F483774
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 859 | 344 | 859 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300015262|Ga0182007_10037631|Ga0182007_100376312 |
| Length | 304 |
| Sequence | VRDGSSGIRADPIRGFQRDKNWAVANAAVAAPLPRRPAGRVALVLAVVVVLLGLWELYRWVWTSAXXXWPFLVNDTSMPHIWTIAKAFGEPAQVNQPALITVLLHKTLFTAKEAAAGFGIGALVHSRLLQRGFLPYIVGSQTVPILAIAPMVVVWVNPKLPGPFQGWGAVAVIAAYLTFFPVAINTLRGLQSADPRALELMRTYAASRWSVLWKLRVPTSLPFVFSALRLAATASVVGAIIGELPSGLQDGLGGAIINFNQYYSIEPQELWATNVIAALLGIAFFVIVVLAERIVVRRAPENVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 101 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 224 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 225 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 226 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 227 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 228 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 229 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 230 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 231 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 232 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 233 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 234 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 296 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 344 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.42 |
| Metatranscriptomes | 0.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.38 |
| Rhizosphere | 91.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10012998 | 3300002075 | Bacteria | 1809 |
| 2 | JGI24749J21850_1005718 | 3300002076 | Bacteria | 1736 |
| 3 | JGI24033J26618_1006159 | 3300002155 | Bacteria | 1340 |
| 4 | JGI24742J22300_10026290 | 3300002244 | Bacteria | 1007 |
| 5 | rootH1_10298486 | 3300003323 | Bacteria | 1329 |
| 6 | Ga0070683_100013597 | 3300005329 | Bacteria | 7102 |
| 7 | Ga0070683_100022464 | 3300005329 | Bacteria | 5639 |
| 8 | Ga0070683_100036210 | 3300005329 | Bacteria | 4515 |
| 9 | Ga0070683_100042523 | 3300005329 | Bacteria | 4184 |
| 10 | Ga0070683_100056634 | 3300005329 | Bacteria | 3640 |
| 11 | Ga0070683_100063871 | 3300005329 | Bacteria | 3426 |
| 12 | Ga0070683_100091183 | 3300005329 | Bacteria | 2862 |
| 13 | Ga0070683_100105441 | 3300005329 | Bacteria | 2657 |
| 14 | Ga0070683_100171743 | 3300005329 | Bacteria | 2058 |
| 15 | Ga0070683_100193485 | 3300005329 | Bacteria | 1931 |
| 16 | Ga0070683_100205643 | 3300005329 | Bacteria | 1870 |
| 17 | Ga0070670_100002873 | 3300005331 | Bacteria | 14260 |
| 18 | Ga0070670_100093877 | 3300005331 | Bacteria | 2580 |
| 19 | Ga0070670_100148623 | 3300005331 | Bacteria | 2027 |
| 20 | Ga0070670_100286507 | 3300005331 | Bacteria | 1439 |
| 21 | Ga0068869_100020150 | 3300005334 | Bacteria | 4568 |
| 22 | Ga0068869_100317021 | 3300005334 | Bacteria | 1263 |
| 23 | Ga0070666_10129238 | 3300005335 | Bacteria | 1755 |
| 24 | Ga0070680_100003799 | 3300005336 | Bacteria | 11293 |
| 25 | Ga0070680_100038557 | 3300005336 | Bacteria | 3864 |
| 26 | Ga0070680_100071290 | 3300005336 | Bacteria | 2855 |
| 27 | Ga0070680_100340706 | 3300005336 | Bacteria | 1274 |
| 28 | Ga0070680_100344442 | 3300005336 | Bacteria | 1267 |
| 29 | Ga0070680_100485029 | 3300005336 | Bacteria | 1057 |
| 30 | Ga0070682_100052554 | 3300005337 | Bacteria | 2550 |
| 31 | Ga0070682_100065673 | 3300005337 | Bacteria | 2306 |
| 32 | Ga0070682_100081973 | 3300005337 | Bacteria | 2090 |
| 33 | Ga0068868_100043982 | 3300005338 | Bacteria | 3490 |
| 34 | Ga0068868_100099747 | 3300005338 | Bacteria | 2350 |
| 35 | Ga0070660_100008149 | 3300005339 | Bacteria | 7322 |
| 36 | Ga0070660_100296138 | 3300005339 | Bacteria | 1326 |
| 37 | Ga0070689_100017892 | 3300005340 | Bacteria | 5210 |
| 38 | Ga0070689_100023937 | 3300005340 | Bacteria | 4578 |
| 39 | Ga0070689_100221328 | 3300005340 | Bacteria | 1553 |
| 40 | Ga0070689_100334725 | 3300005340 | Bacteria | 1267 |
| 41 | Ga0070691_10039543 | 3300005341 | Bacteria | 2229 |
| 42 | Ga0070691_10049650 | 3300005341 | Bacteria | 1999 |
| 43 | Ga0070691_10099365 | 3300005341 | Bacteria | 1443 |
| 44 | Ga0070687_100112684 | 3300005343 | Bacteria | 1542 |
| 45 | Ga0070692_10038289 | 3300005345 | Bacteria | 2443 |
| 46 | Ga0070692_10089763 | 3300005345 | Bacteria | 1669 |
| 47 | Ga0070692_10124424 | 3300005345 | Bacteria | 1442 |
| 48 | Ga0070668_100205677 | 3300005347 | Bacteria | 1617 |
| 49 | Ga0070668_100206043 | 3300005347 | Bacteria | 1616 |
| 50 | Ga0070669_100309655 | 3300005353 | Bacteria | 1272 |
| 51 | Ga0070675_100031711 | 3300005354 | Bacteria | 4274 |
| 52 | Ga0070675_100085638 | 3300005354 | Bacteria | 2633 |
| 53 | Ga0070675_100299488 | 3300005354 | Unclassified | 1416 |
| 54 | Ga0070675_100547349 | 3300005354 | Bacteria | 1046 |
| 55 | Ga0070671_100045043 | 3300005355 | Bacteria | 3667 |
| 56 | Ga0070671_100046486 | 3300005355 | Bacteria | 3610 |
| 57 | Ga0070671_100066413 | 3300005355 | Bacteria | 3006 |
| 58 | Ga0070674_100020746 | 3300005356 | Bacteria | 4206 |
| 59 | Ga0070674_100075189 | 3300005356 | Bacteria | 2398 |
| 60 | Ga0070673_100018908 | 3300005364 | Bacteria | 4937 |
| 61 | Ga0070673_100076592 | 3300005364 | Bacteria | 2701 |
| 62 | Ga0070688_100002230 | 3300005365 | Bacteria | 9781 |
| 63 | Ga0070688_100024170 | 3300005365 | Bacteria | 3581 |
| 64 | Ga0070659_100027432 | 3300005366 | Bacteria | 4388 |
| 65 | Ga0070659_100041371 | 3300005366 | Bacteria | 3602 |
| 66 | Ga0070659_100070384 | 3300005366 | Bacteria | 2779 |
| 67 | Ga0070659_100393505 | 3300005366 | Bacteria | 1169 |
| 68 | Ga0070703_10043087 | 3300005406 | Bacteria | 1414 |
| 69 | Ga0070709_10205326 | 3300005434 | Bacteria | 1398 |
| 70 | Ga0070714_100019569 | 3300005435 | Bacteria | 5518 |
| 71 | Ga0070714_100157277 | 3300005435 | Bacteria | 2053 |
| 72 | Ga0070713_100160074 | 3300005436 | Bacteria | 2009 |
| 73 | Ga0070713_100420627 | 3300005436 | Bacteria | 1251 |
| 74 | Ga0070713_100495393 | 3300005436 | Bacteria | 1152 |
| 75 | Ga0070710_10006221 | 3300005437 | Bacteria | 5716 |
| 76 | Ga0070701_10001690 | 3300005438 | Bacteria | 8284 |
| 77 | Ga0070701_10019121 | 3300005438 | Bacteria | 3232 |
| 78 | Ga0070701_10056756 | 3300005438 | Bacteria | 2050 |
| 79 | Ga0070711_100024667 | 3300005439 | Bacteria | 3926 |
| 80 | Ga0070711_100423813 | 3300005439 | Bacteria | 1085 |
| 81 | Ga0070705_100006131 | 3300005440 | Bacteria | 5887 |
| 82 | Ga0070705_100044043 | 3300005440 | Bacteria | 2562 |
| 83 | Ga0070705_100085756 | 3300005440 | Bacteria | 1947 |
| 84 | Ga0070705_100160132 | 3300005440 | Bacteria | 1503 |
| 85 | Ga0070700_100001364 | 3300005441 | Bacteria | 12137 |
| 86 | Ga0070700_100024024 | 3300005441 | Bacteria | 3573 |
| 87 | Ga0070700_100074944 | 3300005441 | Bacteria | 2169 |
| 88 | Ga0070694_100032102 | 3300005444 | Bacteria | 3447 |
| 89 | Ga0070694_100084676 | 3300005444 | Bacteria | 2212 |
| 90 | Ga0070694_100250391 | 3300005444 | Bacteria | 1340 |
| 91 | Ga0070694_100258732 | 3300005444 | Bacteria | 1319 |
| 92 | Ga0070708_100026776 | 3300005445 | Bacteria | 4939 |
| 93 | Ga0070708_100271269 | 3300005445 | Bacteria | 1596 |
| 94 | Ga0070708_100292466 | 3300005445 | Bacteria | 1534 |
| 95 | Ga0070663_100044597 | 3300005455 | Bacteria | 3127 |
| 96 | Ga0070663_100152860 | 3300005455 | Bacteria | 1771 |
| 97 | Ga0070663_100423019 | 3300005455 | Bacteria | 1093 |
| 98 | Ga0070678_100005176 | 3300005456 | Bacteria | 7499 |
| 99 | Ga0070678_100006943 | 3300005456 | Bacteria | 6681 |
| 100 | Ga0070678_100038226 | 3300005456 | Bacteria | 3377 |
| 101 | Ga0070678_100048888 | 3300005456 | Bacteria | 3049 |
| 102 | Ga0070678_100131007 | 3300005456 | Bacteria | 1992 |
| 103 | Ga0070678_100206742 | 3300005456 | Bacteria | 1624 |
| 104 | Ga0070678_100299492 | 3300005456 | Bacteria | 1366 |
| 105 | Ga0070662_100217686 | 3300005457 | Bacteria | 1522 |
| 106 | Ga0070681_10009610 | 3300005458 | Bacteria | 9509 |
| 107 | Ga0070681_10063272 | 3300005458 | Bacteria | 3672 |
| 108 | Ga0070681_10077567 | 3300005458 | Bacteria | 3280 |
| 109 | Ga0070681_10146508 | 3300005458 | Bacteria | 2290 |
| 110 | Ga0070681_10178703 | 3300005458 | Bacteria | 2044 |
| 111 | Ga0070681_10187659 | 3300005458 | Bacteria | 1987 |
| 112 | Ga0070681_10242256 | 3300005458 | Bacteria | 1717 |
| 113 | Ga0068867_100008996 | 3300005459 | Bacteria | 7046 |
| 114 | Ga0068867_100103678 | 3300005459 | Bacteria | 2176 |
| 115 | Ga0068867_100145225 | 3300005459 | Bacteria | 1858 |
| 116 | Ga0070685_10004735 | 3300005466 | Bacteria | 6887 |
| 117 | Ga0070685_10004928 | 3300005466 | Bacteria | 6754 |
| 118 | Ga0070685_10048036 | 3300005466 | Bacteria | 2456 |
| 119 | Ga0070685_10164006 | 3300005466 | Bacteria | 1419 |
| 120 | Ga0070706_100018674 | 3300005467 | Bacteria | 6394 |
| 121 | Ga0070706_100059179 | 3300005467 | Bacteria | 3536 |
| 122 | Ga0070707_100164074 | 3300005468 | Bacteria | 2165 |
| 123 | Ga0070707_100279743 | 3300005468 | Bacteria | 1622 |
| 124 | Ga0070698_100008125 | 3300005471 | Bacteria | 11341 |
| 125 | Ga0070698_100016785 | 3300005471 | Bacteria | 7723 |
| 126 | Ga0070699_100006802 | 3300005518 | Bacteria | 9949 |
| 127 | Ga0070699_100298523 | 3300005518 | Bacteria | 1445 |
| 128 | Ga0070679_100009682 | 3300005530 | Bacteria | 9114 |
| 129 | Ga0070679_100016335 | 3300005530 | Bacteria | 7156 |
| 130 | Ga0070679_100032107 | 3300005530 | Bacteria | 5192 |
| 131 | Ga0070679_100102599 | 3300005530 | Bacteria | 2847 |
| 132 | Ga0070679_100200684 | 3300005530 | Bacteria | 1961 |
| 133 | Ga0070679_100227082 | 3300005530 | Bacteria | 1827 |
| 134 | Ga0070684_100006235 | 3300005535 | Bacteria | 9203 |
| 135 | Ga0070684_100012640 | 3300005535 | Bacteria | 6771 |
| 136 | Ga0070684_100046442 | 3300005535 | Bacteria | 3763 |
| 137 | Ga0070684_100047123 | 3300005535 | Bacteria | 3735 |
| 138 | Ga0070684_100050130 | 3300005535 | Bacteria | 3625 |
| 139 | Ga0070684_100280420 | 3300005535 | Bacteria | 1527 |
| 140 | Ga0070684_100335151 | 3300005535 | Bacteria | 1390 |
| 141 | Ga0070684_100378390 | 3300005535 | Bacteria | 1304 |
| 142 | Ga0068853_100033528 | 3300005539 | Bacteria | 4358 |
| 143 | Ga0068853_100137441 | 3300005539 | Bacteria | 2191 |
| 144 | Ga0068853_100204900 | 3300005539 | Bacteria | 1796 |
| 145 | Ga0070672_100007417 | 3300005543 | Bacteria | 7435 |
| 146 | Ga0070672_100049726 | 3300005543 | Bacteria | 3263 |
| 147 | Ga0070686_100004397 | 3300005544 | Bacteria | 7773 |
| 148 | Ga0070686_100031350 | 3300005544 | Bacteria | 3249 |
| 149 | Ga0070686_100135624 | 3300005544 | Bacteria | 1707 |
| 150 | Ga0070686_100184335 | 3300005544 | Bacteria | 1485 |
| 151 | Ga0070695_100001212 | 3300005545 | Bacteria | 14186 |
| 152 | Ga0070695_100062788 | 3300005545 | Bacteria | 2413 |
| 153 | Ga0070695_100200930 | 3300005545 | Bacteria | 1424 |
| 154 | Ga0070695_100292790 | 3300005545 | Bacteria | 1201 |
| 155 | Ga0070696_100021632 | 3300005546 | Bacteria | 4362 |
| 156 | Ga0070696_100026616 | 3300005546 | Bacteria | 3934 |
| 157 | Ga0070696_100103960 | 3300005546 | Bacteria | 2039 |
| 158 | Ga0070693_100026230 | 3300005547 | Bacteria | 3145 |
| 159 | Ga0070693_100041337 | 3300005547 | Bacteria | 2593 |
| 160 | Ga0070693_100048036 | 3300005547 | Bacteria | 2430 |
| 161 | Ga0070693_100058850 | 3300005547 | Bacteria | 2226 |
| 162 | Ga0070693_100210886 | 3300005547 | Bacteria | 1267 |
| 163 | Ga0070665_100013694 | 3300005548 | Bacteria | 8160 |
| 164 | Ga0070665_100013838 | 3300005548 | Bacteria | 8114 |
| 165 | Ga0070665_100164820 | 3300005548 | Bacteria | 2218 |
| 166 | Ga0070704_100016783 | 3300005549 | Bacteria | 4637 |
| 167 | Ga0070704_100140215 | 3300005549 | Bacteria | 1886 |
| 168 | Ga0068855_100012204 | 3300005563 | Bacteria | 10385 |
| 169 | Ga0068855_100031221 | 3300005563 | Bacteria | 6362 |
| 170 | Ga0068855_100048007 | 3300005563 | Bacteria | 5040 |
| 171 | Ga0068855_100083606 | 3300005563 | Bacteria | 3697 |
| 172 | Ga0068855_100202442 | 3300005563 | Bacteria | 2234 |
| 173 | Ga0068855_100264543 | 3300005563 | Bacteria | 1915 |
| 174 | Ga0068855_100313576 | 3300005563 | Bacteria | 1735 |
| 175 | Ga0068855_100400343 | 3300005563 | Bacteria | 1504 |
| 176 | Ga0070664_100020852 | 3300005564 | Bacteria | 5399 |
| 177 | Ga0070664_100376370 | 3300005564 | Bacteria | 1295 |
| 178 | Ga0070664_100381033 | 3300005564 | Bacteria | 1287 |
| 179 | Ga0068854_100093844 | 3300005578 | Bacteria | 2237 |
| 180 | Ga0068854_100241908 | 3300005578 | Bacteria | 1437 |
| 181 | Ga0068856_100054765 | 3300005614 | Bacteria | 3936 |
| 182 | Ga0070702_100006703 | 3300005615 | Bacteria | 5471 |
| 183 | Ga0070702_100040736 | 3300005615 | Bacteria | 2601 |
| 184 | Ga0070702_100052589 | 3300005615 | Bacteria | 2336 |
| 185 | Ga0070702_100250049 | 3300005615 | Bacteria | 1201 |
| 186 | Ga0068852_100028872 | 3300005616 | Bacteria | 4546 |
| 187 | Ga0068852_100093451 | 3300005616 | Bacteria | 2696 |
| 188 | Ga0068852_100135322 | 3300005616 | Bacteria | 2275 |
| 189 | Ga0068852_100349220 | 3300005616 | Bacteria | 1444 |
| 190 | Ga0068859_100088640 | 3300005617 | Bacteria | 3143 |
| 191 | Ga0068859_100545656 | 3300005617 | Bacteria | 1254 |
| 192 | Ga0068864_100010046 | 3300005618 | Bacteria | 7815 |
| 193 | Ga0068864_100295216 | 3300005618 | Bacteria | 1516 |
| 194 | Ga0068866_10000945 | 3300005718 | Bacteria | 12771 |
| 195 | Ga0068866_10108928 | 3300005718 | Bacteria | 1542 |
| 196 | Ga0068861_100007991 | 3300005719 | Bacteria | 7280 |
| 197 | Ga0068861_100015257 | 3300005719 | Bacteria | 5410 |
| 198 | Ga0068861_100500156 | 3300005719 | Bacteria | 1099 |
| 199 | Ga0068861_100557003 | 3300005719 | Unclassified | 1046 |
| 200 | Ga0068870_10005803 | 3300005840 | Bacteria | 5415 |
| 201 | Ga0068870_10283741 | 3300005840 | Bacteria | 1039 |
| 202 | Ga0068858_100377297 | 3300005842 | Bacteria | 1360 |
| 203 | Ga0068860_100069185 | 3300005843 | Bacteria | 3355 |
| 204 | Ga0068860_100409574 | 3300005843 | Bacteria | 1342 |
| 205 | Ga0068862_100266282 | 3300005844 | Bacteria | 1566 |
| 206 | Ga0068862_100277846 | 3300005844 | Bacteria | 1534 |
| 207 | Ga0081455_10013165 | 3300005937 | Bacteria | 8196 |
| 208 | Ga0081455_10013491 | 3300005937 | Bacteria | 8067 |
| 209 | Ga0081455_10022031 | 3300005937 | Bacteria | 5965 |
| 210 | Ga0081455_10066747 | 3300005937 | Bacteria | 3002 |
| 211 | Ga0081455_10170483 | 3300005937 | Bacteria | 1658 |
| 212 | Ga0081538_10004835 | 3300005981 | Bacteria | 12280 |
| 213 | Ga0081538_10031354 | 3300005981 | Bacteria | 3587 |
| 214 | Ga0081538_10092110 | 3300005981 | Bacteria | 1562 |
| 215 | Ga0081540_1004951 | 3300005983 | Bacteria | 10015 |
| 216 | Ga0081540_1033790 | 3300005983 | Bacteria | 2770 |
| 217 | Ga0081539_10000620 | 3300005985 | Bacteria | 71882 |
| 218 | Ga0070717_10080163 | 3300006028 | Bacteria | 2738 |
| 219 | Ga0070717_10179822 | 3300006028 | Bacteria | 1843 |
| 220 | Ga0070717_10611452 | 3300006028 | Bacteria | 989 |
| 221 | Ga0075432_10001637 | 3300006058 | Bacteria | 7367 |
| 222 | Ga0075432_10053097 | 3300006058 | Bacteria | 1432 |
| 223 | Ga0070712_100039004 | 3300006175 | Bacteria | 3248 |
| 224 | Ga0097621_100094573 | 3300006237 | Bacteria | 2505 |
| 225 | Ga0097621_100287279 | 3300006237 | Bacteria | 1449 |
| 226 | Ga0097621_100303316 | 3300006237 | Bacteria | 1411 |
| 227 | Ga0068871_100045501 | 3300006358 | Bacteria | 3532 |
| 228 | Ga0068871_100128712 | 3300006358 | Bacteria | 2145 |
| 229 | Ga0075428_100002460 | 3300006844 | Bacteria | 20102 |
| 230 | Ga0075428_100070676 | 3300006844 | Bacteria | 3816 |
| 231 | Ga0075434_100052545 | 3300006871 | Bacteria | 4049 |
| 232 | Ga0068865_100002502 | 3300006881 | Bacteria | 10876 |
| 233 | Ga0068865_100021473 | 3300006881 | Bacteria | 4198 |
| 234 | Ga0068865_100395602 | 3300006881 | Bacteria | 1130 |
| 235 | Ga0097620_100088640 | 3300006931 | Bacteria | 3143 |
| 236 | Ga0097620_100545686 | 3300006931 | Bacteria | 1254 |
| 237 | Ga0075435_100026229 | 3300007076 | Bacteria | 4544 |
| 238 | Ga0075435_100029619 | 3300007076 | Bacteria | 4297 |
| 239 | Ga0075435_100188293 | 3300007076 | Bacteria | 1746 |
| 240 | Ga0105250_10105018 | 3300009092 | Bacteria | 1154 |
| 241 | Ga0105240_10009160 | 3300009093 | Bacteria | 14044 |
| 242 | Ga0105240_10109722 | 3300009093 | Bacteria | 3341 |
| 243 | Ga0105240_10306751 | 3300009093 | Bacteria | 1814 |
| 244 | Ga0105240_10335611 | 3300009093 | Bacteria | 1718 |
| 245 | Ga0105240_10536747 | 3300009093 | Unclassified | 1296 |
| 246 | Ga0111539_10003095 | 3300009094 | Bacteria | 22053 |
| 247 | Ga0111539_10023166 | 3300009094 | Bacteria | 7626 |
| 248 | Ga0111539_10174445 | 3300009094 | Bacteria | 2511 |
| 249 | Ga0111539_10249453 | 3300009094 | Bacteria | 2067 |
| 250 | Ga0105245_10008244 | 3300009098 | Bacteria | 9106 |
| 251 | Ga0105245_10014910 | 3300009098 | Bacteria | 6770 |
| 252 | Ga0105245_10038377 | 3300009098 | Bacteria | 4261 |
| 253 | Ga0105245_10055287 | 3300009098 | Bacteria | 3565 |
| 254 | Ga0105245_10059555 | 3300009098 | Bacteria | 3439 |
| 255 | Ga0105245_10080204 | 3300009098 | Bacteria | 2981 |
| 256 | Ga0105245_10195144 | 3300009098 | Bacteria | 1942 |
| 257 | Ga0105245_10304664 | 3300009098 | Bacteria | 1564 |
| 258 | Ga0105245_10769588 | 3300009098 | Bacteria | 999 |
| 259 | Ga0105247_10014762 | 3300009101 | Bacteria | 4683 |
| 260 | Ga0105247_10065217 | 3300009101 | Bacteria | 2265 |
| 261 | Ga0114129_10006073 | 3300009147 | Bacteria | 17120 |
| 262 | Ga0114129_10179983 | 3300009147 | Bacteria | 2877 |
| 263 | Ga0105243_10038804 | 3300009148 | Bacteria | 3710 |
| 264 | Ga0105243_10068382 | 3300009148 | Bacteria | 2863 |
| 265 | Ga0105243_10149932 | 3300009148 | Bacteria | 1999 |
| 266 | Ga0105243_10187462 | 3300009148 | Bacteria | 1804 |
| 267 | Ga0105243_10286704 | 3300009148 | Bacteria | 1486 |
| 268 | Ga0105243_10707706 | 3300009148 | Bacteria | 983 |
| 269 | Ga0105241_10102020 | 3300009174 | Bacteria | 2282 |
| 270 | Ga0105242_10011727 | 3300009176 | Bacteria | 6744 |
| 271 | Ga0105242_10024665 | 3300009176 | Bacteria | 4751 |
| 272 | Ga0105242_10047304 | 3300009176 | Bacteria | 3493 |
| 273 | Ga0105242_10112371 | 3300009176 | Bacteria | 2324 |
| 274 | Ga0105242_10180473 | 3300009176 | Bacteria | 1862 |
| 275 | Ga0105242_10278983 | 3300009176 | Bacteria | 1517 |
| 276 | Ga0105242_10422111 | 3300009176 | Bacteria | 1250 |
| 277 | Ga0105248_10010628 | 3300009177 | Bacteria | 10150 |
| 278 | Ga0105248_10186137 | 3300009177 | Bacteria | 2340 |
| 279 | Ga0105248_10214289 | 3300009177 | Bacteria | 2169 |
| 280 | Ga0105248_10218547 | 3300009177 | Bacteria | 2146 |
| 281 | Ga0105237_10039745 | 3300009545 | Bacteria | 4747 |
| 282 | Ga0105237_10050600 | 3300009545 | Bacteria | 4175 |
| 283 | Ga0105237_10238800 | 3300009545 | Bacteria | 1818 |
| 284 | Ga0105237_10278220 | 3300009545 | Bacteria | 1676 |
| 285 | Ga0105238_10005763 | 3300009551 | Bacteria | 12259 |
| 286 | Ga0105238_10006788 | 3300009551 | Bacteria | 11431 |
| 287 | Ga0105249_10005447 | 3300009553 | Bacteria | 10988 |
| 288 | Ga0105249_10045346 | 3300009553 | Bacteria | 3998 |
| 289 | Ga0105249_10148466 | 3300009553 | Bacteria | 2254 |
| 290 | Ga0105239_10014335 | 3300010375 | Bacteria | 8794 |
| 291 | Ga0105239_10026235 | 3300010375 | Bacteria | 6414 |
| 292 | Ga0105239_10205199 | 3300010375 | Bacteria | 2209 |
| 293 | Ga0105246_10006134 | 3300011119 | Bacteria | 7335 |
| 294 | Ga0105246_10049280 | 3300011119 | Bacteria | 2884 |
| 295 | Ga0105246_10052146 | 3300011119 | Bacteria | 2811 |
| 296 | Ga0105246_10181204 | 3300011119 | Bacteria | 1622 |
| 297 | Ga0157343_1000626 | 3300012488 | Bacteria | 1475 |
| 298 | Ga0157338_1001164 | 3300012515 | Bacteria | 1815 |
| 299 | Ga0157373_10024948 | 3300013100 | Bacteria | 4329 |
| 300 | Ga0157371_10103642 | 3300013102 | Bacteria | 2019 |
| 301 | Ga0157371_10294468 | 3300013102 | Bacteria | 1174 |
| 302 | Ga0157370_10044909 | 3300013104 | Bacteria | 4243 |
| 303 | Ga0157370_10154371 | 3300013104 | Bacteria | 2136 |
| 304 | Ga0157369_10018894 | 3300013105 | Bacteria | 7723 |
| 305 | Ga0157369_10021078 | 3300013105 | Bacteria | 7284 |
| 306 | Ga0157369_10026887 | 3300013105 | Bacteria | 6380 |
| 307 | Ga0157369_10044616 | 3300013105 | Bacteria | 4824 |
| 308 | Ga0157374_10292555 | 3300013296 | Bacteria | 1610 |
| 309 | Ga0157378_10004800 | 3300013297 | Bacteria | 11846 |
| 310 | Ga0157378_10194619 | 3300013297 | Bacteria | 1914 |
| 311 | Ga0157378_10321430 | 3300013297 | Bacteria | 1503 |
| 312 | Ga0163162_10009912 | 3300013306 | Bacteria | 9265 |
| 313 | Ga0163162_10058659 | 3300013306 | Bacteria | 3879 |
| 314 | Ga0163162_10154976 | 3300013306 | Bacteria | 2410 |
| 315 | Ga0163162_10344629 | 3300013306 | Bacteria | 1622 |
| 316 | Ga0163162_10434426 | 3300013306 | Unclassified | 1445 |
| 317 | Ga0163162_10538690 | 3300013306 | Bacteria | 1296 |
| 318 | Ga0157372_10020185 | 3300013307 | Bacteria | 7185 |
| 319 | Ga0157372_10020936 | 3300013307 | Bacteria | 7059 |
| 320 | Ga0157372_10045204 | 3300013307 | Bacteria | 4883 |
| 321 | Ga0157372_10052407 | 3300013307 | Bacteria | 4543 |
| 322 | Ga0157372_10330789 | 3300013307 | Bacteria | 1774 |
| 323 | Ga0157375_10014563 | 3300013308 | Bacteria | 7020 |
| 324 | Ga0157375_10068190 | 3300013308 | Bacteria | 3558 |
| 325 | Ga0157375_10073531 | 3300013308 | Bacteria | 3437 |
| 326 | Ga0157375_10120845 | 3300013308 | Bacteria | 2729 |
| 327 | Ga0163163_10002702 | 3300014325 | Bacteria | 14985 |
| 328 | Ga0163163_10075938 | 3300014325 | Bacteria | 3354 |
| 329 | Ga0157380_10033532 | 3300014326 | Bacteria | 3954 |
| 330 | Ga0157380_10120038 | 3300014326 | Bacteria | 2225 |
| 331 | Ga0157380_10141840 | 3300014326 | Bacteria | 2065 |
| 332 | Ga0157380_10187928 | 3300014326 | Bacteria | 1821 |
| 333 | Ga0157380_10258709 | 3300014326 | Bacteria | 1580 |
| 334 | Ga0157380_10281553 | 3300014326 | Bacteria | 1522 |
| 335 | Ga0182008_10014699 | 3300014497 | Bacteria | 4094 |
| 336 | Ga0157377_10011681 | 3300014745 | Bacteria | 4391 |
| 337 | Ga0157377_10108023 | 3300014745 | Bacteria | 1668 |
| 338 | Ga0157379_10081001 | 3300014968 | Bacteria | 2908 |
| 339 | Ga0157379_10132878 | 3300014968 | Bacteria | 2241 |
| 340 | Ga0157376_10003894 | 3300014969 | Bacteria | 10323 |
| 341 | Ga0157376_10037240 | 3300014969 | Bacteria | 3946 |
| 342 | Ga0157376_10352526 | 3300014969 | Bacteria | 1409 |
| 343 | Ga0182007_10037631 | 3300015262 | Bacteria | 1624 |
| 344 | Ga0163161_10030576 | 3300017792 | Bacteria | 3834 |
| 345 | Ga0163161_10031897 | 3300017792 | Bacteria | 3758 |
| 346 | Ga0163161_10461712 | 3300017792 | Unclassified | 1028 |
| 347 | Ga0206356_10907748 | 3300020070 | Bacteria | 1768 |
| 348 | Ga0206356_11271870 | 3300020070 | Bacteria | 1276 |
| 349 | Ga0206354_11467900 | 3300020081 | Bacteria | 1413 |
| 350 | Ga0206353_10727954 | 3300020082 | Bacteria | 2177 |
| 351 | Ga0206353_11243256 | 3300020082 | Bacteria | 3217 |
| 352 | Ga0207697_10049155 | 3300025315 | Bacteria | 1740 |
| 353 | Ga0207682_10042232 | 3300025893 | Bacteria | 1863 |
| 354 | Ga0207692_10015358 | 3300025898 | Bacteria | 3367 |
| 355 | Ga0207642_10003172 | 3300025899 | Bacteria | 5159 |
| 356 | Ga0207642_10052274 | 3300025899 | Bacteria | 1853 |
| 357 | Ga0207642_10121729 | 3300025899 | Bacteria | 1347 |
| 358 | Ga0207710_10037637 | 3300025900 | Bacteria | 2137 |
| 359 | Ga0207688_10007135 | 3300025901 | Bacteria | 6076 |
| 360 | Ga0207688_10037103 | 3300025901 | Bacteria | 2702 |
| 361 | Ga0207688_10048436 | 3300025901 | Bacteria | 2375 |
| 362 | Ga0207688_10252472 | 3300025901 | Bacteria | 1068 |
| 363 | Ga0207680_10010499 | 3300025903 | Bacteria | 4634 |
| 364 | Ga0207647_10061628 | 3300025904 | Bacteria | 2288 |
| 365 | Ga0207699_10210631 | 3300025906 | Bacteria | 1322 |
| 366 | Ga0207645_10018402 | 3300025907 | Bacteria | 4596 |
| 367 | Ga0207645_10088914 | 3300025907 | Bacteria | 1986 |
| 368 | Ga0207643_10005237 | 3300025908 | Bacteria | 6937 |
| 369 | Ga0207643_10007449 | 3300025908 | Bacteria | 5873 |
| 370 | Ga0207643_10098383 | 3300025908 | Bacteria | 1713 |
| 371 | Ga0207705_10323093 | 3300025909 | Bacteria | 1186 |
| 372 | Ga0207684_10027750 | 3300025910 | Bacteria | 4822 |
| 373 | Ga0207684_10244109 | 3300025910 | Bacteria | 1549 |
| 374 | Ga0207654_10107939 | 3300025911 | Bacteria | 1726 |
| 375 | Ga0207707_10048845 | 3300025912 | Bacteria | 3686 |
| 376 | Ga0207707_10088830 | 3300025912 | Bacteria | 2700 |
| 377 | Ga0207695_10022893 | 3300025913 | Bacteria | 7077 |
| 378 | Ga0207695_10138406 | 3300025913 | Bacteria | 2386 |
| 379 | Ga0207671_10042344 | 3300025914 | Bacteria | 3370 |
| 380 | Ga0207671_10157798 | 3300025914 | Bacteria | 1756 |
| 381 | Ga0207671_10212620 | 3300025914 | Bacteria | 1513 |
| 382 | Ga0207663_10035150 | 3300025916 | Bacteria | 3003 |
| 383 | Ga0207660_10022590 | 3300025917 | Bacteria | 4239 |
| 384 | Ga0207660_10032137 | 3300025917 | Bacteria | 3621 |
| 385 | Ga0207660_10206768 | 3300025917 | Bacteria | 1535 |
| 386 | Ga0207662_10087811 | 3300025918 | Bacteria | 1908 |
| 387 | Ga0207662_10315848 | 3300025918 | Unclassified | 1042 |
| 388 | Ga0207657_10000392 | 3300025919 | Bacteria | 46205 |
| 389 | Ga0207657_10016444 | 3300025919 | Bacteria | 7136 |
| 390 | Ga0207649_10172437 | 3300025920 | Bacteria | 1508 |
| 391 | Ga0207652_10172028 | 3300025921 | Bacteria | 1944 |
| 392 | Ga0207652_10198354 | 3300025921 | Bacteria | 1806 |
| 393 | Ga0207652_10339799 | 3300025921 | Bacteria | 1355 |
| 394 | Ga0207646_10321003 | 3300025922 | Bacteria | 1399 |
| 395 | Ga0207646_10392131 | 3300025922 | Bacteria | 1254 |
| 396 | Ga0207681_10369591 | 3300025923 | Bacteria | 1152 |
| 397 | Ga0207650_10001595 | 3300025925 | Bacteria | 16196 |
| 398 | Ga0207659_10084766 | 3300025926 | Bacteria | 2352 |
| 399 | Ga0207659_10097825 | 3300025926 | Bacteria | 2205 |
| 400 | Ga0207687_10013742 | 3300025927 | Bacteria | 5287 |
| 401 | Ga0207687_10031107 | 3300025927 | Bacteria | 3605 |
| 402 | Ga0207687_10064773 | 3300025927 | Bacteria | 2593 |
| 403 | Ga0207687_10093370 | 3300025927 | Bacteria | 2200 |
| 404 | Ga0207687_10153789 | 3300025927 | Bacteria | 1758 |
| 405 | Ga0207687_10207264 | 3300025927 | Bacteria | 1536 |
| 406 | Ga0207687_10353276 | 3300025927 | Bacteria | 1198 |
| 407 | Ga0207687_10467578 | 3300025927 | Unclassified | 1048 |
| 408 | Ga0207700_10038006 | 3300025928 | Bacteria | 3491 |
| 409 | Ga0207644_10124071 | 3300025931 | Bacteria | 1969 |
| 410 | Ga0207644_10151624 | 3300025931 | Bacteria | 1794 |
| 411 | Ga0207644_10363081 | 3300025931 | Bacteria | 1178 |
| 412 | Ga0207690_10030289 | 3300025932 | Bacteria | 3449 |
| 413 | Ga0207690_10303344 | 3300025932 | Bacteria | 1250 |
| 414 | Ga0207690_10388882 | 3300025932 | Unclassified | 1110 |
| 415 | Ga0207706_10286040 | 3300025933 | Bacteria | 1437 |
| 416 | Ga0207686_10017939 | 3300025934 | Bacteria | 3998 |
| 417 | Ga0207686_10038722 | 3300025934 | Bacteria | 2887 |
| 418 | Ga0207709_10001613 | 3300025935 | Bacteria | 15346 |
| 419 | Ga0207709_10041624 | 3300025935 | Bacteria | 2758 |
| 420 | Ga0207709_10064132 | 3300025935 | Bacteria | 2305 |
| 421 | Ga0207709_10064273 | 3300025935 | Bacteria | 2303 |
| 422 | Ga0207709_10250800 | 3300025935 | Bacteria | 1293 |
| 423 | Ga0207670_10048290 | 3300025936 | Bacteria | 2839 |
| 424 | Ga0207669_10014513 | 3300025937 | Bacteria | 3951 |
| 425 | Ga0207669_10033865 | 3300025937 | Bacteria | 2889 |
| 426 | Ga0207669_10127363 | 3300025937 | Bacteria | 1742 |
| 427 | Ga0207704_10007273 | 3300025938 | Bacteria | 5219 |
| 428 | Ga0207704_10097403 | 3300025938 | Bacteria | 1951 |
| 429 | Ga0207665_10027095 | 3300025939 | Bacteria | 3786 |
| 430 | Ga0207691_10014462 | 3300025940 | Bacteria | 7524 |
| 431 | Ga0207691_10035608 | 3300025940 | Bacteria | 4618 |
| 432 | Ga0207711_10079577 | 3300025941 | Bacteria | 2861 |
| 433 | Ga0207711_10130483 | 3300025941 | Bacteria | 2253 |
| 434 | Ga0207711_10151573 | 3300025941 | Bacteria | 2092 |
| 435 | Ga0207711_10236847 | 3300025941 | Bacteria | 1673 |
| 436 | Ga0207689_10025253 | 3300025942 | Bacteria | 4979 |
| 437 | Ga0207661_10003730 | 3300025944 | Bacteria | 10614 |
| 438 | Ga0207661_10245636 | 3300025944 | Bacteria | 1589 |
| 439 | Ga0207661_10267589 | 3300025944 | Bacteria | 1524 |
| 440 | Ga0207661_10298500 | 3300025944 | Bacteria | 1444 |
| 441 | Ga0207667_10026439 | 3300025949 | Bacteria | 6341 |
| 442 | Ga0207667_10057030 | 3300025949 | Bacteria | 4101 |
| 443 | Ga0207667_10125801 | 3300025949 | Bacteria | 2640 |
| 444 | Ga0207667_10176749 | 3300025949 | Bacteria | 2193 |
| 445 | Ga0207651_10185890 | 3300025960 | Bacteria | 1653 |
| 446 | Ga0207712_10057529 | 3300025961 | Bacteria | 2744 |
| 447 | Ga0207712_10333984 | 3300025961 | Bacteria | 1255 |
| 448 | Ga0207712_10448386 | 3300025961 | Bacteria | 1094 |
| 449 | Ga0207668_10019407 | 3300025972 | Bacteria | 4298 |
| 450 | Ga0207668_10233307 | 3300025972 | Bacteria | 1485 |
| 451 | Ga0207668_10268999 | 3300025972 | Bacteria | 1392 |
| 452 | Ga0207668_10339742 | 3300025972 | Bacteria | 1252 |
| 453 | Ga0207640_10127781 | 3300025981 | Bacteria | 1832 |
| 454 | Ga0207640_10196939 | 3300025981 | Bacteria | 1523 |
| 455 | Ga0207640_10237459 | 3300025981 | Bacteria | 1406 |
| 456 | Ga0207658_10263161 | 3300025986 | Bacteria | 1471 |
| 457 | Ga0207703_10457330 | 3300026035 | Bacteria | 1193 |
| 458 | Ga0207678_10010413 | 3300026067 | Bacteria | 8163 |
| 459 | Ga0207678_10015965 | 3300026067 | Bacteria | 6596 |
| 460 | Ga0207678_10065220 | 3300026067 | Bacteria | 3128 |
| 461 | Ga0207708_10005066 | 3300026075 | Bacteria | 9717 |
| 462 | Ga0207708_10005846 | 3300026075 | Bacteria | 9103 |
| 463 | Ga0207708_10018361 | 3300026075 | Bacteria | 5268 |
| 464 | Ga0207708_10078445 | 3300026075 | Bacteria | 2536 |
| 465 | Ga0207702_10108008 | 3300026078 | Bacteria | 2469 |
| 466 | Ga0207648_10000214 | 3300026089 | Bacteria | 62323 |
| 467 | Ga0207648_10034363 | 3300026089 | Bacteria | 4469 |
| 468 | Ga0207648_10390014 | 3300026089 | Bacteria | 1260 |
| 469 | Ga0207676_10015876 | 3300026095 | Bacteria | 5446 |
| 470 | Ga0207676_10266979 | 3300026095 | Bacteria | 1548 |
| 471 | Ga0207676_10404409 | 3300026095 | Bacteria | 1277 |
| 472 | Ga0207675_100003071 | 3300026118 | Bacteria | 16378 |
| 473 | Ga0207675_100012690 | 3300026118 | Bacteria | 7874 |
| 474 | Ga0207675_100114769 | 3300026118 | Bacteria | 2544 |
| 475 | Ga0207675_100479615 | 3300026118 | Bacteria | 1236 |
| 476 | Ga0207675_100812348 | 3300026118 | Unclassified | 949 |
| 477 | Ga0207683_10024530 | 3300026121 | Bacteria | 5195 |
| 478 | Ga0207683_10039127 | 3300026121 | Bacteria | 4137 |
| 479 | Ga0207683_10087160 | 3300026121 | Bacteria | 2776 |
| 480 | Ga0207683_10088034 | 3300026121 | Bacteria | 2762 |
| 481 | Ga0207683_10143973 | 3300026121 | Bacteria | 2148 |
| 482 | Ga0207683_10226527 | 3300026121 | Bacteria | 1704 |
| 483 | Ga0207698_10032256 | 3300026142 | Bacteria | 3792 |
| 484 | Ga0207698_10033236 | 3300026142 | Bacteria | 3746 |
| 485 | Ga0207698_10422020 | 3300026142 | Bacteria | 1280 |
| 486 | Ga0207428_10000108 | 3300027907 | Bacteria | 115378 |
| 487 | Ga0207428_10004375 | 3300027907 | Bacteria | 13472 |
| 488 | Ga0207428_10026324 | 3300027907 | Bacteria | 4856 |
| 489 | Ga0268266_10289439 | 3300028379 | Bacteria | 1525 |
| 490 | Ga0268265_10217053 | 3300028380 | Bacteria | 1671 |
| 491 | Ga0268264_10068857 | 3300028381 | Bacteria | 2992 |
| 492 | Ga0268264_10191505 | 3300028381 | Bacteria | 1865 |
| 493 | Ga0265337_1024111 | 3300028556 | Bacteria | 1865 |
| 494 | Ga0265319_1000846 | 3300028563 | Bacteria | 19549 |
| 495 | Ga0265318_10002860 | 3300028577 | Bacteria | 9006 |
| 496 | Ga0265318_10017257 | 3300028577 | Bacteria | 2966 |
| 497 | Ga0265338_10000705 | 3300028800 | Bacteria | 57138 |
| 498 | Ga0265338_10006416 | 3300028800 | Bacteria | 14995 |
| 499 | Ga0265338_10010871 | 3300028800 | Bacteria | 10593 |
| 500 | Ga0265338_10011986 | 3300028800 | Bacteria | 9928 |
| 501 | Ga0265338_10050515 | 3300028800 | Bacteria | 3758 |
| 502 | Ga0265338_10089148 | 3300028800 | Bacteria | 2557 |
| 503 | Ga0265330_10052007 | 3300031235 | Bacteria | 1795 |
| 504 | Ga0265332_10022521 | 3300031238 | Bacteria | 2780 |
| 505 | Ga0265320_10049854 | 3300031240 | Bacteria | 2037 |
| 506 | Ga0265339_10008169 | 3300031249 | Bacteria | 6677 |
| 507 | Ga0265331_10038770 | 3300031250 | Bacteria | 2327 |
| 508 | Ga0265327_10013262 | 3300031251 | Bacteria | 5483 |
| 509 | Ga0265316_10329961 | 3300031344 | Bacteria | 1107 |
| 510 | Ga0265316_10371680 | 3300031344 | Bacteria | 1032 |
| 511 | Ga0307408_100006161 | 3300031548 | Bacteria | 7960 |
| 512 | Ga0265313_10070231 | 3300031595 | Bacteria | 1614 |
| 513 | Ga0265314_10004955 | 3300031711 | Bacteria | 12148 |
| 514 | Ga0265314_10024298 | 3300031711 | Bacteria | 4596 |
| 515 | Ga0265314_10163158 | 3300031711 | Bacteria | 1354 |
| 516 | Ga0307405_10057524 | 3300031731 | Bacteria | 2443 |
| 517 | Ga0307413_10014618 | 3300031824 | Bacteria | 3994 |
| 518 | Ga0307410_10000753 | 3300031852 | Bacteria | 13565 |
| 519 | Ga0307406_10007192 | 3300031901 | Bacteria | 6166 |
| 520 | Ga0307406_10083003 | 3300031901 | Bacteria | 2136 |
| 521 | Ga0307406_10369647 | 3300031901 | Bacteria | 1127 |
| 522 | Ga0307407_10006605 | 3300031903 | Bacteria | 5177 |
| 523 | Ga0307409_100002792 | 3300031995 | Bacteria | 9225 |
| 524 | Ga0307409_100038186 | 3300031995 | Bacteria | 3549 |
| 525 | Ga0307409_100118439 | 3300031995 | Bacteria | 2237 |
| 526 | Ga0307409_100342001 | 3300031995 | Bacteria | 1408 |
| 527 | Ga0307416_100024078 | 3300032002 | Bacteria | 4434 |
| 528 | Ga0307416_100040203 | 3300032002 | Bacteria | 3630 |
| 529 | Ga0307416_100085026 | 3300032002 | Bacteria | 2691 |
| 530 | Ga0307414_10024401 | 3300032004 | Bacteria | 3856 |
| 531 | Ga0307411_10005161 | 3300032005 | Bacteria | 6383 |
| 532 | Ga0307415_100004291 | 3300032126 | Bacteria | 7377 |
| 533 | Ga0307415_100013991 | 3300032126 | Bacteria | 4702 |
| 534 | Ga0307415_100015243 | 3300032126 | Bacteria | 4545 |
| 535 | Ga0307415_100092651 | 3300032126 | Bacteria | 2192 |
| 536 | Ga0307415_100212441 | 3300032126 | Bacteria | 1545 |
| 537 | Ga0373930_0014563 | 3300034816 | Bacteria | 1466 |
| 538 | Ga0373952_0015967 | 3300035092 | Bacteria | 1521 |
| 539 | Ga0373939_0016486 | 3300035114 | Bacteria | 1949 |
| 540 | Ga0373955_0268369 | 3300035172 | Bacteria | 1025 |
| 541 | Ga0373942_0043368 | 3300035207 | Bacteria | 1236 |
| 542 | Ga0373961_0021072 | 3300035241 | Bacteria | 1730 |
| 543 | Ga0373962_0021485 | 3300035242 | Bacteria | 1703 |
| 544 | Ga0373933_0044316 | 3300035724 | Bacteria | 2635 |
| 545 | Ga0373937_0048175 | 3300036401 | Bacteria | 3900 |
| 546 | Ga0373937_0070326 | 3300036401 | Bacteria | 3228 |
| 547 | Ga0395899_0006132 | 3300037312 | Bacteria | 9317 |
| 548 | Ga0395899_0006949 | 3300037312 | Bacteria | 8766 |
| 549 | Ga0395899_0042994 | 3300037312 | Bacteria | 3371 |
| 550 | Ga0395899_0195268 | 3300037312 | Bacteria | 1414 |
| 551 | Ga0395899_0204096 | 3300037312 | Bacteria | 1376 |
| 552 | Ga0395900_0001348 | 3300037418 | Bacteria | 29694 |
| 553 | Ga0395900_0002485 | 3300037418 | Bacteria | 20252 |
| 554 | Ga0395900_0005014 | 3300037418 | Bacteria | 13887 |
| 555 | Ga0395900_0042283 | 3300037418 | Bacteria | 4694 |
| 556 | Ga0395900_0054097 | 3300037418 | Bacteria | 4132 |
| 557 | Ga0395900_0300839 | 3300037418 | Bacteria | 1590 |
| 558 | Ga0395900_0621507 | 3300037418 | Bacteria | 1019 |
| 559 | Ga0395898_0000734 | 3300037466 | Bacteria | 57441 |
| 560 | Ga0395898_0001605 | 3300037466 | Bacteria | 30850 |
| 561 | Ga0395898_0002159 | 3300037466 | Bacteria | 24137 |
| 562 | Ga0395898_0013840 | 3300037466 | Bacteria | 8291 |
| 563 | Ga0395898_0062682 | 3300037466 | Bacteria | 3611 |
| 564 | Ga0395898_0103317 | 3300037466 | Bacteria | 2734 |
| 565 | Ga0395898_0119162 | 3300037466 | Bacteria | 2528 |
| 566 | Ga0395898_0450519 | 3300037466 | Unclassified | 1226 |
| 567 | Ga0395898_0588594 | 3300037466 | Bacteria | 1055 |
| 568 | Ga0395905_0001663 | 3300037471 | Bacteria | 26274 |
| 569 | Ga0395905_0031928 | 3300037471 | Bacteria | 4954 |
| 570 | Ga0395905_0039353 | 3300037471 | Bacteria | 4435 |
| 571 | Ga0395905_0085783 | 3300037471 | Bacteria | 2950 |
| 572 | Ga0395901_0000352 | 3300038443 | Bacteria | 55996 |
| 573 | Ga0395901_0000586 | 3300038443 | Bacteria | 42347 |
| 574 | Ga0395901_0002002 | 3300038443 | Bacteria | 20963 |
| 575 | Ga0395901_0008678 | 3300038443 | Bacteria | 10272 |
| 576 | Ga0395901_0043859 | 3300038443 | Bacteria | 4639 |
| 577 | Ga0395901_0044840 | 3300038443 | Bacteria | 4586 |
| 578 | Ga0395901_0085829 | 3300038443 | Bacteria | 3291 |
| 579 | Ga0395901_0335710 | 3300038443 | Bacteria | 1562 |
| 580 | Ga0395901_0669183 | 3300038443 | Unclassified | 1039 |
| 581 | Ga0242420_030605 | 3300038996 | Bacteria | 997 |
| 582 | Ga0436360_0239625 | 3300039438 | Bacteria | 1922 |
| 583 | Ga0436360_1307936 | 3300039438 | Bacteria | 1994 |
| 584 | Ga0439448_0003935 | 3300042005 | Bacteria | 4167 |
| 585 | Ga0439448_0023177 | 3300042005 | Bacteria | 1934 |
| 586 | Ga0439448_0061849 | 3300042005 | Bacteria | 1238 |
| 587 | Ga0439455_0007909 | 3300042012 | Bacteria | 2265 |
| 588 | Ga0439463_033115 | 3300042016 | Bacteria | 1307 |
| 589 | Ga0450920_000491 | 3300042122 | Bacteria | 6215 |
| 590 | Ga0450920_035425 | 3300042122 | Bacteria | 988 |
| 591 | Ga0439460_0041508 | 3300042461 | Unclassified | 1352 |
| 592 | Ga0466969_0065281 | 3300044656 | Bacteria | 1760 |
| 593 | Ga0466966_0137232 | 3300044684 | Bacteria | 1495 |
| 594 | Ga0466961_0073557 | 3300044693 | Bacteria | 2167 |
| 595 | Ga0466963_0000671 | 3300044694 | Bacteria | 16565 |
| 596 | Ga0466963_0002247 | 3300044694 | Bacteria | 10720 |
| 597 | Ga0466963_0024363 | 3300044694 | Bacteria | 3853 |
| 598 | Ga0466963_0029826 | 3300044694 | Bacteria | 3514 |
| 599 | Ga0466963_0066267 | 3300044694 | Bacteria | 2422 |
| 600 | Ga0466963_0079629 | 3300044694 | Bacteria | 2217 |
| 601 | Ga0466963_0372739 | 3300044694 | Unclassified | 1006 |
| 602 | Ga0466964_0004331 | 3300044706 | Bacteria | 5231 |
| 603 | Ga0466971_0004864 | 3300044719 | Bacteria | 5810 |
| 604 | Ga0466968_0004480 | 3300044735 | Bacteria | 5223 |
| 605 | Ga0466957_0025155 | 3300044842 | Bacteria | 3527 |
| 606 | Ga0466957_0025548 | 3300044842 | Bacteria | 3501 |
| 607 | Ga0466957_0094771 | 3300044842 | Bacteria | 1875 |
| 608 | Ga0466960_0091452 | 3300044901 | Bacteria | 1552 |
| 609 | Ga0466959_0012975 | 3300045049 | Bacteria | 6033 |
| 610 | Ga0466959_0037501 | 3300045049 | Bacteria | 3582 |
| 611 | Ga0466959_0152642 | 3300045049 | Bacteria | 1627 |
| 612 | Ga0451576_0038419 | 3300045051 | Bacteria | 5066 |
| 613 | Ga0451576_0717287 | 3300045051 | Bacteria | 1050 |
| 614 | Ga0466958_0004545 | 3300045836 | Bacteria | 7336 |
| 615 | Ga0466958_0088961 | 3300045836 | Bacteria | 1908 |
| 616 | Ga0466958_0138610 | 3300045836 | Bacteria | 1531 |
| 617 | Ga0466967_0006742 | 3300045976 | Bacteria | 8173 |
| 618 | Ga0466967_0015544 | 3300045976 | Bacteria | 5969 |
| 619 | Ga0466967_0026310 | 3300045976 | Bacteria | 4817 |
| 620 | Ga0466967_0045222 | 3300045976 | Bacteria | 3824 |
| 621 | Ga0466967_0052620 | 3300045976 | Bacteria | 3575 |
| 622 | Ga0466967_0053156 | 3300045976 | Bacteria | 3559 |
| 623 | Ga0466967_0093004 | 3300045976 | Bacteria | 2743 |
| 624 | Ga0466967_0103792 | 3300045976 | Bacteria | 2601 |
| 625 | Ga0466967_0233871 | 3300045976 | Bacteria | 1750 |
| 626 | Ga0466967_0337126 | 3300045976 | Bacteria | 1457 |
| 627 | Ga0466967_0475593 | 3300045976 | Bacteria | 1223 |
| 628 | Ga0466967_0545223 | 3300045976 | Bacteria | 1141 |
| 629 | Ga0495592_0201287 | 3300046454 | Bacteria | 1344 |
| 630 | Ga0495591_030561 | 3300046458 | Bacteria | 1625 |
| 631 | Ga0495629_0082841 | 3300046459 | Bacteria | 2239 |
| 632 | Ga0495651_0087921 | 3300046462 | Bacteria | 2336 |
| 633 | Ga0495651_0223954 | 3300046462 | Bacteria | 1300 |
| 634 | Ga0495653_0144625 | 3300046463 | Bacteria | 1668 |
| 635 | Ga0495584_0027885 | 3300046491 | Bacteria | 2861 |
| 636 | Ga0495585_0128157 | 3300046492 | Bacteria | 1338 |
| 637 | Ga0495596_0027279 | 3300046500 | Bacteria | 2298 |
| 638 | Ga0495596_0065356 | 3300046500 | Bacteria | 1415 |
| 639 | Ga0495596_0072612 | 3300046500 | Bacteria | 1336 |
| 640 | Ga0495608_0026080 | 3300046511 | Bacteria | 3987 |
| 641 | Ga0495608_0057976 | 3300046511 | Bacteria | 2554 |
| 642 | Ga0495608_0220232 | 3300046511 | Bacteria | 1191 |
| 643 | Ga0495628_0216905 | 3300046516 | Bacteria | 1438 |
| 644 | Ga0495630_0218692 | 3300046517 | Bacteria | 1454 |
| 645 | Ga0495631_0034955 | 3300046518 | Bacteria | 2251 |
| 646 | Ga0495631_0106859 | 3300046518 | Bacteria | 1203 |
| 647 | Ga0495637_0104698 | 3300046520 | Bacteria | 1102 |
| 648 | Ga0495663_0016516 | 3300046525 | Bacteria | 2087 |
| 649 | Ga0495663_0041595 | 3300046525 | Bacteria | 1398 |
| 650 | Ga0495642_0077601 | 3300046528 | Bacteria | 1395 |
| 651 | Ga0495652_0339985 | 3300046529 | Bacteria | 1079 |
| 652 | Ga0495654_0140010 | 3300046530 | Bacteria | 1079 |
| 653 | Ga0495665_0056235 | 3300046531 | Bacteria | 2077 |
| 654 | Ga0495586_0009293 | 3300046535 | Bacteria | 5229 |
| 655 | Ga0495609_0072558 | 3300046538 | Bacteria | 1511 |
| 656 | Ga0495609_0091798 | 3300046538 | Bacteria | 1321 |
| 657 | Ga0495621_0037911 | 3300046539 | Bacteria | 1679 |
| 658 | Ga0495667_0130322 | 3300046559 | Bacteria | 1622 |
| 659 | Ga0495667_0241575 | 3300046559 | Bacteria | 1150 |
| 660 | Ga0495668_0144101 | 3300046616 | Bacteria | 1304 |
| 661 | Ga0495611_0064673 | 3300046648 | Bacteria | 1666 |
| 662 | Ga0495611_0125745 | 3300046648 | Bacteria | 1196 |
| 663 | Ga0495659_0071858 | 3300046664 | Bacteria | 1297 |
| 664 | Ga0495661_0178949 | 3300046665 | Bacteria | 1125 |
| 665 | Ga0495588_0041439 | 3300046674 | Bacteria | 2351 |
| 666 | Ga0495646_0196629 | 3300046680 | Bacteria | 1100 |
| 667 | Ga0495658_0103578 | 3300046683 | Bacteria | 1702 |
| 668 | Ga0495669_0123716 | 3300046684 | Bacteria | 1214 |
| 669 | Ga0495613_0041286 | 3300046689 | Bacteria | 3417 |
| 670 | Ga0495613_0193661 | 3300046689 | Bacteria | 1436 |
| 671 | Ga0495670_0116129 | 3300046691 | Bacteria | 1388 |
| 672 | Ga0495589_0078952 | 3300046794 | Bacteria | 1602 |
| 673 | Ga0495660_0172388 | 3300046810 | Bacteria | 1053 |
| 674 | Ga0495581_0008654 | 3300047315 | Bacteria | 5895 |
| 675 | Ga0495604_0072396 | 3300047317 | Bacteria | 2605 |
| 676 | Ga0495680_0119491 | 3300047322 | Bacteria | 1947 |
| 677 | Ga0495675_0101051 | 3300047444 | Bacteria | 1805 |
| 678 | Ga0495677_0011755 | 3300047445 | Bacteria | 3200 |
| 679 | Ga0495677_0022339 | 3300047445 | Bacteria | 2295 |
| 680 | Ga0495684_0045879 | 3300047471 | Bacteria | 3343 |
| 681 | Ga0495602_0090090 | 3300048088 | Bacteria | 2549 |
| 682 | Ga0495602_0271473 | 3300048088 | Bacteria | 1253 |
| 683 | Ga0495602_0386774 | 3300048088 | Bacteria | 1001 |
| 684 | Ga0496100_0010339 | 3300048903 | Bacteria | 5280 |
| 685 | Ga0496100_0058927 | 3300048903 | Bacteria | 2522 |
| 686 | Ga0496100_0165704 | 3300048903 | Bacteria | 1587 |
| 687 | Ga0496101_0010660 | 3300048904 | Bacteria | 6073 |
| 688 | Ga0496101_0046958 | 3300048904 | Bacteria | 3098 |
| 689 | Ga0496101_0074055 | 3300048904 | Bacteria | 2503 |
| 690 | Ga0496101_0096820 | 3300048904 | Bacteria | 2203 |
| 691 | Ga0496101_0131749 | 3300048904 | Bacteria | 1899 |
| 692 | Ga0496102_0006872 | 3300048905 | Bacteria | 9712 |
| 693 | Ga0496102_0034482 | 3300048905 | Bacteria | 4552 |
| 694 | Ga0496102_0080028 | 3300048905 | Bacteria | 3010 |
| 695 | Ga0496103_0001117 | 3300048906 | Bacteria | 18674 |
| 696 | Ga0496103_0051469 | 3300048906 | Bacteria | 2549 |
| 697 | Ga0496103_0151773 | 3300048906 | Bacteria | 1484 |
| 698 | Ga0496103_0172792 | 3300048906 | Bacteria | 1388 |
| 699 | Ga0496104_0002196 | 3300048907 | Bacteria | 16893 |
| 700 | Ga0496104_0065506 | 3300048907 | Bacteria | 3448 |
| 701 | Ga0496104_0096621 | 3300048907 | Bacteria | 2827 |
| 702 | Ga0496104_0455545 | 3300048907 | Bacteria | 1191 |
| 703 | Ga0496105_0000283 | 3300048908 | Bacteria | 33429 |
| 704 | Ga0496105_0071299 | 3300048908 | Bacteria | 2872 |
| 705 | Ga0496105_0113308 | 3300048908 | Bacteria | 2238 |
| 706 | Ga0496105_0146028 | 3300048908 | Bacteria | 1945 |
| 707 | Ga0496105_0149011 | 3300048908 | Bacteria | 1924 |
| 708 | Ga0496106_0007876 | 3300048909 | Bacteria | 7875 |
| 709 | Ga0496106_0039898 | 3300048909 | Bacteria | 3515 |
| 710 | Ga0496106_0159200 | 3300048909 | Bacteria | 1785 |
| 711 | Ga0496107_0004691 | 3300048910 | Bacteria | 9284 |
| 712 | Ga0496107_0024060 | 3300048910 | Bacteria | 4306 |
| 713 | Ga0496108_0002220 | 3300048911 | Bacteria | 15544 |
| 714 | Ga0496108_0017228 | 3300048911 | Bacteria | 5909 |
| 715 | Ga0496108_0027787 | 3300048911 | Bacteria | 4676 |
| 716 | Ga0496108_0042580 | 3300048911 | Bacteria | 3791 |
| 717 | Ga0496108_0065142 | 3300048911 | Bacteria | 3071 |
| 718 | Ga0496108_0316451 | 3300048911 | Bacteria | 1360 |
| 719 | Ga0496109_0000785 | 3300048912 | Bacteria | 26419 |
| 720 | Ga0496109_0008936 | 3300048912 | Bacteria | 8537 |
| 721 | Ga0496109_0015494 | 3300048912 | Bacteria | 6646 |
| 722 | Ga0496109_0047598 | 3300048912 | Bacteria | 3899 |
| 723 | Ga0496109_0071207 | 3300048912 | Bacteria | 3191 |
| 724 | Ga0496109_0224547 | 3300048912 | Bacteria | 1767 |
| 725 | Ga0496110_0000555 | 3300048913 | Bacteria | 25491 |
| 726 | Ga0496110_0002271 | 3300048913 | Bacteria | 14354 |
| 727 | Ga0496110_0016852 | 3300048913 | Bacteria | 6105 |
| 728 | Ga0496110_0024600 | 3300048913 | Bacteria | 5134 |
| 729 | Ga0496110_0138763 | 3300048913 | Bacteria | 2198 |
| 730 | Ga0496110_0465749 | 3300048913 | Bacteria | 1152 |
| 731 | Ga0496110_0996226 | 3300048913 | Unclassified | 745 |
| 732 | Ga0496111_0000703 | 3300048914 | Bacteria | 17719 |
| 733 | Ga0496111_0004301 | 3300048914 | Bacteria | 8977 |
| 734 | Ga0496111_0008368 | 3300048914 | Bacteria | 6840 |
| 735 | Ga0496111_0088441 | 3300048914 | Bacteria | 2269 |
| 736 | Ga0496112_0000415 | 3300048915 | Bacteria | 28101 |
| 737 | Ga0496112_0010167 | 3300048915 | Bacteria | 8525 |
| 738 | Ga0496112_0045544 | 3300048915 | Bacteria | 4300 |
| 739 | Ga0496112_0074963 | 3300048915 | Bacteria | 3346 |
| 740 | Ga0496112_0111162 | 3300048915 | Bacteria | 2710 |
| 741 | Ga0496112_0148667 | 3300048915 | Bacteria | 2310 |
| 742 | Ga0496113_0000335 | 3300048916 | Bacteria | 22374 |
| 743 | Ga0496113_0012986 | 3300048916 | Bacteria | 5620 |
| 744 | Ga0496113_0019335 | 3300048916 | Bacteria | 4762 |
| 745 | Ga0496113_0248128 | 3300048916 | Bacteria | 1421 |
| 746 | Ga0496113_0420546 | 3300048916 | Bacteria | 1073 |
| 747 | Ga0496114_0001492 | 3300048917 | Bacteria | 17771 |
| 748 | Ga0496114_0084020 | 3300048917 | Bacteria | 2695 |
| 749 | Ga0496114_0258841 | 3300048917 | Bacteria | 1532 |
| 750 | Ga0496114_0267204 | 3300048917 | Bacteria | 1507 |
| 751 | Ga0496114_0357078 | 3300048917 | Bacteria | 1293 |
| 752 | Ga0496115_0020149 | 3300048918 | Bacteria | 5141 |
| 753 | Ga0496115_0089641 | 3300048918 | Bacteria | 2512 |
| 754 | Ga0496115_0130013 | 3300048918 | Bacteria | 2075 |
| 755 | Ga0496115_0230407 | 3300048918 | Bacteria | 1528 |
| 756 | Ga0501031_0010930 | 3300049568 | Bacteria | 5912 |
| 757 | Ga0501032_0060784 | 3300049569 | Bacteria | 2534 |
| 758 | Ga0501033_0072109 | 3300049570 | Bacteria | 2536 |
| 759 | Ga0501034_0179167 | 3300049571 | Bacteria | 2084 |
| 760 | Ga0501036_0006390 | 3300049572 | Bacteria | 9565 |
| 761 | Ga0501036_0113383 | 3300049572 | Bacteria | 2291 |
| 762 | Ga0501037_0024894 | 3300049573 | Bacteria | 4424 |
| 763 | Ga0501038_0072433 | 3300049574 | Bacteria | 2920 |
| 764 | Ga0501039_0027456 | 3300049575 | Bacteria | 4377 |
| 765 | Ga0501040_0012664 | 3300049576 | Bacteria | 5531 |
| 766 | Ga0501041_0003076 | 3300049577 | Bacteria | 9584 |
| 767 | Ga0501041_0041960 | 3300049577 | Bacteria | 2779 |
| 768 | Ga0501042_0005065 | 3300049578 | Bacteria | 8455 |
| 769 | Ga0501042_0010629 | 3300049578 | Bacteria | 6182 |
| 770 | Ga0501043_0013884 | 3300049579 | Bacteria | 6302 |
| 771 | Ga0501043_0381326 | 3300049579 | Bacteria | 1067 |
| 772 | Ga0501046_0005063 | 3300049580 | Bacteria | 11816 |
| 773 | Ga0501046_0051136 | 3300049580 | Bacteria | 3262 |
| 774 | Ga0501047_0132227 | 3300049581 | Bacteria | 2375 |
| 775 | Ga0501047_0145112 | 3300049581 | Bacteria | 2251 |
| 776 | Ga0501047_0294112 | 3300049581 | Bacteria | 1467 |
| 777 | Ga0501048_0009048 | 3300049582 | Bacteria | 7495 |
| 778 | Ga0501067_0017617 | 3300049583 | Bacteria | 3953 |
| 779 | Ga0501067_0024848 | 3300049583 | Bacteria | 3322 |
| 780 | Ga0501068_0005241 | 3300049584 | Bacteria | 7076 |
| 781 | Ga0501068_0016442 | 3300049584 | Bacteria | 4265 |
| 782 | Ga0501068_0034183 | 3300049584 | Bacteria | 3032 |
| 783 | Ga0501068_0127412 | 3300049584 | Bacteria | 1590 |
| 784 | Ga0501069_0004780 | 3300049585 | Bacteria | 7009 |
| 785 | Ga0501069_0014630 | 3300049585 | Bacteria | 4196 |
| 786 | Ga0501069_0042923 | 3300049585 | Bacteria | 2502 |
| 787 | Ga0501069_0082640 | 3300049585 | Bacteria | 1810 |
| 788 | Ga0501070_0000336 | 3300049586 | Bacteria | 42631 |
| 789 | Ga0501070_0076035 | 3300049586 | Bacteria | 2780 |
| 790 | Ga0501070_0117029 | 3300049586 | Bacteria | 2201 |
| 791 | Ga0501070_0584956 | 3300049586 | Bacteria | 891 |
| 792 | Ga0501071_0000851 | 3300049587 | Bacteria | 16378 |
| 793 | Ga0501071_0010736 | 3300049587 | Bacteria | 6143 |
| 794 | Ga0501071_0115874 | 3300049587 | Bacteria | 1983 |
| 795 | Ga0501072_0004260 | 3300049588 | Bacteria | 10850 |
| 796 | Ga0501072_0007485 | 3300049588 | Bacteria | 8286 |
| 797 | Ga0501074_0001907 | 3300049590 | Bacteria | 14324 |
| 798 | Ga0501074_0118728 | 3300049590 | Bacteria | 1891 |
| 799 | Ga0501074_0164022 | 3300049590 | Bacteria | 1586 |
| 800 | Ga0501075_0000839 | 3300049591 | Bacteria | 19363 |
| 801 | Ga0501075_0044049 | 3300049591 | Bacteria | 3347 |
| 802 | Ga0501076_0000358 | 3300049592 | Bacteria | 28280 |
| 803 | Ga0501076_0007761 | 3300049592 | Bacteria | 7820 |
| 804 | Ga0501076_0243392 | 3300049592 | Bacteria | 1472 |
| 805 | Ga0501077_0005112 | 3300049593 | Bacteria | 7962 |
| 806 | Ga0501077_0018701 | 3300049593 | Bacteria | 4382 |
| 807 | Ga0501079_0024061 | 3300049741 | Bacteria | 4672 |
| 808 | Ga0501080_0004255 | 3300049742 | Bacteria | 12703 |
| 809 | Ga0501080_0032874 | 3300049742 | Bacteria | 4840 |
| 810 | Ga0501080_0338318 | 3300049742 | Bacteria | 1360 |
| 811 | Ga0501081_0006931 | 3300049743 | Bacteria | 7364 |
| 812 | Ga0501081_0020550 | 3300049743 | Bacteria | 4400 |
| 813 | Ga0501081_0135777 | 3300049743 | Bacteria | 1761 |
| 814 | Ga0501081_0204250 | 3300049743 | Bacteria | 1434 |
| 815 | Ga0501083_0008044 | 3300049744 | Bacteria | 7459 |
| 816 | Ga0501083_0011606 | 3300049744 | Bacteria | 6180 |
| 817 | Ga0501035_0003674 | 3300049822 | Bacteria | 14625 |
| 818 | Ga0501035_0207517 | 3300049822 | Bacteria | 1678 |
| 819 | Ga0501035_0359033 | 3300049822 | Bacteria | 1218 |
| 820 | Ga0501044_0034087 | 3300049823 | Bacteria | 5344 |
| 821 | Ga0501044_0220790 | 3300049823 | Bacteria | 1846 |
| 822 | Ga0501045_0045002 | 3300049824 | Bacteria | 3214 |
| 823 | Ga0501045_0080369 | 3300049824 | Bacteria | 2403 |
| 824 | Ga0501045_0118073 | 3300049824 | Bacteria | 1968 |
| 825 | Ga0501045_0338899 | 3300049824 | Bacteria | 1119 |
| 826 | nmdc:mga05p37_10095_c1 | 3300050507 | Bacteria | 11208 |
| 827 | nmdc:mga05p37_10918_c1 | 3300050507 | Bacteria | 10781 |
| 828 | nmdc:mga05p37_219348_c1 | 3300050507 | Bacteria | 2296 |
| 829 | nmdc:mga05p37_464866_c1 | 3300050507 | Bacteria | 1461 |
| 830 | nmdc:mga05p37_682426_c1 | 3300050507 | Bacteria | 1144 |
| 831 | nmdc:mga09592_4343_c1 | 3300050508 | Bacteria | 11461 |
| 832 | nmdc:mga06r32_84424_c1 | 3300050510 | Bacteria | 3095 |
| 833 | nmdc:mga08y16_13085_c1 | 3300050511 | Bacteria | 8729 |
| 834 | nmdc:mga08y16_7593_c1 | 3300050511 | Bacteria | 11352 |
| 835 | nmdc:mga0n895_60071_c1 | 3300050512 | Bacteria | 3751 |
| 836 | nmdc:mga0n895_602480_c1 | 3300050512 | Bacteria | 1101 |
| 837 | nmdc:mga0rr50_326886_c1 | 3300050513 | Bacteria | 1287 |
| 838 | nmdc:mga08x19_150061_c1 | 3300050514 | Bacteria | 1578 |
| 839 | nmdc:mga08x19_91437_c1 | 3300050514 | Bacteria | 2009 |
| 840 | nmdc:mga0a205_16103_c2 | 3300050515 | Bacteria | 5338 |
| 841 | nmdc:mga0a205_25675_c1 | 3300050515 | Bacteria | 5615 |
| 842 | nmdc:mga0a205_33357_c1 | 3300050515 | Bacteria | 4936 |
| 843 | nmdc:mga0a205_462481_c1 | 3300050515 | Bacteria | 1128 |
| 844 | nmdc:mga0a205_46692_c1 | 3300050515 | Bacteria | 4177 |
| 845 | Ga0495601_0165389 | 3300053077 | Bacteria | 1446 |
| 846 | Ga0495655_0004823 | 3300053083 | Bacteria | 2338 |
| 847 | Ga0495619_0192305 | 3300053085 | Bacteria | 1412 |
| 848 | Ga0495619_0380509 | 3300053085 | Bacteria | 975 |
| 849 | Ga0501084_0000537 | 3300054114 | Bacteria | 28931 |
| 850 | Ga0501084_0026313 | 3300054114 | Bacteria | 4853 |
| 851 | Ga0501082_0003976 | 3300060353 | Bacteria | 12907 |
| 852 | Ga0501082_0034450 | 3300060353 | Bacteria | 4365 |
| 853 | Ga0466962_0000434 | 3300061719 | Bacteria | 18170 |
| 854 | Ga0466962_0056411 | 3300061719 | Bacteria | 1876 |
| 855 | Ga0530510_0017961 | 3300061734 | Bacteria | 5015 |
| 856 | Ga0530510_0053577 | 3300061734 | Bacteria | 2916 |
| 857 | Ga0530510_0066061 | 3300061734 | Bacteria | 2621 |
| 858 | Ga0530510_0091887 | 3300061734 | Bacteria | 2215 |
| 859 | Ga0530510_0205333 | 3300061734 | Bacteria | 1464 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044694 | Ga0466963_0372739 | Ga0466963_0372739_14_697 | 209 |
| 2 | 3300005563 | Ga0068855_100012204 | Ga0068855_1000122047 | 216 |
| 3 | 3300025944 | Ga0207661_10245636 | Ga0207661_102456362 | 216 |
| 4 | 3300025949 | Ga0207667_10026439 | Ga0207667_100264392 | 216 |
| 5 | 3300048913 | Ga0496110_0996226 | Ga0496110_0996226_18_722 | 216 |
| 6 | 3300028563 | Ga0265319_1000846 | Ga0265319_10008462 | 220 |
| 7 | 3300028577 | Ga0265318_10002860 | Ga0265318_100028602 | 220 |
| 8 | 3300028800 | Ga0265338_10010871 | Ga0265338_100108719 | 220 |
| 9 | 3300031240 | Ga0265320_10049854 | Ga0265320_100498542 | 220 |
| 10 | 3300031250 | Ga0265331_10038770 | Ga0265331_100387702 | 220 |
| 11 | 3300031344 | Ga0265316_10371680 | Ga0265316_103716802 | 220 |
| 12 | 3300031711 | Ga0265314_10024298 | Ga0265314_100242981 | 220 |
| 13 | 3300045976 | Ga0466967_0093004 | Ga0466967_0093004_1011_1907 | 221 |
| 14 | 3300037418 | Ga0395900_0300839 | Ga0395900_0300839_310_1158 | 223 |
| 15 | 3300037466 | Ga0395898_0062682 | Ga0395898_0062682_719_1567 | 223 |
| 16 | 3300038443 | Ga0395901_0008678 | Ga0395901_0008678_1547_2395 | 223 |
| 17 | 3300031344 | Ga0265316_10329961 | Ga0265316_103299612 | 224 |
| 18 | 3300044694 | Ga0466963_0066267 | Ga0466963_0066267_997_1929 | 224 |
| 19 | 3300046559 | Ga0495667_0130322 | Ga0495667_0130322_12_713 | 224 |
| 20 | 3300053085 | Ga0495619_0380509 | Ga0495619_0380509_242_943 | 224 |
| 21 | 3300005329 | Ga0070683_100205643 | Ga0070683_1002056432 | 226 |
| 22 | 3300005535 | Ga0070684_100378390 | Ga0070684_1003783902 | 226 |
| 23 | 3300044842 | Ga0466957_0094771 | Ga0466957_0094771_934_1830 | 229 |
| 24 | 3300013105 | Ga0157369_10018894 | Ga0157369_100188949 | 230 |
| 25 | 3300045976 | Ga0466967_0026310 | Ga0466967_0026310_1259_2155 | 230 |
| 26 | 3300045976 | Ga0466967_0545223 | Ga0466967_0545223_231_1124 | 233 |
| 27 | 3300005435 | Ga0070714_100157277 | Ga0070714_1001572772 | 234 |
| 28 | 3300031711 | Ga0265314_10163158 | Ga0265314_101631582 | 234 |
| 29 | 3300005329 | Ga0070683_100171743 | Ga0070683_1001717432 | 235 |
| 30 | 3300005458 | Ga0070681_10178703 | Ga0070681_101787032 | 235 |
| 31 | 3300005530 | Ga0070679_100227082 | Ga0070679_1002270822 | 235 |
| 32 | 3300005539 | Ga0068853_100204900 | Ga0068853_1002049002 | 235 |
| 33 | 3300005563 | Ga0068855_100264543 | Ga0068855_1002645432 | 235 |
| 34 | 3300006028 | Ga0070717_10611452 | Ga0070717_106114521 | 235 |
| 35 | 3300009545 | Ga0105237_10050600 | Ga0105237_100506005 | 235 |
| 36 | 3300009551 | Ga0105238_10006788 | Ga0105238_100067885 | 235 |
| 37 | 3300013100 | Ga0157373_10024948 | Ga0157373_100249482 | 235 |
| 38 | 3300013104 | Ga0157370_10044909 | Ga0157370_100449095 | 235 |
| 39 | 3300013307 | Ga0157372_10052407 | Ga0157372_100524074 | 235 |
| 40 | 3300020070 | Ga0206356_10907748 | Ga0206356_109077482 | 235 |
| 41 | 3300025913 | Ga0207695_10138406 | Ga0207695_101384063 | 235 |
| 42 | 3300025914 | Ga0207671_10157798 | Ga0207671_101577981 | 235 |
| 43 | 3300028556 | Ga0265337_1024111 | Ga0265337_10241112 | 235 |
| 44 | 3300028800 | Ga0265338_10006416 | Ga0265338_100064162 | 235 |
| 45 | 3300031238 | Ga0265332_10022521 | Ga0265332_100225212 | 235 |
| 46 | 3300031249 | Ga0265339_10008169 | Ga0265339_100081694 | 235 |
| 47 | 3300031595 | Ga0265313_10070231 | Ga0265313_100702312 | 235 |
| 48 | 3300031711 | Ga0265314_10004955 | Ga0265314_100049554 | 235 |
| 49 | 3300037466 | Ga0395898_0588594 | Ga0395898_0588594_108_1040 | 235 |
| 50 | 3300045976 | Ga0466967_0337126 | Ga0466967_0337126_175_1074 | 235 |
| 51 | 3300044842 | Ga0466957_0025548 | Ga0466957_0025548_1397_2293 | 238 |
| 52 | 3300045836 | Ga0466958_0138610 | Ga0466958_0138610_170_1066 | 238 |
| 53 | 3300045976 | Ga0466967_0053156 | Ga0466967_0053156_1573_2469 | 238 |
| 54 | 3300048918 | Ga0496115_0089641 | Ga0496115_0089641_463_1362 | 238 |
| 55 | 3300061719 | Ga0466962_0056411 | Ga0466962_0056411_460_1356 | 238 |
| 56 | 3300044706 | Ga0466964_0004331 | Ga0466964_0004331_3112_4008 | 240 |
| 57 | 3300031235 | Ga0265330_10052007 | Ga0265330_100520072 | 241 |
| 58 | 3300044694 | Ga0466963_0029826 | Ga0466963_0029826_679_1578 | 241 |
| 59 | 3300028800 | Ga0265338_10050515 | Ga0265338_100505156 | 242 |
| 60 | 3300005329 | Ga0070683_100056634 | Ga0070683_1000566343 | 244 |
| 61 | 3300005336 | Ga0070680_100003799 | Ga0070680_1000037999 | 244 |
| 62 | 3300005458 | Ga0070681_10009610 | Ga0070681_100096107 | 244 |
| 63 | 3300005530 | Ga0070679_100009682 | Ga0070679_1000096827 | 244 |
| 64 | 3300005535 | Ga0070684_100006235 | Ga0070684_1000062356 | 244 |
| 65 | 3300005563 | Ga0068855_100031221 | Ga0068855_1000312212 | 244 |
| 66 | 3300009093 | Ga0105240_10306751 | Ga0105240_103067512 | 244 |
| 67 | 3300009176 | Ga0105242_10422111 | Ga0105242_104221111 | 244 |
| 68 | 3300013104 | Ga0157370_10154371 | Ga0157370_101543712 | 244 |
| 69 | 3300020070 | Ga0206356_11271870 | Ga0206356_112718702 | 244 |
| 70 | 3300020082 | Ga0206353_11243256 | Ga0206353_112432563 | 244 |
| 71 | 3300025912 | Ga0207707_10048845 | Ga0207707_100488452 | 244 |
| 72 | 3300025917 | Ga0207660_10022590 | Ga0207660_100225901 | 244 |
| 73 | 3300025919 | Ga0207657_10000392 | Ga0207657_1000039220 | 244 |
| 74 | 3300048913 | Ga0496110_0138763 | Ga0496110_0138763_391_1293 | 244 |
| 75 | 3300049583 | Ga0501067_0024848 | Ga0501067_0024848_412_1242 | 244 |
| 76 | 3300049585 | Ga0501069_0014630 | Ga0501069_0014630_2821_3651 | 244 |
| 77 | 3300005436 | Ga0070713_100420627 | Ga0070713_1004206271 | 245 |
| 78 | 3300035724 | Ga0373933_0044316 | Ga0373933_0044316_1668_2471 | 245 |
| 79 | 3300048907 | Ga0496104_0065506 | Ga0496104_0065506_262_1101 | 245 |
| 80 | 3300048908 | Ga0496105_0146028 | Ga0496105_0146028_614_1453 | 245 |
| 81 | 3300049742 | Ga0501080_0338318 | Ga0501080_0338318_56_868 | 245 |
| 82 | 3300031995 | Ga0307409_100118439 | Ga0307409_1001184393 | 246 |
| 83 | 3300032126 | Ga0307415_100212441 | Ga0307415_1002124412 | 246 |
| 84 | 3300042122 | Ga0450920_035425 | Ga0450920_035425_66_959 | 246 |
| 85 | 3300049579 | Ga0501043_0381326 | Ga0501043_0381326_290_1030 | 246 |
| 86 | 3300049824 | Ga0501045_0118073 | Ga0501045_0118073_1193_1933 | 246 |
| 87 | 3300005456 | Ga0070678_100206742 | Ga0070678_1002067422 | 247 |
| 88 | 3300005458 | Ga0070681_10242256 | Ga0070681_102422562 | 247 |
| 89 | 3300005981 | Ga0081538_10092110 | Ga0081538_100921102 | 247 |
| 90 | 3300009176 | Ga0105242_10047304 | Ga0105242_100473044 | 247 |
| 91 | 3300026121 | Ga0207683_10087160 | Ga0207683_100871602 | 247 |
| 92 | 3300049571 | Ga0501034_0179167 | Ga0501034_0179167_102_998 | 247 |
| 93 | 3300049581 | Ga0501047_0132227 | Ga0501047_0132227_1048_1944 | 247 |
| 94 | 3300049822 | Ga0501035_0359033 | Ga0501035_0359033_264_1160 | 247 |
| 95 | 3300005440 | Ga0070705_100044043 | Ga0070705_1000440432 | 248 |
| 96 | 3300005981 | Ga0081538_10004835 | Ga0081538_100048355 | 248 |
| 97 | 3300005981 | Ga0081538_10031354 | Ga0081538_100313542 | 248 |
| 98 | 3300049824 | Ga0501045_0338899 | Ga0501045_0338899_119_928 | 248 |
| 99 | 3300003323 | rootH1_10298486 | rootH1_102984862 | 249 |
| 100 | 3300007076 | Ga0075435_100188293 | Ga0075435_1001882932 | 249 |
| 101 | 3300049823 | Ga0501044_0220790 | Ga0501044_0220790_582_1430 | 250 |
| 102 | 3300028800 | Ga0265338_10000705 | Ga0265338_1000070542 | 251 |
| 103 | 3300031251 | Ga0265327_10013262 | Ga0265327_100132625 | 251 |
| 104 | 3300035172 | Ga0373955_0268369 | Ga0373955_0268369_50_940 | 251 |
| 105 | 3300036401 | Ga0373937_0048175 | Ga0373937_0048175_470_1360 | 251 |
| 106 | 3300045836 | Ga0466958_0088961 | Ga0466958_0088961_27_923 | 251 |
| 107 | 3300045976 | Ga0466967_0015544 | Ga0466967_0015544_3306_4145 | 251 |
| 108 | 3300046511 | Ga0495608_0026080 | Ga0495608_0026080_2143_3033 | 251 |
| 109 | 3300046529 | Ga0495652_0339985 | Ga0495652_0339985_160_1050 | 251 |
| 110 | 3300046559 | Ga0495667_0241575 | Ga0495667_0241575_212_1102 | 251 |
| 111 | 3300047317 | Ga0495604_0072396 | Ga0495604_0072396_173_1063 | 251 |
| 112 | 3300047444 | Ga0495675_0101051 | Ga0495675_0101051_146_1036 | 251 |
| 113 | 3300047471 | Ga0495684_0045879 | Ga0495684_0045879_664_1554 | 251 |
| 114 | 3300048088 | Ga0495602_0386774 | Ga0495602_0386774_72_962 | 251 |
| 115 | 3300049584 | Ga0501068_0034183 | Ga0501068_0034183_1420_2268 | 251 |
| 116 | 3300005336 | Ga0070680_100340706 | Ga0070680_1003407062 | 252 |
| 117 | 3300005444 | Ga0070694_100032102 | Ga0070694_1000321024 | 252 |
| 118 | 3300005458 | Ga0070681_10146508 | Ga0070681_101465082 | 252 |
| 119 | 3300005545 | Ga0070695_100001212 | Ga0070695_1000012128 | 252 |
| 120 | 3300005937 | Ga0081455_10066747 | Ga0081455_100667471 | 252 |
| 121 | 3300009093 | Ga0105240_10009160 | Ga0105240_100091608 | 252 |
| 122 | 3300009545 | Ga0105237_10039745 | Ga0105237_100397455 | 252 |
| 123 | 3300013307 | Ga0157372_10020185 | Ga0157372_100201855 | 252 |
| 124 | 3300025913 | Ga0207695_10022893 | Ga0207695_100228935 | 252 |
| 125 | 3300025914 | Ga0207671_10042344 | Ga0207671_100423444 | 252 |
| 126 | 3300025949 | Ga0207667_10176749 | Ga0207667_101767492 | 252 |
| 127 | 3300044694 | Ga0466963_0000671 | Ga0466963_0000671_84_980 | 252 |
| 128 | 3300045976 | Ga0466967_0475593 | Ga0466967_0475593_295_1191 | 252 |
| 129 | 3300046459 | Ga0495629_0082841 | Ga0495629_0082841_956_1765 | 252 |
| 130 | 3300046463 | Ga0495653_0144625 | Ga0495653_0144625_681_1490 | 252 |
| 131 | 3300046511 | Ga0495608_0220232 | Ga0495608_0220232_180_989 | 252 |
| 132 | 3300047322 | Ga0495680_0119491 | Ga0495680_0119491_644_1453 | 252 |
| 133 | 3300048905 | Ga0496102_0006872 | Ga0496102_0006872_3916_4737 | 252 |
| 134 | 3300002076 | JGI24749J21850_1005718 | JGI24749J21850_10057182 | 253 |
| 135 | 3300005329 | Ga0070683_100036210 | Ga0070683_1000362104 | 253 |
| 136 | 3300005331 | Ga0070670_100002873 | Ga0070670_10000287311 | 253 |
| 137 | 3300005331 | Ga0070670_100148623 | Ga0070670_1001486232 | 253 |
| 138 | 3300005334 | Ga0068869_100020150 | Ga0068869_1000201501 | 253 |
| 139 | 3300005337 | Ga0070682_100081973 | Ga0070682_1000819732 | 253 |
| 140 | 3300005338 | Ga0068868_100043982 | Ga0068868_1000439824 | 253 |
| 141 | 3300005340 | Ga0070689_100023937 | Ga0070689_1000239372 | 253 |
| 142 | 3300005343 | Ga0070687_100112684 | Ga0070687_1001126842 | 253 |
| 143 | 3300005354 | Ga0070675_100085638 | Ga0070675_1000856383 | 253 |
| 144 | 3300005355 | Ga0070671_100045043 | Ga0070671_1000450432 | 253 |
| 145 | 3300005356 | Ga0070674_100075189 | Ga0070674_1000751893 | 253 |
| 146 | 3300005364 | Ga0070673_100018908 | Ga0070673_1000189082 | 253 |
| 147 | 3300005366 | Ga0070659_100070384 | Ga0070659_1000703843 | 253 |
| 148 | 3300005439 | Ga0070711_100423813 | Ga0070711_1004238132 | 253 |
| 149 | 3300005440 | Ga0070705_100160132 | Ga0070705_1001601322 | 253 |
| 150 | 3300005441 | Ga0070700_100001364 | Ga0070700_1000013649 | 253 |
| 151 | 3300005444 | Ga0070694_100250391 | Ga0070694_1002503911 | 253 |
| 152 | 3300005455 | Ga0070663_100152860 | Ga0070663_1001528602 | 253 |
| 153 | 3300005456 | Ga0070678_100006943 | Ga0070678_1000069436 | 253 |
| 154 | 3300005459 | Ga0068867_100103678 | Ga0068867_1001036782 | 253 |
| 155 | 3300005466 | Ga0070685_10004735 | Ga0070685_100047353 | 253 |
| 156 | 3300005518 | Ga0070699_100006802 | Ga0070699_1000068029 | 253 |
| 157 | 3300005535 | Ga0070684_100050130 | Ga0070684_1000501302 | 253 |
| 158 | 3300005544 | Ga0070686_100031350 | Ga0070686_1000313502 | 253 |
| 159 | 3300005547 | Ga0070693_100210886 | Ga0070693_1002108862 | 253 |
| 160 | 3300005548 | Ga0070665_100013694 | Ga0070665_1000136942 | 253 |
| 161 | 3300005615 | Ga0070702_100250049 | Ga0070702_1002500492 | 253 |
| 162 | 3300005618 | Ga0068864_100010046 | Ga0068864_1000100468 | 253 |
| 163 | 3300005719 | Ga0068861_100557003 | Ga0068861_1005570031 | 253 |
| 164 | 3300005840 | Ga0068870_10005803 | Ga0068870_100058035 | 253 |
| 165 | 3300006844 | Ga0075428_100070676 | Ga0075428_1000706761 | 253 |
| 166 | 3300006881 | Ga0068865_100021473 | Ga0068865_1000214733 | 253 |
| 167 | 3300009147 | Ga0114129_10179983 | Ga0114129_101799834 | 253 |
| 168 | 3300009176 | Ga0105242_10180473 | Ga0105242_101804732 | 253 |
| 169 | 3300009177 | Ga0105248_10218547 | Ga0105248_102185472 | 253 |
| 170 | 3300011119 | Ga0105246_10006134 | Ga0105246_100061342 | 253 |
| 171 | 3300011119 | Ga0105246_10052146 | Ga0105246_100521463 | 253 |
| 172 | 3300013308 | Ga0157375_10014563 | Ga0157375_100145636 | 253 |
| 173 | 3300014325 | Ga0163163_10002702 | Ga0163163_1000270214 | 253 |
| 174 | 3300014326 | Ga0157380_10120038 | Ga0157380_101200382 | 253 |
| 175 | 3300014745 | Ga0157377_10011681 | Ga0157377_100116812 | 253 |
| 176 | 3300017792 | Ga0163161_10030576 | Ga0163161_100305764 | 253 |
| 177 | 3300025901 | Ga0207688_10007135 | Ga0207688_100071353 | 253 |
| 178 | 3300025907 | Ga0207645_10088914 | Ga0207645_100889142 | 253 |
| 179 | 3300025908 | Ga0207643_10007449 | Ga0207643_100074494 | 253 |
| 180 | 3300025918 | Ga0207662_10315848 | Ga0207662_103158481 | 253 |
| 181 | 3300025925 | Ga0207650_10001595 | Ga0207650_100015954 | 253 |
| 182 | 3300025926 | Ga0207659_10084766 | Ga0207659_100847662 | 253 |
| 183 | 3300025927 | Ga0207687_10031107 | Ga0207687_100311072 | 253 |
| 184 | 3300025931 | Ga0207644_10151624 | Ga0207644_101516242 | 253 |
| 185 | 3300025932 | Ga0207690_10388882 | Ga0207690_103888822 | 253 |
| 186 | 3300025935 | Ga0207709_10041624 | Ga0207709_100416242 | 253 |
| 187 | 3300025938 | Ga0207704_10097403 | Ga0207704_100974032 | 253 |
| 188 | 3300025940 | Ga0207691_10035608 | Ga0207691_100356085 | 253 |
| 189 | 3300025944 | Ga0207661_10267589 | Ga0207661_102675892 | 253 |
| 190 | 3300025972 | Ga0207668_10233307 | Ga0207668_102333072 | 253 |
| 191 | 3300025981 | Ga0207640_10196939 | Ga0207640_101969392 | 253 |
| 192 | 3300026067 | Ga0207678_10065220 | Ga0207678_100652203 | 253 |
| 193 | 3300026075 | Ga0207708_10005066 | Ga0207708_100050668 | 253 |
| 194 | 3300026095 | Ga0207676_10015876 | Ga0207676_100158765 | 253 |
| 195 | 3300026118 | Ga0207675_100812348 | Ga0207675_1008123481 | 253 |
| 196 | 3300026121 | Ga0207683_10024530 | Ga0207683_100245303 | 253 |
| 197 | 3300026142 | Ga0207698_10422020 | Ga0207698_104220202 | 253 |
| 198 | 3300045976 | Ga0466967_0052620 | Ga0466967_0052620_506_1426 | 253 |
| 199 | 3300046462 | Ga0495651_0223954 | Ga0495651_0223954_241_1098 | 253 |
| 200 | 3300048088 | Ga0495602_0090090 | Ga0495602_0090090_426_1283 | 253 |
| 201 | 3300048912 | Ga0496109_0071207 | Ga0496109_0071207_2015_2866 | 253 |
| 202 | 3300048914 | Ga0496111_0088441 | Ga0496111_0088441_366_1217 | 253 |
| 203 | 3300048916 | Ga0496113_0248128 | Ga0496113_0248128_412_1263 | 253 |
| 204 | 3300049581 | Ga0501047_0294112 | Ga0501047_0294112_443_1288 | 253 |
| 205 | 3300049585 | Ga0501069_0082640 | Ga0501069_0082640_67_912 | 253 |
| 206 | 3300049590 | Ga0501074_0164022 | Ga0501074_0164022_562_1407 | 253 |
| 207 | 3300050507 | nmdc:mga05p37_10095_c1 | nmdc:mga05p37_10095_c1_5145_5996 | 253 |
| 208 | 3300050507 | nmdc:mga05p37_219348_c1 | nmdc:mga05p37_219348_c1_117_968 | 253 |
| 209 | 3300005434 | Ga0070709_10205326 | Ga0070709_102053262 | 254 |
| 210 | 3300005435 | Ga0070714_100019569 | Ga0070714_1000195695 | 254 |
| 211 | 3300025906 | Ga0207699_10210631 | Ga0207699_102106312 | 254 |
| 212 | 3300045976 | Ga0466967_0045222 | Ga0466967_0045222_2450_3298 | 254 |
| 213 | 3300048918 | Ga0496115_0230407 | Ga0496115_0230407_212_1069 | 255 |
| 214 | 3300005336 | Ga0070680_100344442 | Ga0070680_1003444422 | 256 |
| 215 | 3300005341 | Ga0070691_10039543 | Ga0070691_100395431 | 256 |
| 216 | 3300005345 | Ga0070692_10124424 | Ga0070692_101244242 | 256 |
| 217 | 3300005366 | Ga0070659_100393505 | Ga0070659_1003935051 | 256 |
| 218 | 3300005578 | Ga0068854_100241908 | Ga0068854_1002419082 | 256 |
| 219 | 3300005615 | Ga0070702_100040736 | Ga0070702_1000407362 | 256 |
| 220 | 3300005937 | Ga0081455_10013165 | Ga0081455_100131657 | 256 |
| 221 | 3300009094 | Ga0111539_10174445 | Ga0111539_101744452 | 256 |
| 222 | 3300009098 | Ga0105245_10080204 | Ga0105245_100802042 | 256 |
| 223 | 3300009148 | Ga0105243_10707706 | Ga0105243_107077062 | 256 |
| 224 | 3300010375 | Ga0105239_10026235 | Ga0105239_100262352 | 256 |
| 225 | 3300025901 | Ga0207688_10037103 | Ga0207688_100371032 | 256 |
| 226 | 3300025927 | Ga0207687_10353276 | Ga0207687_103532761 | 256 |
| 227 | 3300025961 | Ga0207712_10448386 | Ga0207712_104483861 | 256 |
| 228 | 3300025972 | Ga0207668_10339742 | Ga0207668_103397422 | 256 |
| 229 | 3300026075 | Ga0207708_10078445 | Ga0207708_100784452 | 256 |
| 230 | 3300026089 | Ga0207648_10034363 | Ga0207648_100343634 | 256 |
| 231 | 3300026121 | Ga0207683_10226527 | Ga0207683_102265272 | 256 |
| 232 | 3300031548 | Ga0307408_100006161 | Ga0307408_1000061618 | 256 |
| 233 | 3300031731 | Ga0307405_10057524 | Ga0307405_100575242 | 256 |
| 234 | 3300031824 | Ga0307413_10014618 | Ga0307413_100146182 | 256 |
| 235 | 3300031852 | Ga0307410_10000753 | Ga0307410_1000075313 | 256 |
| 236 | 3300031901 | Ga0307406_10007192 | Ga0307406_100071924 | 256 |
| 237 | 3300031901 | Ga0307406_10369647 | Ga0307406_103696472 | 256 |
| 238 | 3300031903 | Ga0307407_10006605 | Ga0307407_100066056 | 256 |
| 239 | 3300031995 | Ga0307409_100002792 | Ga0307409_1000027924 | 256 |
| 240 | 3300032002 | Ga0307416_100040203 | Ga0307416_1000402034 | 256 |
| 241 | 3300032004 | Ga0307414_10024401 | Ga0307414_100244012 | 256 |
| 242 | 3300032005 | Ga0307411_10005161 | Ga0307411_100051614 | 256 |
| 243 | 3300032126 | Ga0307415_100004291 | Ga0307415_1000042913 | 256 |
| 244 | 3300042005 | Ga0439448_0003935 | Ga0439448_0003935_1488_2312 | 256 |
| 245 | 3300045051 | Ga0451576_0717287 | Ga0451576_0717287_97_921 | 256 |
| 246 | 3300046458 | Ga0495591_030561 | Ga0495591_030561_357_1181 | 256 |
| 247 | 3300046518 | Ga0495631_0106859 | Ga0495631_0106859_330_1154 | 256 |
| 248 | 3300046520 | Ga0495637_0104698 | Ga0495637_0104698_236_1060 | 256 |
| 249 | 3300046525 | Ga0495663_0041595 | Ga0495663_0041595_123_947 | 256 |
| 250 | 3300046528 | Ga0495642_0077601 | Ga0495642_0077601_308_1132 | 256 |
| 251 | 3300046530 | Ga0495654_0140010 | Ga0495654_0140010_98_922 | 256 |
| 252 | 3300046648 | Ga0495611_0064673 | Ga0495611_0064673_752_1576 | 256 |
| 253 | 3300046665 | Ga0495661_0178949 | Ga0495661_0178949_247_1071 | 256 |
| 254 | 3300047445 | Ga0495677_0011755 | Ga0495677_0011755_1431_2255 | 256 |
| 255 | 3300048905 | Ga0496102_0080028 | Ga0496102_0080028_2170_2994 | 256 |
| 256 | 3300005436 | Ga0070713_100495393 | Ga0070713_1004953932 | 257 |
| 257 | 3300005518 | Ga0070699_100298523 | Ga0070699_1002985232 | 257 |
| 258 | 3300005985 | Ga0081539_10000620 | Ga0081539_1000062074 | 257 |
| 259 | 3300006028 | Ga0070717_10080163 | Ga0070717_100801632 | 257 |
| 260 | 3300025928 | Ga0207700_10038006 | Ga0207700_100380063 | 257 |
| 261 | 3300025935 | Ga0207709_10064273 | Ga0207709_100642732 | 257 |
| 262 | 3300028800 | Ga0265338_10011986 | Ga0265338_100119869 | 257 |
| 263 | 3300039438 | Ga0436360_0239625 | Ga0436360_0239625_489_1331 | 257 |
| 264 | 3300045976 | Ga0466967_0103792 | Ga0466967_0103792_814_1653 | 257 |
| 265 | 3300046500 | Ga0495596_0027279 | Ga0495596_0027279_1020_1844 | 257 |
| 266 | 3300046538 | Ga0495609_0072558 | Ga0495609_0072558_407_1231 | 257 |
| 267 | 3300046539 | Ga0495621_0037911 | Ga0495621_0037911_394_1218 | 257 |
| 268 | 3300046664 | Ga0495659_0071858 | Ga0495659_0071858_457_1281 | 257 |
| 269 | 3300050514 | nmdc:mga08x19_150061_c1 | nmdc:mga08x19_150061_c1_551_1393 | 257 |
| 270 | 3300053083 | Ga0495655_0004823 | Ga0495655_0004823_944_1768 | 257 |
| 271 | 3300025927 | Ga0207687_10207264 | Ga0207687_102072642 | 258 |
| 272 | 3300037418 | Ga0395900_0621507 | Ga0395900_0621507_71_973 | 258 |
| 273 | 3300049743 | Ga0501081_0204250 | Ga0501081_0204250_486_1337 | 258 |
| 274 | 3300053077 | Ga0495601_0165389 | Ga0495601_0165389_12_821 | 258 |
| 275 | 3300061734 | Ga0530510_0091887 | Ga0530510_0091887_592_1443 | 258 |
| 276 | 3300009148 | Ga0105243_10038804 | Ga0105243_100388042 | 259 |
| 277 | 3300048913 | Ga0496110_0465749 | Ga0496110_0465749_139_951 | 259 |
| 278 | 3300049586 | Ga0501070_0584956 | Ga0501070_0584956_20_868 | 259 |
| 279 | 3300049592 | Ga0501076_0243392 | Ga0501076_0243392_253_1152 | 259 |
| 280 | 3300049743 | Ga0501081_0135777 | Ga0501081_0135777_80_931 | 259 |
| 281 | 3300050515 | nmdc:mga0a205_462481_c1 | nmdc:mga0a205_462481_c1_11_814 | 259 |
| 282 | 3300005937 | Ga0081455_10170483 | Ga0081455_101704832 | 260 |
| 283 | 3300049568 | Ga0501031_0010930 | Ga0501031_0010930_1233_2132 | 260 |
| 284 | 3300049569 | Ga0501032_0060784 | Ga0501032_0060784_1094_1993 | 260 |
| 285 | 3300049570 | Ga0501033_0072109 | Ga0501033_0072109_958_1857 | 260 |
| 286 | 3300049572 | Ga0501036_0006390 | Ga0501036_0006390_5227_6126 | 260 |
| 287 | 3300049573 | Ga0501037_0024894 | Ga0501037_0024894_701_1600 | 260 |
| 288 | 3300049576 | Ga0501040_0012664 | Ga0501040_0012664_613_1512 | 260 |
| 289 | 3300049577 | Ga0501041_0003076 | Ga0501041_0003076_3634_4533 | 260 |
| 290 | 3300049578 | Ga0501042_0005065 | Ga0501042_0005065_3634_4533 | 260 |
| 291 | 3300049579 | Ga0501043_0013884 | Ga0501043_0013884_357_1256 | 260 |
| 292 | 3300049580 | Ga0501046_0005063 | Ga0501046_0005063_4250_5149 | 260 |
| 293 | 3300049582 | Ga0501048_0009048 | Ga0501048_0009048_3794_4693 | 260 |
| 294 | 3300049584 | Ga0501068_0005241 | Ga0501068_0005241_2039_2938 | 260 |
| 295 | 3300049585 | Ga0501069_0004780 | Ga0501069_0004780_2824_3723 | 260 |
| 296 | 3300049587 | Ga0501071_0010736 | Ga0501071_0010736_2497_3396 | 260 |
| 297 | 3300049588 | Ga0501072_0004260 | Ga0501072_0004260_8344_9243 | 260 |
| 298 | 3300049590 | Ga0501074_0001907 | Ga0501074_0001907_2324_3223 | 260 |
| 299 | 3300049590 | Ga0501074_0118728 | Ga0501074_0118728_392_1291 | 260 |
| 300 | 3300049591 | Ga0501075_0000839 | Ga0501075_0000839_4629_5528 | 260 |
| 301 | 3300049592 | Ga0501076_0007761 | Ga0501076_0007761_4157_5056 | 260 |
| 302 | 3300049593 | Ga0501077_0005112 | Ga0501077_0005112_2731_3630 | 260 |
| 303 | 3300049741 | Ga0501079_0024061 | Ga0501079_0024061_1716_2615 | 260 |
| 304 | 3300049742 | Ga0501080_0004255 | Ga0501080_0004255_9020_9919 | 260 |
| 305 | 3300049743 | Ga0501081_0020550 | Ga0501081_0020550_2196_3095 | 260 |
| 306 | 3300049744 | Ga0501083_0008044 | Ga0501083_0008044_299_1198 | 260 |
| 307 | 3300049822 | Ga0501035_0003674 | Ga0501035_0003674_10829_11728 | 260 |
| 308 | 3300049823 | Ga0501044_0034087 | Ga0501044_0034087_1630_2529 | 260 |
| 309 | 3300049824 | Ga0501045_0045002 | Ga0501045_0045002_2064_2885 | 260 |
| 310 | 3300049824 | Ga0501045_0080369 | Ga0501045_0080369_70_969 | 260 |
| 311 | 3300054114 | Ga0501084_0026313 | Ga0501084_0026313_2789_3688 | 260 |
| 312 | 3300060353 | Ga0501082_0003976 | Ga0501082_0003976_6860_7759 | 260 |
| 313 | 3300061734 | Ga0530510_0066061 | Ga0530510_0066061_129_1028 | 260 |
| 314 | 3300005354 | Ga0070675_100547349 | Ga0070675_1005473491 | 261 |
| 315 | 3300005456 | Ga0070678_100048888 | Ga0070678_1000488882 | 261 |
| 316 | 3300005530 | Ga0070679_100102599 | Ga0070679_1001025993 | 261 |
| 317 | 3300005563 | Ga0068855_100313576 | Ga0068855_1003135762 | 261 |
| 318 | 3300005616 | Ga0068852_100349220 | Ga0068852_1003492202 | 261 |
| 319 | 3300005840 | Ga0068870_10283741 | Ga0068870_102837411 | 261 |
| 320 | 3300006237 | Ga0097621_100303316 | Ga0097621_1003033162 | 261 |
| 321 | 3300006358 | Ga0068871_100128712 | Ga0068871_1001287122 | 261 |
| 322 | 3300009098 | Ga0105245_10055287 | Ga0105245_100552874 | 261 |
| 323 | 3300009176 | Ga0105242_10112371 | Ga0105242_101123712 | 261 |
| 324 | 3300013105 | Ga0157369_10026887 | Ga0157369_100268876 | 261 |
| 325 | 3300014326 | Ga0157380_10141840 | Ga0157380_101418402 | 261 |
| 326 | 3300020081 | Ga0206354_11467900 | Ga0206354_114679002 | 261 |
| 327 | 3300020082 | Ga0206353_10727954 | Ga0206353_107279542 | 261 |
| 328 | 3300025908 | Ga0207643_10005237 | Ga0207643_100052371 | 261 |
| 329 | 3300025921 | Ga0207652_10198354 | Ga0207652_101983542 | 261 |
| 330 | 3300025927 | Ga0207687_10153789 | Ga0207687_101537891 | 261 |
| 331 | 3300025937 | Ga0207669_10127363 | Ga0207669_101273632 | 261 |
| 332 | 3300026121 | Ga0207683_10088034 | Ga0207683_100880342 | 261 |
| 333 | 3300031901 | Ga0307406_10083003 | Ga0307406_100830032 | 261 |
| 334 | 3300032002 | Ga0307416_100085026 | Ga0307416_1000850262 | 261 |
| 335 | 3300044684 | Ga0466966_0137232 | Ga0466966_0137232_297_1196 | 261 |
| 336 | 3300048915 | Ga0496112_0074963 | Ga0496112_0074963_2208_3017 | 261 |
| 337 | 3300005336 | Ga0070680_100485029 | Ga0070680_1004850291 | 262 |
| 338 | 3300005345 | Ga0070692_10089763 | Ga0070692_100897632 | 262 |
| 339 | 3300005440 | Ga0070705_100085756 | Ga0070705_1000857562 | 262 |
| 340 | 3300005441 | Ga0070700_100074944 | Ga0070700_1000749442 | 262 |
| 341 | 3300005445 | Ga0070708_100292466 | Ga0070708_1002924662 | 262 |
| 342 | 3300005459 | Ga0068867_100145225 | Ga0068867_1001452252 | 262 |
| 343 | 3300005544 | Ga0070686_100135624 | Ga0070686_1001356242 | 262 |
| 344 | 3300005545 | Ga0070695_100200930 | Ga0070695_1002009302 | 262 |
| 345 | 3300005563 | Ga0068855_100400343 | Ga0068855_1004003432 | 262 |
| 346 | 3300005578 | Ga0068854_100093844 | Ga0068854_1000938442 | 262 |
| 347 | 3300005615 | Ga0070702_100052589 | Ga0070702_1000525893 | 262 |
| 348 | 3300005843 | Ga0068860_100409574 | Ga0068860_1004095742 | 262 |
| 349 | 3300006881 | Ga0068865_100395602 | Ga0068865_1003956021 | 262 |
| 350 | 3300014497 | Ga0182008_10014699 | Ga0182008_100146995 | 262 |
| 351 | 3300025899 | Ga0207642_10052274 | Ga0207642_100522742 | 262 |
| 352 | 3300025918 | Ga0207662_10087811 | Ga0207662_100878112 | 262 |
| 353 | 3300025933 | Ga0207706_10286040 | Ga0207706_102860402 | 262 |
| 354 | 3300025934 | Ga0207686_10038722 | Ga0207686_100387224 | 262 |
| 355 | 3300025986 | Ga0207658_10263161 | Ga0207658_102631612 | 262 |
| 356 | 3300026075 | Ga0207708_10018361 | Ga0207708_100183615 | 262 |
| 357 | 3300026089 | Ga0207648_10390014 | Ga0207648_103900142 | 262 |
| 358 | 3300026118 | Ga0207675_100114769 | Ga0207675_1001147692 | 262 |
| 359 | 3300037312 | Ga0395899_0204096 | Ga0395899_0204096_290_1192 | 262 |
| 360 | 3300037418 | Ga0395900_0042283 | Ga0395900_0042283_705_1607 | 262 |
| 361 | 3300037466 | Ga0395898_0001605 | Ga0395898_0001605_28259_29161 | 262 |
| 362 | 3300037471 | Ga0395905_0031928 | Ga0395905_0031928_2848_3750 | 262 |
| 363 | 3300038443 | Ga0395901_0000352 | Ga0395901_0000352_23740_24678 | 262 |
| 364 | 3300038443 | Ga0395901_0669183 | Ga0395901_0669183_73_897 | 262 |
| 365 | 3300038996 | Ga0242420_030605 | Ga0242420_030605_32_844 | 262 |
| 366 | 3300044656 | Ga0466969_0065281 | Ga0466969_0065281_329_1231 | 262 |
| 367 | 3300044735 | Ga0466968_0004480 | Ga0466968_0004480_1495_2397 | 262 |
| 368 | 3300045049 | Ga0466959_0012975 | Ga0466959_0012975_398_1300 | 262 |
| 369 | 3300049583 | Ga0501067_0017617 | Ga0501067_0017617_857_1681 | 262 |
| 370 | 3300049584 | Ga0501068_0016442 | Ga0501068_0016442_817_1641 | 262 |
| 371 | 3300049585 | Ga0501069_0042923 | Ga0501069_0042923_549_1373 | 262 |
| 372 | 3300049586 | Ga0501070_0076035 | Ga0501070_0076035_71_895 | 262 |
| 373 | 3300049587 | Ga0501071_0115874 | Ga0501071_0115874_651_1475 | 262 |
| 374 | 3300007076 | Ga0075435_100026229 | Ga0075435_1000262293 | 264 |
| 375 | 3300048917 | Ga0496114_0258841 | Ga0496114_0258841_102_986 | 264 |
| 376 | 3300050515 | nmdc:mga0a205_25675_c1 | nmdc:mga0a205_25675_c1_2991_3878 | 264 |
| 377 | 3300005547 | Ga0070693_100058850 | Ga0070693_1000588502 | 265 |
| 378 | 3300015262 | Ga0182007_10037631 | Ga0182007_100376312 | 265 |
| 379 | 3300025941 | Ga0207711_10151573 | Ga0207711_101515732 | 265 |
| 380 | 3300037312 | Ga0395899_0006132 | Ga0395899_0006132_5606_6463 | 265 |
| 381 | 3300037312 | Ga0395899_0195268 | Ga0395899_0195268_180_1118 | 265 |
| 382 | 3300037418 | Ga0395900_0001348 | Ga0395900_0001348_25963_26820 | 265 |
| 383 | 3300037418 | Ga0395900_0005014 | Ga0395900_0005014_11757_12695 | 265 |
| 384 | 3300037466 | Ga0395898_0000734 | Ga0395898_0000734_24401_25339 | 265 |
| 385 | 3300037466 | Ga0395898_0002159 | Ga0395898_0002159_3987_4844 | 265 |
| 386 | 3300037471 | Ga0395905_0001663 | Ga0395905_0001663_22584_23441 | 265 |
| 387 | 3300038443 | Ga0395901_0000586 | Ga0395901_0000586_18725_19582 | 265 |
| 388 | 3300038443 | Ga0395901_0043859 | Ga0395901_0043859_369_1307 | 265 |
| 389 | 3300048917 | Ga0496114_0357078 | Ga0496114_0357078_274_1095 | 265 |
| 390 | 3300049581 | Ga0501047_0145112 | Ga0501047_0145112_436_1332 | 265 |
| 391 | 3300028800 | Ga0265338_10089148 | Ga0265338_100891483 | 266 |
| 392 | 3300032126 | Ga0307415_100092651 | Ga0307415_1000926512 | 266 |
| 393 | 3300044693 | Ga0466961_0073557 | Ga0466961_0073557_941_1876 | 266 |
| 394 | 3300044694 | Ga0466963_0002247 | Ga0466963_0002247_9045_9980 | 266 |
| 395 | 3300044719 | Ga0466971_0004864 | Ga0466971_0004864_4362_5297 | 266 |
| 396 | 3300044842 | Ga0466957_0025155 | Ga0466957_0025155_964_1899 | 266 |
| 397 | 3300045049 | Ga0466959_0037501 | Ga0466959_0037501_2139_3074 | 266 |
| 398 | 3300045836 | Ga0466958_0004545 | Ga0466958_0004545_614_1549 | 266 |
| 399 | 3300045976 | Ga0466967_0233871 | Ga0466967_0233871_205_1140 | 266 |
| 400 | 3300061719 | Ga0466962_0000434 | Ga0466962_0000434_5171_6106 | 266 |
| 401 | 3300044694 | Ga0466963_0024363 | Ga0466963_0024363_536_1432 | 267 |
| 402 | 3300005339 | Ga0070660_100296138 | Ga0070660_1002961382 | 268 |
| 403 | 3300005341 | Ga0070691_10049650 | Ga0070691_100496501 | 268 |
| 404 | 3300005438 | Ga0070701_10056756 | Ga0070701_100567562 | 268 |
| 405 | 3300005444 | Ga0070694_100258732 | Ga0070694_1002587322 | 268 |
| 406 | 3300005445 | Ga0070708_100026776 | Ga0070708_1000267765 | 268 |
| 407 | 3300005467 | Ga0070706_100059179 | Ga0070706_1000591792 | 268 |
| 408 | 3300005468 | Ga0070707_100164074 | Ga0070707_1001640743 | 268 |
| 409 | 3300005471 | Ga0070698_100016785 | Ga0070698_1000167857 | 268 |
| 410 | 3300005616 | Ga0068852_100135322 | Ga0068852_1001353223 | 268 |
| 411 | 3300025910 | Ga0207684_10244109 | Ga0207684_102441092 | 268 |
| 412 | 3300025922 | Ga0207646_10321003 | Ga0207646_103210032 | 268 |
| 413 | 3300025927 | Ga0207687_10013742 | Ga0207687_100137422 | 268 |
| 414 | 3300045976 | Ga0466967_0006742 | Ga0466967_0006742_1925_2764 | 268 |
| 415 | 3300005983 | Ga0081540_1033790 | Ga0081540_10337902 | 269 |
| 416 | 3300038443 | Ga0395901_0335710 | Ga0395901_0335710_82_978 | 269 |
| 417 | 3300039438 | Ga0436360_1307936 | Ga0436360_1307936_790_1623 | 269 |
| 418 | 3300042005 | Ga0439448_0061849 | Ga0439448_0061849_245_1078 | 269 |
| 419 | 3300013306 | Ga0163162_10538690 | Ga0163162_105386902 | 270 |
| 420 | 3300044694 | Ga0466963_0079629 | Ga0466963_0079629_1030_1929 | 270 |
| 421 | 3300044901 | Ga0466960_0091452 | Ga0466960_0091452_228_1133 | 270 |
| 422 | 3300048904 | Ga0496101_0131749 | Ga0496101_0131749_920_1771 | 270 |
| 423 | 3300048909 | Ga0496106_0159200 | Ga0496106_0159200_790_1641 | 270 |
| 424 | 3300048917 | Ga0496114_0084020 | Ga0496114_0084020_1347_2198 | 270 |
| 425 | 3300050515 | nmdc:mga0a205_33357_c1 | nmdc:mga0a205_33357_c1_980_1831 | 270 |
| 426 | 3300005467 | Ga0070706_100018674 | Ga0070706_1000186742 | 271 |
| 427 | 3300005471 | Ga0070698_100008125 | Ga0070698_1000081259 | 271 |
| 428 | 3300013105 | Ga0157369_10021078 | Ga0157369_100210783 | 271 |
| 429 | 3300025910 | Ga0207684_10027750 | Ga0207684_100277505 | 271 |
| 430 | 3300045049 | Ga0466959_0152642 | Ga0466959_0152642_696_1556 | 271 |
| 431 | 3300048915 | Ga0496112_0045544 | Ga0496112_0045544_414_1262 | 271 |
| 432 | 3300005468 | Ga0070707_100279743 | Ga0070707_1002797432 | 273 |
| 433 | 3300036401 | Ga0373937_0070326 | Ga0373937_0070326_716_1585 | 274 |
| 434 | 3300046454 | Ga0495592_0201287 | Ga0495592_0201287_223_1092 | 274 |
| 435 | 3300046462 | Ga0495651_0087921 | Ga0495651_0087921_178_1047 | 274 |
| 436 | 3300046511 | Ga0495608_0057976 | Ga0495608_0057976_310_1179 | 274 |
| 437 | 3300046516 | Ga0495628_0216905 | Ga0495628_0216905_330_1199 | 274 |
| 438 | 3300046680 | Ga0495646_0196629 | Ga0495646_0196629_134_1003 | 274 |
| 439 | 3300048088 | Ga0495602_0271473 | Ga0495602_0271473_15_884 | 274 |
| 440 | 3300053085 | Ga0495619_0192305 | Ga0495619_0192305_455_1324 | 274 |
| 441 | 3300028577 | Ga0265318_10017257 | Ga0265318_100172573 | 278 |
| 442 | 3300014745 | Ga0157377_10108023 | Ga0157377_101080231 | 279 |
| 443 | 3300061734 | Ga0530510_0205333 | Ga0530510_0205333_41_949 | 279 |
| 444 | 3300005329 | Ga0070683_100063871 | Ga0070683_1000638713 | 280 |
| 445 | 3300005340 | Ga0070689_100221328 | Ga0070689_1002213282 | 280 |
| 446 | 3300005436 | Ga0070713_100160074 | Ga0070713_1001600742 | 280 |
| 447 | 3300005456 | Ga0070678_100038226 | Ga0070678_1000382261 | 280 |
| 448 | 3300005458 | Ga0070681_10077567 | Ga0070681_100775674 | 280 |
| 449 | 3300005530 | Ga0070679_100032107 | Ga0070679_1000321075 | 280 |
| 450 | 3300005535 | Ga0070684_100046442 | Ga0070684_1000464424 | 280 |
| 451 | 3300005546 | Ga0070696_100103960 | Ga0070696_1001039602 | 280 |
| 452 | 3300005719 | Ga0068861_100500156 | Ga0068861_1005001561 | 280 |
| 453 | 3300005937 | Ga0081455_10013491 | Ga0081455_100134914 | 280 |
| 454 | 3300005983 | Ga0081540_1004951 | Ga0081540_10049518 | 280 |
| 455 | 3300006028 | Ga0070717_10179822 | Ga0070717_101798222 | 280 |
| 456 | 3300006058 | Ga0075432_10053097 | Ga0075432_100530972 | 280 |
| 457 | 3300006871 | Ga0075434_100052545 | Ga0075434_1000525455 | 280 |
| 458 | 3300007076 | Ga0075435_100029619 | Ga0075435_1000296193 | 280 |
| 459 | 3300009092 | Ga0105250_10105018 | Ga0105250_101050181 | 280 |
| 460 | 3300009093 | Ga0105240_10109722 | Ga0105240_101097223 | 280 |
| 461 | 3300009094 | Ga0111539_10249453 | Ga0111539_102494532 | 280 |
| 462 | 3300009098 | Ga0105245_10195144 | Ga0105245_101951442 | 280 |
| 463 | 3300009098 | Ga0105245_10304664 | Ga0105245_103046642 | 280 |
| 464 | 3300009148 | Ga0105243_10187462 | Ga0105243_101874622 | 280 |
| 465 | 3300009176 | Ga0105242_10024665 | Ga0105242_100246655 | 280 |
| 466 | 3300009545 | Ga0105237_10278220 | Ga0105237_102782202 | 280 |
| 467 | 3300013102 | Ga0157371_10103642 | Ga0157371_101036423 | 280 |
| 468 | 3300013297 | Ga0157378_10194619 | Ga0157378_101946192 | 280 |
| 469 | 3300013306 | Ga0163162_10344629 | Ga0163162_103446292 | 280 |
| 470 | 3300013306 | Ga0163162_10434426 | Ga0163162_104344261 | 280 |
| 471 | 3300013307 | Ga0157372_10330789 | Ga0157372_103307892 | 280 |
| 472 | 3300013308 | Ga0157375_10120845 | Ga0157375_101208452 | 280 |
| 473 | 3300014325 | Ga0163163_10075938 | Ga0163163_100759382 | 280 |
| 474 | 3300014326 | Ga0157380_10187928 | Ga0157380_101879282 | 280 |
| 475 | 3300014969 | Ga0157376_10352526 | Ga0157376_103525262 | 280 |
| 476 | 3300025909 | Ga0207705_10323093 | Ga0207705_103230932 | 280 |
| 477 | 3300025917 | Ga0207660_10206768 | Ga0207660_102067682 | 280 |
| 478 | 3300025981 | Ga0207640_10237459 | Ga0207640_102374592 | 280 |
| 479 | 3300026095 | Ga0207676_10404409 | Ga0207676_104044092 | 280 |
| 480 | 3300026118 | Ga0207675_100479615 | Ga0207675_1004796152 | 280 |
| 481 | 3300027907 | Ga0207428_10004375 | Ga0207428_100043753 | 280 |
| 482 | 3300031995 | Ga0307409_100038186 | Ga0307409_1000381862 | 280 |
| 483 | 3300032126 | Ga0307415_100015243 | Ga0307415_1000152435 | 280 |
| 484 | 3300034816 | Ga0373930_0014563 | Ga0373930_0014563_220_1098 | 280 |
| 485 | 3300037312 | Ga0395899_0006949 | Ga0395899_0006949_1450_2328 | 280 |
| 486 | 3300037418 | Ga0395900_0002485 | Ga0395900_0002485_16749_17627 | 280 |
| 487 | 3300037466 | Ga0395898_0013840 | Ga0395898_0013840_685_1563 | 280 |
| 488 | 3300037471 | Ga0395905_0039353 | Ga0395905_0039353_804_1682 | 280 |
| 489 | 3300038443 | Ga0395901_0002002 | Ga0395901_0002002_7493_8371 | 280 |
| 490 | 3300042005 | Ga0439448_0023177 | Ga0439448_0023177_560_1438 | 280 |
| 491 | 3300042012 | Ga0439455_0007909 | Ga0439455_0007909_685_1563 | 280 |
| 492 | 3300042016 | Ga0439463_033115 | Ga0439463_033115_146_1024 | 280 |
| 493 | 3300042461 | Ga0439460_0041508 | Ga0439460_0041508_439_1317 | 280 |
| 494 | 3300045051 | Ga0451576_0038419 | Ga0451576_0038419_2461_3339 | 280 |
| 495 | 3300046500 | Ga0495596_0065356 | Ga0495596_0065356_47_925 | 280 |
| 496 | 3300046517 | Ga0495630_0218692 | Ga0495630_0218692_479_1384 | 280 |
| 497 | 3300046535 | Ga0495586_0009293 | Ga0495586_0009293_931_1836 | 280 |
| 498 | 3300046683 | Ga0495658_0103578 | Ga0495658_0103578_249_1154 | 280 |
| 499 | 3300046689 | Ga0495613_0041286 | Ga0495613_0041286_1467_2372 | 280 |
| 500 | 3300048903 | Ga0496100_0010339 | Ga0496100_0010339_3481_4359 | 280 |
| 501 | 3300048904 | Ga0496101_0010660 | Ga0496101_0010660_955_1833 | 280 |
| 502 | 3300048904 | Ga0496101_0096820 | Ga0496101_0096820_775_1653 | 280 |
| 503 | 3300048905 | Ga0496102_0034482 | Ga0496102_0034482_440_1318 | 280 |
| 504 | 3300048906 | Ga0496103_0051469 | Ga0496103_0051469_1326_2204 | 280 |
| 505 | 3300048906 | Ga0496103_0151773 | Ga0496103_0151773_143_1021 | 280 |
| 506 | 3300048907 | Ga0496104_0002196 | Ga0496104_0002196_9601_10479 | 280 |
| 507 | 3300048907 | Ga0496104_0455545 | Ga0496104_0455545_226_1119 | 280 |
| 508 | 3300048908 | Ga0496105_0000283 | Ga0496105_0000283_14104_14982 | 280 |
| 509 | 3300048908 | Ga0496105_0071299 | Ga0496105_0071299_1147_2025 | 280 |
| 510 | 3300048909 | Ga0496106_0039898 | Ga0496106_0039898_2584_3462 | 280 |
| 511 | 3300048910 | Ga0496107_0024060 | Ga0496107_0024060_2971_3849 | 280 |
| 512 | 3300048911 | Ga0496108_0002220 | Ga0496108_0002220_6688_7566 | 280 |
| 513 | 3300048911 | Ga0496108_0027787 | Ga0496108_0027787_358_1236 | 280 |
| 514 | 3300048912 | Ga0496109_0000785 | Ga0496109_0000785_18681_19559 | 280 |
| 515 | 3300048913 | Ga0496110_0000555 | Ga0496110_0000555_8486_9364 | 280 |
| 516 | 3300048913 | Ga0496110_0016852 | Ga0496110_0016852_1514_2392 | 280 |
| 517 | 3300048914 | Ga0496111_0000703 | Ga0496111_0000703_7241_8119 | 280 |
| 518 | 3300048915 | Ga0496112_0000415 | Ga0496112_0000415_5495_6373 | 280 |
| 519 | 3300048915 | Ga0496112_0010167 | Ga0496112_0010167_939_1817 | 280 |
| 520 | 3300048916 | Ga0496113_0000335 | Ga0496113_0000335_19322_20200 | 280 |
| 521 | 3300048916 | Ga0496113_0019335 | Ga0496113_0019335_2889_3767 | 280 |
| 522 | 3300048918 | Ga0496115_0130013 | Ga0496115_0130013_476_1354 | 280 |
| 523 | 3300049586 | Ga0501070_0000336 | Ga0501070_0000336_36996_37895 | 280 |
| 524 | 3300050507 | nmdc:mga05p37_464866_c1 | nmdc:mga05p37_464866_c1_401_1279 | 280 |
| 525 | 3300050507 | nmdc:mga05p37_682426_c1 | nmdc:mga05p37_682426_c1_259_1128 | 280 |
| 526 | 3300050510 | nmdc:mga06r32_84424_c1 | nmdc:mga06r32_84424_c1_1642_2520 | 280 |
| 527 | 3300050512 | nmdc:mga0n895_60071_c1 | nmdc:mga0n895_60071_c1_160_1038 | 280 |
| 528 | 3300050513 | nmdc:mga0rr50_326886_c1 | nmdc:mga0rr50_326886_c1_250_1128 | 280 |
| 529 | 3300050514 | nmdc:mga08x19_91437_c1 | nmdc:mga08x19_91437_c1_1010_1888 | 280 |
| 530 | 3300050515 | nmdc:mga0a205_46692_c1 | nmdc:mga0a205_46692_c1_2079_2957 | 280 |
| 531 | 3300002075 | JGI24738J21930_10012998 | JGI24738J21930_100129982 | 281 |
| 532 | 3300002155 | JGI24033J26618_1006159 | JGI24033J26618_10061591 | 281 |
| 533 | 3300002244 | JGI24742J22300_10026290 | JGI24742J22300_100262901 | 281 |
| 534 | 3300005329 | Ga0070683_100013597 | Ga0070683_1000135973 | 281 |
| 535 | 3300005329 | Ga0070683_100022464 | Ga0070683_1000224643 | 281 |
| 536 | 3300005329 | Ga0070683_100042523 | Ga0070683_1000425234 | 281 |
| 537 | 3300005329 | Ga0070683_100091183 | Ga0070683_1000911833 | 281 |
| 538 | 3300005329 | Ga0070683_100105441 | Ga0070683_1001054412 | 281 |
| 539 | 3300005329 | Ga0070683_100193485 | Ga0070683_1001934852 | 281 |
| 540 | 3300005331 | Ga0070670_100093877 | Ga0070670_1000938772 | 281 |
| 541 | 3300005331 | Ga0070670_100286507 | Ga0070670_1002865072 | 281 |
| 542 | 3300005334 | Ga0068869_100317021 | Ga0068869_1003170212 | 281 |
| 543 | 3300005335 | Ga0070666_10129238 | Ga0070666_101292382 | 281 |
| 544 | 3300005336 | Ga0070680_100038557 | Ga0070680_1000385574 | 281 |
| 545 | 3300005336 | Ga0070680_100071290 | Ga0070680_1000712903 | 281 |
| 546 | 3300005337 | Ga0070682_100052554 | Ga0070682_1000525543 | 281 |
| 547 | 3300005337 | Ga0070682_100065673 | Ga0070682_1000656732 | 281 |
| 548 | 3300005338 | Ga0068868_100099747 | Ga0068868_1000997472 | 281 |
| 549 | 3300005339 | Ga0070660_100008149 | Ga0070660_1000081499 | 281 |
| 550 | 3300005340 | Ga0070689_100017892 | Ga0070689_1000178922 | 281 |
| 551 | 3300005340 | Ga0070689_100334725 | Ga0070689_1003347251 | 281 |
| 552 | 3300005341 | Ga0070691_10099365 | Ga0070691_100993652 | 281 |
| 553 | 3300005345 | Ga0070692_10038289 | Ga0070692_100382892 | 281 |
| 554 | 3300005347 | Ga0070668_100205677 | Ga0070668_1002056772 | 281 |
| 555 | 3300005347 | Ga0070668_100206043 | Ga0070668_1002060432 | 281 |
| 556 | 3300005353 | Ga0070669_100309655 | Ga0070669_1003096552 | 281 |
| 557 | 3300005354 | Ga0070675_100031711 | Ga0070675_1000317115 | 281 |
| 558 | 3300005354 | Ga0070675_100299488 | Ga0070675_1002994882 | 281 |
| 559 | 3300005355 | Ga0070671_100046486 | Ga0070671_1000464862 | 281 |
| 560 | 3300005355 | Ga0070671_100066413 | Ga0070671_1000664132 | 281 |
| 561 | 3300005356 | Ga0070674_100020746 | Ga0070674_1000207464 | 281 |
| 562 | 3300005364 | Ga0070673_100076592 | Ga0070673_1000765922 | 281 |
| 563 | 3300005365 | Ga0070688_100002230 | Ga0070688_1000022305 | 281 |
| 564 | 3300005365 | Ga0070688_100024170 | Ga0070688_1000241703 | 281 |
| 565 | 3300005366 | Ga0070659_100027432 | Ga0070659_1000274324 | 281 |
| 566 | 3300005366 | Ga0070659_100041371 | Ga0070659_1000413712 | 281 |
| 567 | 3300005406 | Ga0070703_10043087 | Ga0070703_100430872 | 281 |
| 568 | 3300005437 | Ga0070710_10006221 | Ga0070710_100062212 | 281 |
| 569 | 3300005438 | Ga0070701_10001690 | Ga0070701_1000169010 | 281 |
| 570 | 3300005438 | Ga0070701_10019121 | Ga0070701_100191213 | 281 |
| 571 | 3300005439 | Ga0070711_100024667 | Ga0070711_1000246672 | 281 |
| 572 | 3300005440 | Ga0070705_100006131 | Ga0070705_1000061312 | 281 |
| 573 | 3300005441 | Ga0070700_100024024 | Ga0070700_1000240243 | 281 |
| 574 | 3300005444 | Ga0070694_100084676 | Ga0070694_1000846762 | 281 |
| 575 | 3300005445 | Ga0070708_100271269 | Ga0070708_1002712692 | 281 |
| 576 | 3300005455 | Ga0070663_100044597 | Ga0070663_1000445972 | 281 |
| 577 | 3300005455 | Ga0070663_100423019 | Ga0070663_1004230191 | 281 |
| 578 | 3300005456 | Ga0070678_100005176 | Ga0070678_1000051763 | 281 |
| 579 | 3300005456 | Ga0070678_100131007 | Ga0070678_1001310072 | 281 |
| 580 | 3300005456 | Ga0070678_100299492 | Ga0070678_1002994921 | 281 |
| 581 | 3300005457 | Ga0070662_100217686 | Ga0070662_1002176862 | 281 |
| 582 | 3300005458 | Ga0070681_10063272 | Ga0070681_100632723 | 281 |
| 583 | 3300005458 | Ga0070681_10187659 | Ga0070681_101876592 | 281 |
| 584 | 3300005459 | Ga0068867_100008996 | Ga0068867_1000089966 | 281 |
| 585 | 3300005466 | Ga0070685_10004928 | Ga0070685_100049283 | 281 |
| 586 | 3300005466 | Ga0070685_10048036 | Ga0070685_100480362 | 281 |
| 587 | 3300005466 | Ga0070685_10164006 | Ga0070685_101640062 | 281 |
| 588 | 3300005530 | Ga0070679_100016335 | Ga0070679_1000163354 | 281 |
| 589 | 3300005530 | Ga0070679_100200684 | Ga0070679_1002006841 | 281 |
| 590 | 3300005535 | Ga0070684_100012640 | Ga0070684_1000126403 | 281 |
| 591 | 3300005535 | Ga0070684_100047123 | Ga0070684_1000471233 | 281 |
| 592 | 3300005535 | Ga0070684_100280420 | Ga0070684_1002804202 | 281 |
| 593 | 3300005535 | Ga0070684_100335151 | Ga0070684_1003351512 | 281 |
| 594 | 3300005539 | Ga0068853_100033528 | Ga0068853_1000335283 | 281 |
| 595 | 3300005539 | Ga0068853_100137441 | Ga0068853_1001374412 | 281 |
| 596 | 3300005543 | Ga0070672_100007417 | Ga0070672_1000074175 | 281 |
| 597 | 3300005543 | Ga0070672_100049726 | Ga0070672_1000497263 | 281 |
| 598 | 3300005544 | Ga0070686_100004397 | Ga0070686_1000043974 | 281 |
| 599 | 3300005544 | Ga0070686_100184335 | Ga0070686_1001843352 | 281 |
| 600 | 3300005545 | Ga0070695_100062788 | Ga0070695_1000627883 | 281 |
| 601 | 3300005545 | Ga0070695_100292790 | Ga0070695_1002927902 | 281 |
| 602 | 3300005546 | Ga0070696_100021632 | Ga0070696_1000216322 | 281 |
| 603 | 3300005546 | Ga0070696_100026616 | Ga0070696_1000266163 | 281 |
| 604 | 3300005547 | Ga0070693_100026230 | Ga0070693_1000262303 | 281 |
| 605 | 3300005547 | Ga0070693_100041337 | Ga0070693_1000413372 | 281 |
| 606 | 3300005547 | Ga0070693_100048036 | Ga0070693_1000480362 | 281 |
| 607 | 3300005548 | Ga0070665_100013838 | Ga0070665_1000138383 | 281 |
| 608 | 3300005548 | Ga0070665_100164820 | Ga0070665_1001648202 | 281 |
| 609 | 3300005549 | Ga0070704_100016783 | Ga0070704_1000167832 | 281 |
| 610 | 3300005549 | Ga0070704_100140215 | Ga0070704_1001402152 | 281 |
| 611 | 3300005563 | Ga0068855_100048007 | Ga0068855_1000480075 | 281 |
| 612 | 3300005563 | Ga0068855_100083606 | Ga0068855_1000836064 | 281 |
| 613 | 3300005563 | Ga0068855_100202442 | Ga0068855_1002024422 | 281 |
| 614 | 3300005564 | Ga0070664_100020852 | Ga0070664_1000208523 | 281 |
| 615 | 3300005564 | Ga0070664_100376370 | Ga0070664_1003763702 | 281 |
| 616 | 3300005564 | Ga0070664_100381033 | Ga0070664_1003810332 | 281 |
| 617 | 3300005614 | Ga0068856_100054765 | Ga0068856_1000547654 | 281 |
| 618 | 3300005615 | Ga0070702_100006703 | Ga0070702_1000067032 | 281 |
| 619 | 3300005616 | Ga0068852_100028872 | Ga0068852_1000288724 | 281 |
| 620 | 3300005616 | Ga0068852_100093451 | Ga0068852_1000934513 | 281 |
| 621 | 3300005617 | Ga0068859_100088640 | Ga0068859_1000886403 | 281 |
| 622 | 3300005617 | Ga0068859_100545656 | Ga0068859_1005456561 | 281 |
| 623 | 3300005618 | Ga0068864_100295216 | Ga0068864_1002952161 | 281 |
| 624 | 3300005718 | Ga0068866_10000945 | Ga0068866_100009453 | 281 |
| 625 | 3300005718 | Ga0068866_10108928 | Ga0068866_101089282 | 281 |
| 626 | 3300005719 | Ga0068861_100007991 | Ga0068861_1000079912 | 281 |
| 627 | 3300005719 | Ga0068861_100015257 | Ga0068861_1000152575 | 281 |
| 628 | 3300005842 | Ga0068858_100377297 | Ga0068858_1003772972 | 281 |
| 629 | 3300005843 | Ga0068860_100069185 | Ga0068860_1000691853 | 281 |
| 630 | 3300005844 | Ga0068862_100266282 | Ga0068862_1002662821 | 281 |
| 631 | 3300005844 | Ga0068862_100277846 | Ga0068862_1002778462 | 281 |
| 632 | 3300005937 | Ga0081455_10022031 | Ga0081455_100220315 | 281 |
| 633 | 3300006058 | Ga0075432_10001637 | Ga0075432_100016373 | 281 |
| 634 | 3300006175 | Ga0070712_100039004 | Ga0070712_1000390042 | 281 |
| 635 | 3300006237 | Ga0097621_100094573 | Ga0097621_1000945732 | 281 |
| 636 | 3300006237 | Ga0097621_100287279 | Ga0097621_1002872792 | 281 |
| 637 | 3300006358 | Ga0068871_100045501 | Ga0068871_1000455012 | 281 |
| 638 | 3300006844 | Ga0075428_100002460 | Ga0075428_1000024606 | 281 |
| 639 | 3300006881 | Ga0068865_100002502 | Ga0068865_1000025027 | 281 |
| 640 | 3300006931 | Ga0097620_100088640 | Ga0097620_1000886402 | 281 |
| 641 | 3300006931 | Ga0097620_100545686 | Ga0097620_1005456862 | 281 |
| 642 | 3300009093 | Ga0105240_10335611 | Ga0105240_103356112 | 281 |
| 643 | 3300009093 | Ga0105240_10536747 | Ga0105240_105367472 | 281 |
| 644 | 3300009094 | Ga0111539_10003095 | Ga0111539_1000309522 | 281 |
| 645 | 3300009094 | Ga0111539_10023166 | Ga0111539_100231668 | 281 |
| 646 | 3300009098 | Ga0105245_10008244 | Ga0105245_100082447 | 281 |
| 647 | 3300009098 | Ga0105245_10014910 | Ga0105245_100149104 | 281 |
| 648 | 3300009098 | Ga0105245_10038377 | Ga0105245_100383772 | 281 |
| 649 | 3300009098 | Ga0105245_10059555 | Ga0105245_100595552 | 281 |
| 650 | 3300009098 | Ga0105245_10769588 | Ga0105245_107695881 | 281 |
| 651 | 3300009101 | Ga0105247_10014762 | Ga0105247_100147622 | 281 |
| 652 | 3300009101 | Ga0105247_10065217 | Ga0105247_100652172 | 281 |
| 653 | 3300009147 | Ga0114129_10006073 | Ga0114129_100060733 | 281 |
| 654 | 3300009148 | Ga0105243_10068382 | Ga0105243_100683822 | 281 |
| 655 | 3300009148 | Ga0105243_10149932 | Ga0105243_101499322 | 281 |
| 656 | 3300009148 | Ga0105243_10286704 | Ga0105243_102867042 | 281 |
| 657 | 3300009174 | Ga0105241_10102020 | Ga0105241_101020202 | 281 |
| 658 | 3300009176 | Ga0105242_10011727 | Ga0105242_100117274 | 281 |
| 659 | 3300009176 | Ga0105242_10278983 | Ga0105242_102789831 | 281 |
| 660 | 3300009177 | Ga0105248_10010628 | Ga0105248_1001062813 | 281 |
| 661 | 3300009177 | Ga0105248_10186137 | Ga0105248_101861372 | 281 |
| 662 | 3300009177 | Ga0105248_10214289 | Ga0105248_102142892 | 281 |
| 663 | 3300009545 | Ga0105237_10238800 | Ga0105237_102388002 | 281 |
| 664 | 3300009551 | Ga0105238_10005763 | Ga0105238_100057632 | 281 |
| 665 | 3300009553 | Ga0105249_10005447 | Ga0105249_100054473 | 281 |
| 666 | 3300009553 | Ga0105249_10045346 | Ga0105249_100453464 | 281 |
| 667 | 3300009553 | Ga0105249_10148466 | Ga0105249_101484662 | 281 |
| 668 | 3300010375 | Ga0105239_10014335 | Ga0105239_100143353 | 281 |
| 669 | 3300010375 | Ga0105239_10205199 | Ga0105239_102051993 | 281 |
| 670 | 3300011119 | Ga0105246_10049280 | Ga0105246_100492803 | 281 |
| 671 | 3300011119 | Ga0105246_10181204 | Ga0105246_101812042 | 281 |
| 672 | 3300012488 | Ga0157343_1000626 | Ga0157343_10006262 | 281 |
| 673 | 3300012515 | Ga0157338_1001164 | Ga0157338_10011641 | 281 |
| 674 | 3300013102 | Ga0157371_10294468 | Ga0157371_102944681 | 281 |
| 675 | 3300013105 | Ga0157369_10044616 | Ga0157369_100446163 | 281 |
| 676 | 3300013296 | Ga0157374_10292555 | Ga0157374_102925552 | 281 |
| 677 | 3300013297 | Ga0157378_10004800 | Ga0157378_100048005 | 281 |
| 678 | 3300013297 | Ga0157378_10321430 | Ga0157378_103214302 | 281 |
| 679 | 3300013306 | Ga0163162_10009912 | Ga0163162_100099123 | 281 |
| 680 | 3300013306 | Ga0163162_10058659 | Ga0163162_100586593 | 281 |
| 681 | 3300013306 | Ga0163162_10154976 | Ga0163162_101549762 | 281 |
| 682 | 3300013307 | Ga0157372_10020936 | Ga0157372_100209363 | 281 |
| 683 | 3300013307 | Ga0157372_10045204 | Ga0157372_100452042 | 281 |
| 684 | 3300013308 | Ga0157375_10068190 | Ga0157375_100681903 | 281 |
| 685 | 3300013308 | Ga0157375_10073531 | Ga0157375_100735314 | 281 |
| 686 | 3300014326 | Ga0157380_10033532 | Ga0157380_100335321 | 281 |
| 687 | 3300014326 | Ga0157380_10258709 | Ga0157380_102587091 | 281 |
| 688 | 3300014326 | Ga0157380_10281553 | Ga0157380_102815532 | 281 |
| 689 | 3300014968 | Ga0157379_10081001 | Ga0157379_100810012 | 281 |
| 690 | 3300014968 | Ga0157379_10132878 | Ga0157379_101328782 | 281 |
| 691 | 3300014969 | Ga0157376_10003894 | Ga0157376_100038945 | 281 |
| 692 | 3300014969 | Ga0157376_10037240 | Ga0157376_100372404 | 281 |
| 693 | 3300017792 | Ga0163161_10031897 | Ga0163161_100318972 | 281 |
| 694 | 3300017792 | Ga0163161_10461712 | Ga0163161_104617121 | 281 |
| 695 | 3300025315 | Ga0207697_10049155 | Ga0207697_100491552 | 281 |
| 696 | 3300025893 | Ga0207682_10042232 | Ga0207682_100422322 | 281 |
| 697 | 3300025898 | Ga0207692_10015358 | Ga0207692_100153584 | 281 |
| 698 | 3300025899 | Ga0207642_10003172 | Ga0207642_100031724 | 281 |
| 699 | 3300025899 | Ga0207642_10121729 | Ga0207642_101217292 | 281 |
| 700 | 3300025900 | Ga0207710_10037637 | Ga0207710_100376372 | 281 |
| 701 | 3300025901 | Ga0207688_10048436 | Ga0207688_100484362 | 281 |
| 702 | 3300025901 | Ga0207688_10252472 | Ga0207688_102524722 | 281 |
| 703 | 3300025903 | Ga0207680_10010499 | Ga0207680_100104992 | 281 |
| 704 | 3300025904 | Ga0207647_10061628 | Ga0207647_100616282 | 281 |
| 705 | 3300025907 | Ga0207645_10018402 | Ga0207645_100184025 | 281 |
| 706 | 3300025908 | Ga0207643_10098383 | Ga0207643_100983832 | 281 |
| 707 | 3300025911 | Ga0207654_10107939 | Ga0207654_101079392 | 281 |
| 708 | 3300025912 | Ga0207707_10088830 | Ga0207707_100888303 | 281 |
| 709 | 3300025914 | Ga0207671_10212620 | Ga0207671_102126202 | 281 |
| 710 | 3300025916 | Ga0207663_10035150 | Ga0207663_100351502 | 281 |
| 711 | 3300025917 | Ga0207660_10032137 | Ga0207660_100321372 | 281 |
| 712 | 3300025919 | Ga0207657_10016444 | Ga0207657_100164443 | 281 |
| 713 | 3300025920 | Ga0207649_10172437 | Ga0207649_101724372 | 281 |
| 714 | 3300025921 | Ga0207652_10172028 | Ga0207652_101720282 | 281 |
| 715 | 3300025921 | Ga0207652_10339799 | Ga0207652_103397992 | 281 |
| 716 | 3300025922 | Ga0207646_10392131 | Ga0207646_103921311 | 281 |
| 717 | 3300025923 | Ga0207681_10369591 | Ga0207681_103695912 | 281 |
| 718 | 3300025926 | Ga0207659_10097825 | Ga0207659_100978252 | 281 |
| 719 | 3300025927 | Ga0207687_10064773 | Ga0207687_100647733 | 281 |
| 720 | 3300025927 | Ga0207687_10093370 | Ga0207687_100933702 | 281 |
| 721 | 3300025927 | Ga0207687_10467578 | Ga0207687_104675781 | 281 |
| 722 | 3300025931 | Ga0207644_10124071 | Ga0207644_101240712 | 281 |
| 723 | 3300025931 | Ga0207644_10363081 | Ga0207644_103630812 | 281 |
| 724 | 3300025932 | Ga0207690_10030289 | Ga0207690_100302892 | 281 |
| 725 | 3300025932 | Ga0207690_10303344 | Ga0207690_103033442 | 281 |
| 726 | 3300025934 | Ga0207686_10017939 | Ga0207686_100179392 | 281 |
| 727 | 3300025935 | Ga0207709_10001613 | Ga0207709_100016136 | 281 |
| 728 | 3300025935 | Ga0207709_10064132 | Ga0207709_100641322 | 281 |
| 729 | 3300025935 | Ga0207709_10250800 | Ga0207709_102508001 | 281 |
| 730 | 3300025936 | Ga0207670_10048290 | Ga0207670_100482903 | 281 |
| 731 | 3300025937 | Ga0207669_10014513 | Ga0207669_100145132 | 281 |
| 732 | 3300025937 | Ga0207669_10033865 | Ga0207669_100338652 | 281 |
| 733 | 3300025938 | Ga0207704_10007273 | Ga0207704_100072732 | 281 |
| 734 | 3300025939 | Ga0207665_10027095 | Ga0207665_100270952 | 281 |
| 735 | 3300025940 | Ga0207691_10014462 | Ga0207691_100144625 | 281 |
| 736 | 3300025941 | Ga0207711_10079577 | Ga0207711_100795772 | 281 |
| 737 | 3300025941 | Ga0207711_10130483 | Ga0207711_101304832 | 281 |
| 738 | 3300025941 | Ga0207711_10236847 | Ga0207711_102368472 | 281 |
| 739 | 3300025942 | Ga0207689_10025253 | Ga0207689_100252533 | 281 |
| 740 | 3300025944 | Ga0207661_10003730 | Ga0207661_100037307 | 281 |
| 741 | 3300025944 | Ga0207661_10298500 | Ga0207661_102985002 | 281 |
| 742 | 3300025949 | Ga0207667_10057030 | Ga0207667_100570302 | 281 |
| 743 | 3300025949 | Ga0207667_10125801 | Ga0207667_101258012 | 281 |
| 744 | 3300025960 | Ga0207651_10185890 | Ga0207651_101858902 | 281 |
| 745 | 3300025961 | Ga0207712_10057529 | Ga0207712_100575293 | 281 |
| 746 | 3300025961 | Ga0207712_10333984 | Ga0207712_103339842 | 281 |
| 747 | 3300025972 | Ga0207668_10019407 | Ga0207668_100194074 | 281 |
| 748 | 3300025972 | Ga0207668_10268999 | Ga0207668_102689992 | 281 |
| 749 | 3300025981 | Ga0207640_10127781 | Ga0207640_101277812 | 281 |
| 750 | 3300026035 | Ga0207703_10457330 | Ga0207703_104573302 | 281 |
| 751 | 3300026067 | Ga0207678_10010413 | Ga0207678_100104137 | 281 |
| 752 | 3300026067 | Ga0207678_10015965 | Ga0207678_100159652 | 281 |
| 753 | 3300026075 | Ga0207708_10005846 | Ga0207708_100058462 | 281 |
| 754 | 3300026078 | Ga0207702_10108008 | Ga0207702_101080082 | 281 |
| 755 | 3300026089 | Ga0207648_10000214 | Ga0207648_1000021457 | 281 |
| 756 | 3300026095 | Ga0207676_10266979 | Ga0207676_102669792 | 281 |
| 757 | 3300026118 | Ga0207675_100003071 | Ga0207675_10000307115 | 281 |
| 758 | 3300026118 | Ga0207675_100012690 | Ga0207675_1000126904 | 281 |
| 759 | 3300026121 | Ga0207683_10039127 | Ga0207683_100391273 | 281 |
| 760 | 3300026121 | Ga0207683_10143973 | Ga0207683_101439731 | 281 |
| 761 | 3300026142 | Ga0207698_10032256 | Ga0207698_100322563 | 281 |
| 762 | 3300026142 | Ga0207698_10033236 | Ga0207698_100332364 | 281 |
| 763 | 3300027907 | Ga0207428_10000108 | Ga0207428_10000108113 | 281 |
| 764 | 3300027907 | Ga0207428_10026324 | Ga0207428_100263242 | 281 |
| 765 | 3300028379 | Ga0268266_10289439 | Ga0268266_102894392 | 281 |
| 766 | 3300028380 | Ga0268265_10217053 | Ga0268265_102170532 | 281 |
| 767 | 3300028381 | Ga0268264_10068857 | Ga0268264_100688572 | 281 |
| 768 | 3300028381 | Ga0268264_10191505 | Ga0268264_101915052 | 281 |
| 769 | 3300031995 | Ga0307409_100342001 | Ga0307409_1003420011 | 281 |
| 770 | 3300032002 | Ga0307416_100024078 | Ga0307416_1000240784 | 281 |
| 771 | 3300032126 | Ga0307415_100013991 | Ga0307415_1000139915 | 281 |
| 772 | 3300035092 | Ga0373952_0015967 | Ga0373952_0015967_73_942 | 281 |
| 773 | 3300035114 | Ga0373939_0016486 | Ga0373939_0016486_646_1515 | 281 |
| 774 | 3300035207 | Ga0373942_0043368 | Ga0373942_0043368_24_893 | 281 |
| 775 | 3300035241 | Ga0373961_0021072 | Ga0373961_0021072_750_1619 | 281 |
| 776 | 3300035242 | Ga0373962_0021485 | Ga0373962_0021485_530_1399 | 281 |
| 777 | 3300037312 | Ga0395899_0042994 | Ga0395899_0042994_1025_1906 | 281 |
| 778 | 3300037418 | Ga0395900_0054097 | Ga0395900_0054097_2237_3118 | 281 |
| 779 | 3300037466 | Ga0395898_0103317 | Ga0395898_0103317_1026_1907 | 281 |
| 780 | 3300037466 | Ga0395898_0119162 | Ga0395898_0119162_566_1447 | 281 |
| 781 | 3300037466 | Ga0395898_0450519 | Ga0395898_0450519_181_1062 | 281 |
| 782 | 3300037471 | Ga0395905_0085783 | Ga0395905_0085783_1586_2467 | 281 |
| 783 | 3300038443 | Ga0395901_0044840 | Ga0395901_0044840_1936_2817 | 281 |
| 784 | 3300038443 | Ga0395901_0085829 | Ga0395901_0085829_109_990 | 281 |
| 785 | 3300042122 | Ga0450920_000491 | Ga0450920_000491_1671_2540 | 281 |
| 786 | 3300046491 | Ga0495584_0027885 | Ga0495584_0027885_1399_2280 | 281 |
| 787 | 3300046492 | Ga0495585_0128157 | Ga0495585_0128157_349_1230 | 281 |
| 788 | 3300046500 | Ga0495596_0072612 | Ga0495596_0072612_314_1195 | 281 |
| 789 | 3300046518 | Ga0495631_0034955 | Ga0495631_0034955_1080_1949 | 281 |
| 790 | 3300046525 | Ga0495663_0016516 | Ga0495663_0016516_386_1267 | 281 |
| 791 | 3300046531 | Ga0495665_0056235 | Ga0495665_0056235_1169_2050 | 281 |
| 792 | 3300046538 | Ga0495609_0091798 | Ga0495609_0091798_245_1126 | 281 |
| 793 | 3300046616 | Ga0495668_0144101 | Ga0495668_0144101_82_963 | 281 |
| 794 | 3300046648 | Ga0495611_0125745 | Ga0495611_0125745_210_1091 | 281 |
| 795 | 3300046674 | Ga0495588_0041439 | Ga0495588_0041439_1402_2283 | 281 |
| 796 | 3300046684 | Ga0495669_0123716 | Ga0495669_0123716_319_1188 | 281 |
| 797 | 3300046689 | Ga0495613_0193661 | Ga0495613_0193661_413_1294 | 281 |
| 798 | 3300046691 | Ga0495670_0116129 | Ga0495670_0116129_315_1184 | 281 |
| 799 | 3300046794 | Ga0495589_0078952 | Ga0495589_0078952_273_1142 | 281 |
| 800 | 3300046810 | Ga0495660_0172388 | Ga0495660_0172388_16_885 | 281 |
| 801 | 3300047315 | Ga0495581_0008654 | Ga0495581_0008654_2408_3289 | 281 |
| 802 | 3300047445 | Ga0495677_0022339 | Ga0495677_0022339_1026_1907 | 281 |
| 803 | 3300048903 | Ga0496100_0058927 | Ga0496100_0058927_792_1673 | 281 |
| 804 | 3300048903 | Ga0496100_0165704 | Ga0496100_0165704_552_1421 | 281 |
| 805 | 3300048904 | Ga0496101_0046958 | Ga0496101_0046958_1240_2121 | 281 |
| 806 | 3300048904 | Ga0496101_0074055 | Ga0496101_0074055_101_970 | 281 |
| 807 | 3300048906 | Ga0496103_0001117 | Ga0496103_0001117_9657_10538 | 281 |
| 808 | 3300048906 | Ga0496103_0172792 | Ga0496103_0172792_395_1264 | 281 |
| 809 | 3300048907 | Ga0496104_0096621 | Ga0496104_0096621_1556_2425 | 281 |
| 810 | 3300048908 | Ga0496105_0113308 | Ga0496105_0113308_419_1288 | 281 |
| 811 | 3300048908 | Ga0496105_0149011 | Ga0496105_0149011_1016_1885 | 281 |
| 812 | 3300048909 | Ga0496106_0007876 | Ga0496106_0007876_3494_4375 | 281 |
| 813 | 3300048910 | Ga0496107_0004691 | Ga0496107_0004691_1478_2359 | 281 |
| 814 | 3300048911 | Ga0496108_0017228 | Ga0496108_0017228_3857_4726 | 281 |
| 815 | 3300048911 | Ga0496108_0042580 | Ga0496108_0042580_1772_2641 | 281 |
| 816 | 3300048911 | Ga0496108_0065142 | Ga0496108_0065142_1868_2746 | 281 |
| 817 | 3300048911 | Ga0496108_0316451 | Ga0496108_0316451_39_908 | 281 |
| 818 | 3300048912 | Ga0496109_0008936 | Ga0496109_0008936_3607_4485 | 281 |
| 819 | 3300048912 | Ga0496109_0015494 | Ga0496109_0015494_1055_1924 | 281 |
| 820 | 3300048912 | Ga0496109_0047598 | Ga0496109_0047598_907_1776 | 281 |
| 821 | 3300048912 | Ga0496109_0224547 | Ga0496109_0224547_341_1210 | 281 |
| 822 | 3300048913 | Ga0496110_0002271 | Ga0496110_0002271_3249_4127 | 281 |
| 823 | 3300048913 | Ga0496110_0024600 | Ga0496110_0024600_1263_2132 | 281 |
| 824 | 3300048914 | Ga0496111_0004301 | Ga0496111_0004301_5087_5965 | 281 |
| 825 | 3300048914 | Ga0496111_0008368 | Ga0496111_0008368_675_1544 | 281 |
| 826 | 3300048915 | Ga0496112_0111162 | Ga0496112_0111162_620_1498 | 281 |
| 827 | 3300048915 | Ga0496112_0148667 | Ga0496112_0148667_1332_2201 | 281 |
| 828 | 3300048916 | Ga0496113_0012986 | Ga0496113_0012986_1330_2199 | 281 |
| 829 | 3300048916 | Ga0496113_0420546 | Ga0496113_0420546_192_1061 | 281 |
| 830 | 3300048917 | Ga0496114_0001492 | Ga0496114_0001492_3019_3900 | 281 |
| 831 | 3300048917 | Ga0496114_0267204 | Ga0496114_0267204_45_914 | 281 |
| 832 | 3300048918 | Ga0496115_0020149 | Ga0496115_0020149_2513_3394 | 281 |
| 833 | 3300049572 | Ga0501036_0113383 | Ga0501036_0113383_598_1467 | 281 |
| 834 | 3300049574 | Ga0501038_0072433 | Ga0501038_0072433_1274_2143 | 281 |
| 835 | 3300049575 | Ga0501039_0027456 | Ga0501039_0027456_2371_3240 | 281 |
| 836 | 3300049577 | Ga0501041_0041960 | Ga0501041_0041960_1071_1940 | 281 |
| 837 | 3300049578 | Ga0501042_0010629 | Ga0501042_0010629_1613_2482 | 281 |
| 838 | 3300049580 | Ga0501046_0051136 | Ga0501046_0051136_1583_2452 | 281 |
| 839 | 3300049584 | Ga0501068_0127412 | Ga0501068_0127412_63_932 | 281 |
| 840 | 3300049586 | Ga0501070_0117029 | Ga0501070_0117029_804_1673 | 281 |
| 841 | 3300049587 | Ga0501071_0000851 | Ga0501071_0000851_804_1673 | 281 |
| 842 | 3300049588 | Ga0501072_0007485 | Ga0501072_0007485_5774_6643 | 281 |
| 843 | 3300049591 | Ga0501075_0044049 | Ga0501075_0044049_1362_2231 | 281 |
| 844 | 3300049592 | Ga0501076_0000358 | Ga0501076_0000358_26170_27039 | 281 |
| 845 | 3300049593 | Ga0501077_0018701 | Ga0501077_0018701_2155_3024 | 281 |
| 846 | 3300049742 | Ga0501080_0032874 | Ga0501080_0032874_2637_3506 | 281 |
| 847 | 3300049743 | Ga0501081_0006931 | Ga0501081_0006931_1756_2625 | 281 |
| 848 | 3300049744 | Ga0501083_0011606 | Ga0501083_0011606_4391_5260 | 281 |
| 849 | 3300049822 | Ga0501035_0207517 | Ga0501035_0207517_157_1026 | 281 |
| 850 | 3300050507 | nmdc:mga05p37_10918_c1 | nmdc:mga05p37_10918_c1_3413_4282 | 281 |
| 851 | 3300050508 | nmdc:mga09592_4343_c1 | nmdc:mga09592_4343_c1_5731_6600 | 281 |
| 852 | 3300050511 | nmdc:mga08y16_13085_c1 | nmdc:mga08y16_13085_c1_6797_7666 | 281 |
| 853 | 3300050511 | nmdc:mga08y16_7593_c1 | nmdc:mga08y16_7593_c1_6194_7063 | 281 |
| 854 | 3300050512 | nmdc:mga0n895_602480_c1 | nmdc:mga0n895_602480_c1_55_924 | 281 |
| 855 | 3300050515 | nmdc:mga0a205_16103_c2 | nmdc:mga0a205_16103_c2_4069_4938 | 281 |
| 856 | 3300054114 | Ga0501084_0000537 | Ga0501084_0000537_1373_2242 | 281 |
| 857 | 3300060353 | Ga0501082_0034450 | Ga0501082_0034450_2061_2930 | 281 |
| 858 | 3300061734 | Ga0530510_0017961 | Ga0530510_0017961_1390_2259 | 281 |
| 859 | 3300061734 | Ga0530510_0053577 | Ga0530510_0053577_1121_1990 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
114
300
0.84
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.867 | 81 | 269 |
| 7ahh-assembly1.cif.gz_A | opua inhibited inward-facing, sbd docked | 0.8651 | 81 | 270 |
| 7ahd-assembly1.cif.gz_B | opua (e190q) occluded | 0.8114 | 80 | 269 |
| 3dhw-assembly2.cif.gz_F | crystal structure of methionine importer metni | 0.7798 | 73 | 264 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7778 | 70 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVG9_10_202_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8955 | 74 | 270 | 1.10.3720.10 |
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8934 | 74 | 270 | 1.10.3720.10 |
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8812 | 75 | 269 | 1.10.3720.10 |
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8769 | 74 | 275 | 1.10.3720.10 |
| af_Q2FVG9_10_202_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.874 | 74 | 270 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8VV98-F1-model_v4 | ABC transporter permease | 0.946 | 12 | 274 |
GO:0005886
GO:0055085 |
| AF-A0A7V8BXH3-F1-model_v4 | ABC transporter permease | 0.9384 | 15 | 279 |
GO:0005886
GO:0055085 |
| AF-A0A7M2YVS5-F1-model_v4 | ABC-type nitrate/sulfonate/bicarbonate transport system permease component | 0.9336 | 15 | 281 |
GO:0005886
GO:0055085 |
| AF-A0A2V7I453-F1-model_v4 | ABC transporter permease | 0.933 | 29 | 277 |
GO:0005886
GO:0055085 |
| AF-A0A2V7E7I1-F1-model_v4 | ABC transporter permease | 0.9303 | 49 | 272 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar