Ga0070665_100520214
933 Ga0068854_100102539
934 Ga0068856_100187406
935 Ga0070702_100008268
936 Ga0068859_100352685
937 Ga0068861_100021921
938 Ga0068851_10019658
939 Ga0068858_100231005
940 Ga0068862_100022876
941 Ga0075365_10000498
942 Ga0075365_10357341
943 Ga0075368_10027222
944 Ga0075362_10168511
945 Ga0075367_10004009
946 Ga0075367_10208516
947 Ga0075369_10002071
948 Ga0075369_10139210
949 Ga0075370_10011795
950 Ga0075370_10209238
951 Ga0068871_100660497
952 Ga0068865_100089107
953 Ga0097620_100352674
954 Ga0105251_10017043
955 Ga0105250_10029222
956 Ga0105250_10264039
957 Ga0105240_10000013
958 Ga0111539_10078411
959 Ga0111539_10087317
960 Ga0105245_10000318
961 Ga0105247_10151798
962 Ga0105243_10020943
963 Ga0105248_10119214
964 Ga0105237_10012810
965 Ga0105237_10768513
966 Ga0105237_10994329
967 Ga0105238_10446000
968 Ga0105249_10129204
969 Ga0123341_1077843
970 Ga0105239_10000820
971 Ga0105246_10046692
972 Ga0157370_10005427
973 Ga0157369_10835614
974 Ga0157378_10025049
975 Ga0157378_10393336
976 Ga0157375_10357049
977 Ga0163163_10609719
978 Ga0157380_10388760
979 Ga0182008_10083407
980 Ga0157376_10245906
981 Ga0182007_10002575
982 Ga0182005_1004658
983 Ga0163161_10042233
984 Ga0163161_10076548
985 Ga0214544_1000288
986 Ga0214542_1000008
987 Ga0214542_1029224
988 Ga0214543_1000015
989 Ga0214543_1000031
990 Ga0209435_100009
991 Ga0209760_103523
992 Ga0209436_100018
993 Ga0209436_100664
994 Ga0209672_103233
995 Ga0207427_114073
996 Ga0209437_100057
997 Ga0209437_100107
998 Ga0209437_104595
999 Ga0207425_1000553
1000 Ga0207425_1002143
1001 Ga0207425_1009172
1002 Ga0207425_1020102
1003 Ga0207425_1040725
1004 Ga0209646_1000018
1005 Ga0209646_1015814
1006 Ga0209026_1000068
1007 Ga0209677_104031
1008 Ga0209759_1000007
1009 Ga0209129_1000118
1010 Ga0209129_1000717
1011 Ga0209129_1000971
1012 Ga0209129_1003196
1013 Ga0209129_1003252
1014 Ga0209129_1004160
1015 Ga0209129_1015557
1016 Ga0209233_1000130
1017 Ga0209233_1000358
1018 Ga0209233_1000531
1019 Ga0209673_1000033
1020 Ga0209673_1000050
1021 Ga0209673_1004625
1022 Ga0209673_1005860
1023 Ga0209673_1037831
1024 Ga0209130_1000009
1025 Ga0209130_1000027
1026 Ga0209130_1008796
1027 Ga0209130_1030926
1028 Ga0209675_1028441
1029 Ga0209676_1000406
1030 Ga0209025_1000241
1031 Ga0209025_1002217
1032 Ga0209025_1002221
1033 Ga0209025_1005633
1034 Ga0209025_1013935
1035 Ga0209025_1015409
1036 Ga0209025_1027717
1037 Ga0209025_1105110
1038 Ga0209564_1000111
1039 Ga0209564_1000782
1040 Ga0209564_1003367
1041 Ga0209758_1001085
1042 Ga0209758_1001086
1043 Ga0209758_1001953
1044 Ga0209758_1002520
1045 Ga0209758_1015745
1046 Ga0209758_1044585
1047 Ga0209050_1000572
1048 Ga0209256_1001743
1049 Ga0209256_1003544
1050 Ga0209256_1003766
1051 Ga0209256_1007283
1052 Ga0209256_1007659
1053 Ga0209256_1012473
1054 Ga0209256_1040854
1055 Ga0207426_1000041
1056 Ga0207426_1000072
1057 Ga0207426_1001232
1058 Ga0209051_1001068
1059 Ga0209051_1006368
1060 Ga0209051_1009487
1061 Ga0209051_1081467
1062 Ga0209257_1002707
1063 Ga0209257_1020143
1064 Ga0209257_1029438
1065 Ga0209257_1045375
1066 Ga0207656_10028222
1067 Ga0207680_10387845
1068 Ga0207695_10000044
1069 Ga0207671_10000400
1070 Ga0207681_10021367
1071 Ga0207681_10891874
1072 Ga0207650_10000691
1073 Ga0207687_10000398
1074 Ga0207709_10008378
1075 Ga0207709_10043700
1076 Ga0207669_10054812
1077 Ga0207704_10083333
1078 Ga0207712_10072186
1079 Ga0207668_10003241
1080 Ga0207668_10115428
1081 Ga0207640_10124181
1082 Ga0207658_10238775
1083 Ga0207703_10541700
1084 Ga0207678_10652719
1085 Ga0207702_10170624
1086 Ga0207675_100037533
1087 Ga0207698_11128353
1088 Ga0209281_1000144
1089 Ga0209371_1003285
1090 Ga0268266_10004208
1091 Ga0268265_10027018
1092 Ga0268264_10501188
1093 Ga0307515_10001330
1094 Ga0268256_1003721
1095 Ga0307513_10005665
1096 Ga0307509_10046214
1097 Ga0307408_100049613
1098 Ga0307405_10003191
1099 Ga0307405_10043558
1100 Ga0307410_10026303
1101 Ga0307406_10001146
1102 Ga0307407_10471978
1103 Ga0307412_10049133
1104 Ga0307412_10091473
1105 Ga0307409_100152956
1106 Ga0307416_100195516
1107 Ga0307416_100412784
1108 Ga0439436_0031360
1109 Ga0439436_0039888
1110 Ga0439438_076479
1111 Ga0439465_0003192
1112 Ga0439465_0021316
1113 Ga0439465_0024058
1114 Ga0439465_0033814
1115 Ga0439465_0040129
1116 Ga0439465_0070310
1117 Ga0451802_1942730
1118 Ga0451807_2434037
1119 Ga0451837_0113530
1120 Ga0451837_0640748
1121 Ga0451841_0606347
1122 Ga0451845_0072877
1123 Ga0451847_0157273
1124 Ga0439433_0095868
1125 Ga0439449_0001259
1126 Ga0439449_0011037
1127 Ga0450919_018777
1128 Ga0439434_0007818
1129 Ga0466971_0150338
1130 Ga0466957_0045595
1131 Ga0466959_0321279
1132 Ga0466958_0071590
1133 Ga0495592_0027176
1134 Ga0495603_0160518
1135 Ga0495629_0012949
1136 Ga0495638_0003269
1137 Ga0495605_0002525
1138 Ga0495662_0002948
1139 Ga0495664_0069731
1140 Ga0495585_0079696
1141 Ga0495585_0382759
1142 Ga0495607_0043296
1143 Ga0495583_0020888
1144 Ga0495583_0030217
1145 Ga0495606_0002721
1146 Ga0495606_0065112
1147 Ga0495606_0067996
1148 Ga0495606_0069944
1149 Ga0495610_0018390
1150 Ga0495610_0025605
1151 Ga0495610_0028473
1152 Ga0495616_0020903
1153 Ga0495620_0071384
1154 Ga0495620_0103809
1155 Ga0495620_0134729
1156 Ga0495631_0002242
1157 Ga0495632_0009845
1158 Ga0495632_0018201
1159 Ga0495632_0028409
1160 Ga0495632_0066458
1161 Ga0495643_0009187
1162 Ga0495643_0080205
1163 Ga0495643_0133875
1164 Ga0495644_0156944
1165 Ga0495663_0032664
1166 Ga0495654_0036910
1167 Ga0495654_0150171
1168 Ga0495587_0043343
1169 Ga0495597_0117664
1170 Ga0495597_0122656
1171 Ga0495622_0056449
1172 Ga0495633_0038878
1173 Ga0495633_0043486
1174 Ga0495656_0017308
1175 Ga0495668_0006323
1176 Ga0495668_0033189
1177 Ga0495668_0086219
1178 Ga0495668_0393635
1179 Ga0495625_0004490
1180 Ga0495625_0030505
1181 Ga0495661_0173689
1182 Ga0495588_0176320
1183 Ga0495657_0040807
1184 Ga0495624_0076566
1185 Ga0495670_0077090
1186 Ga0495671_0015746
1187 Ga0495649_0070475
1188 Ga0495660_0210913
1189 Ga0495604_0030094
1190 Ga0495636_0075163
1191 Ga0495683_0118278
1192 Ga0495687_052212
1193 Ga0495677_0096983
1194 Ga0495673_0060008
1195 Ga0495686_0015554
1196 Ga0495686_0022064
1197 Ga0495686_0034308
1198 Ga0495686_0038018
1199 Ga0495686_0224123
1200 Ga0495686_0265488
1201 Ga0496100_0351798
1202 Ga0496103_0064585
1203 Ga0496106_0004976
1204 Ga0496106_0384312
1205 Ga0496107_0046967
1206 Ga0496109_0170455
1207 Ga0496114_0080244
1208 Ga0496116_0004254
1209 Ga0496116_0043890
1210 Ga0496116_0046733
1211 Ga0496116_0312108
1212 Ga0496117_0002097
1213 Ga0496117_0019389
1214 Ga0496117_0022854
1215 Ga0496117_0359750
1216 Ga0496118_0000606
1217 Ga0496118_0002291
1218 Ga0496118_0018393
1219 Ga0496118_0041571
1220 Ga0496118_0080335
1221 Ga0496118_0097285
1222 Ga0496118_0404497
1223 Ga0496119_0006994
1224 Ga0496119_0063845
1225 Ga0496121_0017407
1226 Ga0496121_0018473
1227 Ga0496121_0027371
1228 Ga0496121_0038490
1229 Ga0496121_0044056
1230 Ga0496121_0050403
1231 Ga0496121_0067368
1232 Ga0496121_0103185
1233 Ga0496121_0153978
1234 Ga0496122_0009143
1235 Ga0496122_0021693
1236 Ga0496122_0022747
1237 Ga0496122_0137693
1238 Ga0496122_0157446
1239 Ga0496122_0214912
1240 Ga0496123_0008746
1241 Ga0496123_0037961
1242 Ga0496123_0072166
1243 Ga0496123_0255241
1244 Ga0496124_0006102
1245 Ga0496124_0021210
1246 Ga0496124_0088136
1247 Ga0496124_0089409
1248 Ga0496124_0123928
1249 Ga0496124_0197867
1250 Ga0496125_0027541
1251 Ga0496125_0027792
1252 Ga0496125_0223750
1253 Ga0496125_0414032
1254 Ga0496126_0143939
1255 Ga0496126_0151149
1256 Ga0496126_0270304
1257 Ga0496126_0837315
1258 Ga0495678_006181
1259 Ga0495678_025159
1260 Ga0501032_0087494
1261 Ga0501032_0108822
1262 Ga0501034_0355085
1263 Ga0501036_0269710
1264 Ga0501037_0226858
1265 Ga0501047_0181563
1266 Ga0501068_0179507
1267 Ga0501073_0189847
1268 Ga0501044_0179878
1269 nmdc:mga00v17_401984_c1
1270 nmdc:mga06z11_323144_c1
1271 nmdc:mga07m45_278923_c1
1272 nmdc:mga07m45_346612_c1
1273 nmdc:mga08y16_93195_c1
1274 nmdc:mga0sz30_32333_c1
1275 Ga0495601_0086094
1276 Ga0500610_0012502
1277 Ga0495619_0085068
1278 Ga0500578_0067685
1279 Ga0500578_0255107
1280 Ga0500644_0146997
1281 Ga0500641_0086745
1282 Ga0500557_055562
1283 Ga0500569_015174
1284 Ga0500569_089159
1285 Ga0500569_112320
1286 Ga0500618_002740
1287 Ga0500618_019083
1288 Ga0500658_0000309
1289 Ga0500658_0018303
1290 Ga0500559_0041933
1291 Ga0500568_0008863
1292 Ga0500568_0018252
1293 Ga0500573_0000290
1294 Ga0500573_0000334
1295 Ga0500588_0202363
1296 Ga0500590_017695
1297 Ga0500604_0009869
1298 Ga0500616_0007819
1299 Ga0500616_0020147
1300 Ga0500622_0003318
1301 Ga0500624_000002
1302 Ga0500627_0159258
1303 Ga0500636_0238701
1304 Ga0501082_0107843
1305 2509109585
1306 2509378091
1307 2510135234
1308 2510306719
1309 2511183986
1310 2511194590
1311 2511498490
1312 2512534631
1313 2513571618
1314 2513578652
1315 2513583652
1316 2513596817
1317 2513601920
1318 2513615725
1319 2513630163
1320 2513867468
1321 2513884980
1322 2513905190
1323 2513912367
1324 2513928448
1325 2513988040
1326 2514003480
1327 2515114392
1328 2515611063
1329 2515635395
1330 2515643197
1331 2515741576
1332 2516205573
1333 2516894770
1334 2517038042
1335 2517078306
1336 2517097065
1337 2517408551
1338 2517571435
1339 2520376399
1340 2524450419
1341 2535519009
1342 2551676624
1343 2551680248
1344 2551685078
1345 2551694478
1346 2551697730
1347 2551708357
1348 2551717608
1349 2551731609
1350 2551736193
1351 2551746080
1352 2558867408
1353 2561467078
1354 2585201750
1355 2585223911
1356 2585228753
1357 2585257360
1358 2585271651
1359 2585280712
1360 2585326497
1361 2585334160
1362 2585396086
1363 2585399736
1364 2585531646
1365 2585549134
1366 2585551407
1367 2585563109
1368 2585820823
1369 2585844863
1370 2585907327
1371 2587982679
1372 2599335113
1373 2599420160
1374 2600193361
1375 2616296327
1376 2616306743
1377 2616557589
1378 2617383261
1379 2643808059
1380 2644002458
1381 2644068752
1382 2644110158
1383 2644150434
1384 2644194836
1385 2644240516
1386 2644313038
1387 2644336586
1388 2644379493
1389 2644419822
1390 2644453179
1391 2644546233
1392 2644618768
1393 2644677087
1394 2644688793
1395 2657682400
1396 2671113485
1397 2692319952
1398 2719182951
1399 2719667296
1400 2719733668
1401 2720493716
1402 2720615169
1403 2720621964
1404 2720633314
1405 2720777012
1406 2721149063
1407 2721160461
1408 2721165876
1409 2722842046
1410 2723028610
1411 2723562214
1412 2723568917
1413 2724046424
1414 2724091619
1415 2724106182
1416 2724111988
1417 2725947525
1418 2730109546
1419 2730166186
1420 2730300093
1421 2738801181
1422 2753462456
1423 2766064280
1424 2778173741
1425 2792582250
1426 2792621902
1427 2792628841
1428 2792639985
1429 2793295640
1430 2793320708
1431 2793327271
1432 2793332225
1433 2793346588
1434 2793353873
1435 2802717198
1436 2802724813
1437 2802729564
1438 2802736910
1439 2802743315
1440 2802749559
1441 2804753707
1442 2805926203
1443 2819611234
1444 2819638837
1445 2838018344
1446 2838024027
1447 2838030923
1448 2838040366
1449 2838050794
1450 2838062560
1451 2838072111
1452 2838078175
1453 2838667780
1454 2838672152
1455 2838690269
1456 2838704978
1457 2838732044
1458 2838744940
1459 2841855998
1460 2842116867
1461 2842148786
1462 2842161168
1463 2842166680
1464 2842184784
1465 2842201620
1466 2842232366
1467 2842246782
1468 2842254659
1469 2842261117
1470 2842269626
1471 2842274289
1472 2842288506
1473 2842305868
1474 2842311398
1475 2842406148
1476 2842412733
1477 2842419388
1478 2842425743
1479 2842433612
1480 2842439940
1481 2842446569
1482 2842448793
1483 2842467922
1484 2842474549
1485 2842477655
1486 2842484961
1487 2842491152
1488 2842504472
1489 2842926303
1490 2844166246
1491 2844457032
1492 2847420824
1493 2848995650
1494 2850082647
1495 2855827398
1496 2855842776
1497 2855878187
1498 2857519561
1499 2858802114
1500 2896390204
1501 2913300192
1502 2915982411
1503 2915992774
1504 2915999337
1505 2916002821
1506 2916010604
1507 2916018156
1508 2916023832
1509 2916034386
1510 2916040399
1511 2916045407
1512 2916050743
1513 2916056762
1514 2916064997
1515 2916073582
1516 2916080606
1517 2919105374
1518 2919411058
1519 2920760331
1520 2921207994
1521 2921215121
1522 2921249040
1523 2921252921
1524 2921260230
1525 2921266337
1526 2921286992
1527 2921296109
1528 2921303388
1529 2923559503
1530 2924149537
1531 2924157562
1532 2924163228
1533 2924169664
1534 2924174209
1535 2924181858
1536 2924187841
1537 2924193583
1538 2924201767
1539 2924207692
1540 2924219002
1541 2924225845
1542 2924235321
1543 2933017014
1544 2933572373
1545 2933593128
1546 2933603036
1547 2935903648
1548 2936369876
1549 2936379061
1550 2936998951
1551 2937006626
1552 2937015560
1553 2937017819
1554 2937023277
1555 2937031841
1556 2937036228
1557 2937048426
1558 2937050998
1559 2937060056
1560 2937065784
1561 2937077390
1562 2937082064
1563 2937090002
1564 2937098079
1565 2937101281
1566 2937109122
1567 2937114144
1568 2937120146
1569 2937127729
1570 2941501358
1571 2957381811
1572 2957384587
1573 2957395293
1574 2957396065
1575 2957404444
1576 2957411810
1577 2957416552
1578 2957428732
1579 2957432013
1580 2957442070
1581 2957450305
1582 2957451367
1583 2957460902
1584 2957470934
1585 2957474154
1586 2957479370
1587 2957489726
1588 2957494533
1589 2957504939
1590 2957512223
1591 2960585374
1592 2960592252
1593 2960597995
1594 2960609780
1595 2960613316
1596 2960618316
1597 2960629375
1598 2960633796
1599 2960643779
1600 2960647557
1601 2960659398
1602 2960666843
1603 2960673192
1604 2960674606
1605 2960682359
1606 2960688320
1607 2960698215
1608 2964609519
1609 2964617067
1610 2964627107
1611 2964633247
1612 2964641596
1613 2964648838
1614 2964656298
1615 2964659603
1616 2964669303
1617 2964673368
1618 2964681260
1619 2964686140
1620 2964695045
1621 2964702445
1622 2964705928
1623 2964712758
1624 2964726707
1625 2967670607
1626 2967678285
1627 2967681726
1628 2967690231
1629 2967699302
1630 2967705980
1631 2967713292
1632 2967718991
1633 2967723890
1634 2967730842
1635 2967738366
1636 2967748307
1637 2967753961
1638 2967757437
1639 2967764233
1640 2967775610
1641 2967776590
1642 2970023622
1643 2970029554
1644 2970040559
1645 2970044921
1646 2970049480
1647 2970058934
1648 2970062047
1649 2970070262
1650 2970082677
1651 2970086261
1652 2970092841
1653 2970096718
1654 2970107018
1655 2970112987
1656 2970116841
1657 2970133619
1658 2970139754
1659 2970143585
1660 2970152930
1661 2970158010
1662 2970170852
1663 2970181237
1664 2970185467
1665 2970192205
1666 2977519725
1667 2977525202
1668 2977535065
1669 2977544568
1670 2977550610
1671 2977553186
1672 2977562172
1673 2977571213
1674 2977573736
1675 2977582937
1676 2996890227
1677 2996895267
1678 3005415784
1679 3005421630
1680 3005449646
1681 3005455929
1682 643827419
1683 648737214
1684 8003995356
1685 8004003097
1686 8005262411
1687 8005286762
1688 8005305949
1689 8005313685
1690 8005319665
1691 8005324754
1692 8005381581
1693 8005387785
1694 8005400821
1695 8005431092
1696 8005465083
1697 8005490287
1698 8005497660
1699 8005546658
1700 8005561158
1701 8005565783
1702 8005623394
1703 8005631026
1704 8005646943
1705 8005669065
1706 8005688092
1707 8005694352
1708 8018128897
1709 8018153348
1710 8018165103
1711 8024490837
1712 8045868830
1713 8046767218
1714 8049296305
1715 8056385232
1716 8057879274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10755

DUF2585

Protein of unknown function (DUF2585)

62

225

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rv0-assembly1.cif.gz_A crystal structure of k. polysporus dcr1 without the c-terminal dsrbd 0.4439 65 173
3rv0-assembly2.cif.gz_D crystal structure of k. polysporus dcr1 without the c-terminal dsrbd 0.3728 65 173
3rv0-assembly2.cif.gz_C crystal structure of k. polysporus dcr1 without the c-terminal dsrbd 0.3676 65 173
6zoo-assembly1.cif.gz_L photosystem i reduced plastocyanin complex 0.3378 67 175
7ytj-assembly1.cif.gz_A cryo-em structure of vtc complex 0.3295 67 149
ID Description Score Start End Superfamily
3rv0A02 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.4439 65 173 1.10.1520.10
af_P34356_122_311_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.4359 70 150 1.20.1540.10
af_Q2FZ50_16_166_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.4193 65 150 1.10.1520.10
af_Q8IXF9_8_246_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.4184 67 149 1.20.1080.10
af_O44695_7_274_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4066 74 150 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2W6T3M0-F1-model_v4 Uncharacterized protein 0.9697 17 181 GO:0005886
AF-A0A2V8G5G7-F1-model_v4 DUF2585 domain-containing protein 0.9674 17 178 GO:0005886
AF-A0A532BX12-F1-model_v4 DUF2585 domain-containing protein 0.9612 9 183 GO:0005886
AF-A0A353YGZ0-F1-model_v4 DUF2585 family protein 0.9604 16 145 GO:0005886
AF-A0A5R2N459-F1-model_v4 DUF2585 domain-containing protein 0.9598 1 153 GO:0005886

Map