F483774

General Info

Members Datasets Scaffolds Average Seq Length
859 344 859 278

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10037631|Ga0182007_100376312
Length 304
Sequence VRDGSSGIRADPIRGFQRDKNWAVANAAVAAPLPRRPAGRVALVLAVVVVLLGLWELYRWVWTSAXXXWPFLVNDTSMPHIWTIAKAFGEPAQVNQPALITVLLHKTLFTAKEAAAGFGIGALVHSRLLQRGFLPYIVGSQTVPILAIAPMVVVWVNPKLPGPFQGWGAVAVIAAYLTFFPVAINTLRGLQSADPRALELMRTYAASRWSVLWKLRVPTSLPFVFSALRLAATASVVGAIIGELPSGLQDGLGGAIINFNQYYSIEPQELWATNVIAALLGIAFFVIVVLAERIVVRRAPENVA

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
101 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
208 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
224 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
225 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
226 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
227 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
233 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
234 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
264 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
265 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
266 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
318 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
321 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
322 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
339 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
344 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.38
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10012998 3300002075 Bacteria 1809
2 JGI24749J21850_1005718 3300002076 Bacteria 1736
3 JGI24033J26618_1006159 3300002155 Bacteria 1340
4 JGI24742J22300_10026290 3300002244 Bacteria 1007
5 rootH1_10298486 3300003323 Bacteria 1329
6 Ga0070683_100013597 3300005329 Bacteria 7102
7 Ga0070683_100022464 3300005329 Bacteria 5639
8 Ga0070683_100036210 3300005329 Bacteria 4515
9 Ga0070683_100042523 3300005329 Bacteria 4184
10 Ga0070683_100056634 3300005329 Bacteria 3640
11 Ga0070683_100063871 3300005329 Bacteria 3426
12 Ga0070683_100091183 3300005329 Bacteria 2862
13 Ga0070683_100105441 3300005329 Bacteria 2657
14 Ga0070683_100171743 3300005329 Bacteria 2058
15 Ga0070683_100193485 3300005329 Bacteria 1931
16 Ga0070683_100205643 3300005329 Bacteria 1870
17 Ga0070670_100002873 3300005331 Bacteria 14260
18 Ga0070670_100093877 3300005331 Bacteria 2580
19 Ga0070670_100148623 3300005331 Bacteria 2027
20 Ga0070670_100286507 3300005331 Bacteria 1439
21 Ga0068869_100020150 3300005334 Bacteria 4568
22 Ga0068869_100317021 3300005334 Bacteria 1263
23 Ga0070666_10129238 3300005335 Bacteria 1755
24 Ga0070680_100003799 3300005336 Bacteria 11293
25 Ga0070680_100038557 3300005336 Bacteria 3864
26 Ga0070680_100071290 3300005336 Bacteria 2855
27 Ga0070680_100340706 3300005336 Bacteria 1274
28 Ga0070680_100344442 3300005336 Bacteria 1267
29 Ga0070680_100485029 3300005336 Bacteria 1057
30 Ga0070682_100052554 3300005337 Bacteria 2550
31 Ga0070682_100065673 3300005337 Bacteria 2306
32 Ga0070682_100081973 3300005337 Bacteria 2090
33 Ga0068868_100043982 3300005338 Bacteria 3490
34 Ga0068868_100099747 3300005338 Bacteria 2350
35 Ga0070660_100008149 3300005339 Bacteria 7322
36 Ga0070660_100296138 3300005339 Bacteria 1326
37 Ga0070689_100017892 3300005340 Bacteria 5210
38 Ga0070689_100023937 3300005340 Bacteria 4578
39 Ga0070689_100221328 3300005340 Bacteria 1553
40 Ga0070689_100334725 3300005340 Bacteria 1267
41 Ga0070691_10039543 3300005341 Bacteria 2229
42 Ga0070691_10049650 3300005341 Bacteria 1999
43 Ga0070691_10099365 3300005341 Bacteria 1443
44 Ga0070687_100112684 3300005343 Bacteria 1542
45 Ga0070692_10038289 3300005345 Bacteria 2443
46 Ga0070692_10089763 3300005345 Bacteria 1669
47 Ga0070692_10124424 3300005345 Bacteria 1442
48 Ga0070668_100205677 3300005347 Bacteria 1617
49 Ga0070668_100206043 3300005347 Bacteria 1616
50 Ga0070669_100309655 3300005353 Bacteria 1272
51 Ga0070675_100031711 3300005354 Bacteria 4274
52 Ga0070675_100085638 3300005354 Bacteria 2633
53 Ga0070675_100299488 3300005354 Unclassified 1416
54 Ga0070675_100547349 3300005354 Bacteria 1046
55 Ga0070671_100045043 3300005355 Bacteria 3667
56 Ga0070671_100046486 3300005355 Bacteria 3610
57 Ga0070671_100066413 3300005355 Bacteria 3006
58 Ga0070674_100020746 3300005356 Bacteria 4206
59 Ga0070674_100075189 3300005356 Bacteria 2398
60 Ga0070673_100018908 3300005364 Bacteria 4937
61 Ga0070673_100076592 3300005364 Bacteria 2701
62 Ga0070688_100002230 3300005365 Bacteria 9781
63 Ga0070688_100024170 3300005365 Bacteria 3581
64 Ga0070659_100027432 3300005366 Bacteria 4388
65 Ga0070659_100041371 3300005366 Bacteria 3602
66 Ga0070659_100070384 3300005366 Bacteria 2779
67 Ga0070659_100393505 3300005366 Bacteria 1169
68 Ga0070703_10043087 3300005406 Bacteria 1414
69 Ga0070709_10205326 3300005434 Bacteria 1398
70 Ga0070714_100019569 3300005435 Bacteria 5518
71 Ga0070714_100157277 3300005435 Bacteria 2053
72 Ga0070713_100160074 3300005436 Bacteria 2009
73 Ga0070713_100420627 3300005436 Bacteria 1251
74 Ga0070713_100495393 3300005436 Bacteria 1152
75 Ga0070710_10006221 3300005437 Bacteria 5716
76 Ga0070701_10001690 3300005438 Bacteria 8284
77 Ga0070701_10019121 3300005438 Bacteria 3232
78 Ga0070701_10056756 3300005438 Bacteria 2050
79 Ga0070711_100024667 3300005439 Bacteria 3926
80 Ga0070711_100423813 3300005439 Bacteria 1085
81 Ga0070705_100006131 3300005440 Bacteria 5887
82 Ga0070705_100044043 3300005440 Bacteria 2562
83 Ga0070705_100085756 3300005440 Bacteria 1947
84 Ga0070705_100160132 3300005440 Bacteria 1503
85 Ga0070700_100001364 3300005441 Bacteria 12137
86 Ga0070700_100024024 3300005441 Bacteria 3573
87 Ga0070700_100074944 3300005441 Bacteria 2169
88 Ga0070694_100032102 3300005444 Bacteria 3447
89 Ga0070694_100084676 3300005444 Bacteria 2212
90 Ga0070694_100250391 3300005444 Bacteria 1340
91 Ga0070694_100258732 3300005444 Bacteria 1319
92 Ga0070708_100026776 3300005445 Bacteria 4939
93 Ga0070708_100271269 3300005445 Bacteria 1596
94 Ga0070708_100292466 3300005445 Bacteria 1534
95 Ga0070663_100044597 3300005455 Bacteria 3127
96 Ga0070663_100152860 3300005455 Bacteria 1771
97 Ga0070663_100423019 3300005455 Bacteria 1093
98 Ga0070678_100005176 3300005456 Bacteria 7499
99 Ga0070678_100006943 3300005456 Bacteria 6681
100 Ga0070678_100038226 3300005456 Bacteria 3377
101 Ga0070678_100048888 3300005456 Bacteria 3049
102 Ga0070678_100131007 3300005456 Bacteria 1992
103 Ga0070678_100206742 3300005456 Bacteria 1624
104 Ga0070678_100299492 3300005456 Bacteria 1366
105 Ga0070662_100217686 3300005457 Bacteria 1522
106 Ga0070681_10009610 3300005458 Bacteria 9509
107 Ga0070681_10063272 3300005458 Bacteria 3672
108 Ga0070681_10077567 3300005458 Bacteria 3280
109 Ga0070681_10146508 3300005458 Bacteria 2290
110 Ga0070681_10178703 3300005458 Bacteria 2044
111 Ga0070681_10187659 3300005458 Bacteria 1987
112 Ga0070681_10242256 3300005458 Bacteria 1717
113 Ga0068867_100008996 3300005459 Bacteria 7046
114 Ga0068867_100103678 3300005459 Bacteria 2176
115 Ga0068867_100145225 3300005459 Bacteria 1858
116 Ga0070685_10004735 3300005466 Bacteria 6887
117 Ga0070685_10004928 3300005466 Bacteria 6754
118 Ga0070685_10048036 3300005466 Bacteria 2456
119 Ga0070685_10164006 3300005466 Bacteria 1419
120 Ga0070706_100018674 3300005467 Bacteria 6394
121 Ga0070706_100059179 3300005467 Bacteria 3536
122 Ga0070707_100164074 3300005468 Bacteria 2165
123 Ga0070707_100279743 3300005468 Bacteria 1622
124 Ga0070698_100008125 3300005471 Bacteria 11341
125 Ga0070698_100016785 3300005471 Bacteria 7723
126 Ga0070699_100006802 3300005518 Bacteria 9949
127 Ga0070699_100298523 3300005518 Bacteria 1445
128 Ga0070679_100009682 3300005530 Bacteria 9114
129 Ga0070679_100016335 3300005530 Bacteria 7156
130 Ga0070679_100032107 3300005530 Bacteria 5192
131 Ga0070679_100102599 3300005530 Bacteria 2847
132 Ga0070679_100200684 3300005530 Bacteria 1961
133 Ga0070679_100227082 3300005530 Bacteria 1827
134 Ga0070684_100006235 3300005535 Bacteria 9203
135 Ga0070684_100012640 3300005535 Bacteria 6771
136 Ga0070684_100046442 3300005535 Bacteria 3763
137 Ga0070684_100047123 3300005535 Bacteria 3735
138 Ga0070684_100050130 3300005535 Bacteria 3625
139 Ga0070684_100280420 3300005535 Bacteria 1527
140 Ga0070684_100335151 3300005535 Bacteria 1390
141 Ga0070684_100378390 3300005535 Bacteria 1304
142 Ga0068853_100033528 3300005539 Bacteria 4358
143 Ga0068853_100137441 3300005539 Bacteria 2191
144 Ga0068853_100204900 3300005539 Bacteria 1796
145 Ga0070672_100007417 3300005543 Bacteria 7435
146 Ga0070672_100049726 3300005543 Bacteria 3263
147 Ga0070686_100004397 3300005544 Bacteria 7773
148 Ga0070686_100031350 3300005544 Bacteria 3249
149 Ga0070686_100135624 3300005544 Bacteria 1707
150 Ga0070686_100184335 3300005544 Bacteria 1485
151 Ga0070695_100001212 3300005545 Bacteria 14186
152 Ga0070695_100062788 3300005545 Bacteria 2413
153 Ga0070695_100200930 3300005545 Bacteria 1424
154 Ga0070695_100292790 3300005545 Bacteria 1201
155 Ga0070696_100021632 3300005546 Bacteria 4362
156 Ga0070696_100026616 3300005546 Bacteria 3934
157 Ga0070696_100103960 3300005546 Bacteria 2039
158 Ga0070693_100026230 3300005547 Bacteria 3145
159 Ga0070693_100041337 3300005547 Bacteria 2593
160 Ga0070693_100048036 3300005547 Bacteria 2430
161 Ga0070693_100058850 3300005547 Bacteria 2226
162 Ga0070693_100210886 3300005547 Bacteria 1267
163 Ga0070665_100013694 3300005548 Bacteria 8160
164 Ga0070665_100013838 3300005548 Bacteria 8114
165 Ga0070665_100164820 3300005548 Bacteria 2218
166 Ga0070704_100016783 3300005549 Bacteria 4637
167 Ga0070704_100140215 3300005549 Bacteria 1886
168 Ga0068855_100012204 3300005563 Bacteria 10385
169 Ga0068855_100031221 3300005563 Bacteria 6362
170 Ga0068855_100048007 3300005563 Bacteria 5040
171 Ga0068855_100083606 3300005563 Bacteria 3697
172 Ga0068855_100202442 3300005563 Bacteria 2234
173 Ga0068855_100264543 3300005563 Bacteria 1915
174 Ga0068855_100313576 3300005563 Bacteria 1735
175 Ga0068855_100400343 3300005563 Bacteria 1504
176 Ga0070664_100020852 3300005564 Bacteria 5399
177 Ga0070664_100376370 3300005564 Bacteria 1295
178 Ga0070664_100381033 3300005564 Bacteria 1287
179 Ga0068854_100093844 3300005578 Bacteria 2237
180 Ga0068854_100241908 3300005578 Bacteria 1437
181 Ga0068856_100054765 3300005614 Bacteria 3936
182 Ga0070702_100006703 3300005615 Bacteria 5471
183 Ga0070702_100040736 3300005615 Bacteria 2601
184 Ga0070702_100052589 3300005615 Bacteria 2336
185 Ga0070702_100250049 3300005615 Bacteria 1201
186 Ga0068852_100028872 3300005616 Bacteria 4546
187 Ga0068852_100093451 3300005616 Bacteria 2696
188 Ga0068852_100135322 3300005616 Bacteria 2275
189 Ga0068852_100349220 3300005616 Bacteria 1444
190 Ga0068859_100088640 3300005617 Bacteria 3143
191 Ga0068859_100545656 3300005617 Bacteria 1254
192 Ga0068864_100010046 3300005618 Bacteria 7815
193 Ga0068864_100295216 3300005618 Bacteria 1516
194 Ga0068866_10000945 3300005718 Bacteria 12771
195 Ga0068866_10108928 3300005718 Bacteria 1542
196 Ga0068861_100007991 3300005719 Bacteria 7280
197 Ga0068861_100015257 3300005719 Bacteria 5410
198 Ga0068861_100500156 3300005719 Bacteria 1099
199 Ga0068861_100557003 3300005719 Unclassified 1046
200 Ga0068870_10005803 3300005840 Bacteria 5415
201 Ga0068870_10283741 3300005840 Bacteria 1039
202 Ga0068858_100377297 3300005842 Bacteria 1360
203 Ga0068860_100069185 3300005843 Bacteria 3355
204 Ga0068860_100409574 3300005843 Bacteria 1342
205 Ga0068862_100266282 3300005844 Bacteria 1566
206 Ga0068862_100277846 3300005844 Bacteria 1534
207 Ga0081455_10013165 3300005937 Bacteria 8196
208 Ga0081455_10013491 3300005937 Bacteria 8067
209 Ga0081455_10022031 3300005937 Bacteria 5965
210 Ga0081455_10066747 3300005937 Bacteria 3002
211 Ga0081455_10170483 3300005937 Bacteria 1658
212 Ga0081538_10004835 3300005981 Bacteria 12280
213 Ga0081538_10031354 3300005981 Bacteria 3587
214 Ga0081538_10092110 3300005981 Bacteria 1562
215 Ga0081540_1004951 3300005983 Bacteria 10015
216 Ga0081540_1033790 3300005983 Bacteria 2770
217 Ga0081539_10000620 3300005985 Bacteria 71882
218 Ga0070717_10080163 3300006028 Bacteria 2738
219 Ga0070717_10179822 3300006028 Bacteria 1843
220 Ga0070717_10611452 3300006028 Bacteria 989
221 Ga0075432_10001637 3300006058 Bacteria 7367
222 Ga0075432_10053097 3300006058 Bacteria 1432
223 Ga0070712_100039004 3300006175 Bacteria 3248
224 Ga0097621_100094573 3300006237 Bacteria 2505
225 Ga0097621_100287279 3300006237 Bacteria 1449
226 Ga0097621_100303316 3300006237 Bacteria 1411
227 Ga0068871_100045501 3300006358 Bacteria 3532
228 Ga0068871_100128712 3300006358 Bacteria 2145
229 Ga0075428_100002460 3300006844 Bacteria 20102
230 Ga0075428_100070676 3300006844 Bacteria 3816
231 Ga0075434_100052545 3300006871 Bacteria 4049
232 Ga0068865_100002502 3300006881 Bacteria 10876
233 Ga0068865_100021473 3300006881 Bacteria 4198
234 Ga0068865_100395602 3300006881 Bacteria 1130
235 Ga0097620_100088640 3300006931 Bacteria 3143
236 Ga0097620_100545686 3300006931 Bacteria 1254
237 Ga0075435_100026229 3300007076 Bacteria 4544
238 Ga0075435_100029619 3300007076 Bacteria 4297
239 Ga0075435_100188293 3300007076 Bacteria 1746
240 Ga0105250_10105018 3300009092 Bacteria 1154
241 Ga0105240_10009160 3300009093 Bacteria 14044
242 Ga0105240_10109722 3300009093 Bacteria 3341
243 Ga0105240_10306751 3300009093 Bacteria 1814
244 Ga0105240_10335611 3300009093 Bacteria 1718
245 Ga0105240_10536747 3300009093 Unclassified 1296
246 Ga0111539_10003095 3300009094 Bacteria 22053
247 Ga0111539_10023166 3300009094 Bacteria 7626
248 Ga0111539_10174445 3300009094 Bacteria 2511
249 Ga0111539_10249453 3300009094 Bacteria 2067
250 Ga0105245_10008244 3300009098 Bacteria 9106
251 Ga0105245_10014910 3300009098 Bacteria 6770
252 Ga0105245_10038377 3300009098 Bacteria 4261
253 Ga0105245_10055287 3300009098 Bacteria 3565
254 Ga0105245_10059555 3300009098 Bacteria 3439
255 Ga0105245_10080204 3300009098 Bacteria 2981
256 Ga0105245_10195144 3300009098 Bacteria 1942
257 Ga0105245_10304664 3300009098 Bacteria 1564
258 Ga0105245_10769588 3300009098 Bacteria 999
259 Ga0105247_10014762 3300009101 Bacteria 4683
260 Ga0105247_10065217 3300009101 Bacteria 2265
261 Ga0114129_10006073 3300009147 Bacteria 17120
262 Ga0114129_10179983 3300009147 Bacteria 2877
263 Ga0105243_10038804 3300009148 Bacteria 3710
264 Ga0105243_10068382 3300009148 Bacteria 2863
265 Ga0105243_10149932 3300009148 Bacteria 1999
266 Ga0105243_10187462 3300009148 Bacteria 1804
267 Ga0105243_10286704 3300009148 Bacteria 1486
268 Ga0105243_10707706 3300009148 Bacteria 983
269 Ga0105241_10102020 3300009174 Bacteria 2282
270 Ga0105242_10011727 3300009176 Bacteria 6744
271 Ga0105242_10024665 3300009176 Bacteria 4751
272 Ga0105242_10047304 3300009176 Bacteria 3493
273 Ga0105242_10112371 3300009176 Bacteria 2324
274 Ga0105242_10180473 3300009176 Bacteria 1862
275 Ga0105242_10278983 3300009176 Bacteria 1517
276 Ga0105242_10422111 3300009176 Bacteria 1250
277 Ga0105248_10010628 3300009177 Bacteria 10150
278 Ga0105248_10186137 3300009177 Bacteria 2340
279 Ga0105248_10214289 3300009177 Bacteria 2169
280 Ga0105248_10218547 3300009177 Bacteria 2146
281 Ga0105237_10039745 3300009545 Bacteria 4747
282 Ga0105237_10050600 3300009545 Bacteria 4175
283 Ga0105237_10238800 3300009545 Bacteria 1818
284 Ga0105237_10278220 3300009545 Bacteria 1676
285 Ga0105238_10005763 3300009551 Bacteria 12259
286 Ga0105238_10006788 3300009551 Bacteria 11431
287 Ga0105249_10005447 3300009553 Bacteria 10988
288 Ga0105249_10045346 3300009553 Bacteria 3998
289 Ga0105249_10148466 3300009553 Bacteria 2254
290 Ga0105239_10014335 3300010375 Bacteria 8794
291 Ga0105239_10026235 3300010375 Bacteria 6414
292 Ga0105239_10205199 3300010375 Bacteria 2209
293 Ga0105246_10006134 3300011119 Bacteria 7335
294 Ga0105246_10049280 3300011119 Bacteria 2884
295 Ga0105246_10052146 3300011119 Bacteria 2811
296 Ga0105246_10181204 3300011119 Bacteria 1622
297 Ga0157343_1000626 3300012488 Bacteria 1475
298 Ga0157338_1001164 3300012515 Bacteria 1815
299 Ga0157373_10024948 3300013100 Bacteria 4329
300 Ga0157371_10103642 3300013102 Bacteria 2019
301 Ga0157371_10294468 3300013102 Bacteria 1174
302 Ga0157370_10044909 3300013104 Bacteria 4243
303 Ga0157370_10154371 3300013104 Bacteria 2136
304 Ga0157369_10018894 3300013105 Bacteria 7723
305 Ga0157369_10021078 3300013105 Bacteria 7284
306 Ga0157369_10026887 3300013105 Bacteria 6380
307 Ga0157369_10044616 3300013105 Bacteria 4824
308 Ga0157374_10292555 3300013296 Bacteria 1610
309 Ga0157378_10004800 3300013297 Bacteria 11846
310 Ga0157378_10194619 3300013297 Bacteria 1914
311 Ga0157378_10321430 3300013297 Bacteria 1503
312 Ga0163162_10009912 3300013306 Bacteria 9265
313 Ga0163162_10058659 3300013306 Bacteria 3879
314 Ga0163162_10154976 3300013306 Bacteria 2410
315 Ga0163162_10344629 3300013306 Bacteria 1622
316 Ga0163162_10434426 3300013306 Unclassified 1445
317 Ga0163162_10538690 3300013306 Bacteria 1296
318 Ga0157372_10020185 3300013307 Bacteria 7185
319 Ga0157372_10020936 3300013307 Bacteria 7059
320 Ga0157372_10045204 3300013307 Bacteria 4883
321 Ga0157372_10052407 3300013307 Bacteria 4543
322 Ga0157372_10330789 3300013307 Bacteria 1774
323 Ga0157375_10014563 3300013308 Bacteria 7020
324 Ga0157375_10068190 3300013308 Bacteria 3558
325 Ga0157375_10073531 3300013308 Bacteria 3437
326 Ga0157375_10120845 3300013308 Bacteria 2729
327 Ga0163163_10002702 3300014325 Bacteria 14985
328 Ga0163163_10075938 3300014325 Bacteria 3354
329 Ga0157380_10033532 3300014326 Bacteria 3954
330 Ga0157380_10120038 3300014326 Bacteria 2225
331 Ga0157380_10141840 3300014326 Bacteria 2065
332 Ga0157380_10187928 3300014326 Bacteria 1821
333 Ga0157380_10258709 3300014326 Bacteria 1580
334 Ga0157380_10281553 3300014326 Bacteria 1522
335 Ga0182008_10014699 3300014497 Bacteria 4094
336 Ga0157377_10011681 3300014745 Bacteria 4391
337 Ga0157377_10108023 3300014745 Bacteria 1668
338 Ga0157379_10081001 3300014968 Bacteria 2908
339 Ga0157379_10132878 3300014968 Bacteria 2241
340 Ga0157376_10003894 3300014969 Bacteria 10323
341 Ga0157376_10037240 3300014969 Bacteria 3946
342 Ga0157376_10352526 3300014969 Bacteria 1409
343 Ga0182007_10037631 3300015262 Bacteria 1624
344 Ga0163161_10030576 3300017792 Bacteria 3834
345 Ga0163161_10031897 3300017792 Bacteria 3758
346 Ga0163161_10461712 3300017792 Unclassified 1028
347 Ga0206356_10907748 3300020070 Bacteria 1768
348 Ga0206356_11271870 3300020070 Bacteria 1276
349 Ga0206354_11467900 3300020081 Bacteria 1413
350 Ga0206353_10727954 3300020082 Bacteria 2177
351 Ga0206353_11243256 3300020082 Bacteria 3217
352 Ga0207697_10049155 3300025315 Bacteria 1740
353 Ga0207682_10042232 3300025893 Bacteria 1863
354 Ga0207692_10015358 3300025898 Bacteria 3367
355 Ga0207642_10003172 3300025899 Bacteria 5159
356 Ga0207642_10052274 3300025899 Bacteria 1853
357 Ga0207642_10121729 3300025899 Bacteria 1347
358 Ga0207710_10037637 3300025900 Bacteria 2137
359 Ga0207688_10007135 3300025901 Bacteria 6076
360 Ga0207688_10037103 3300025901 Bacteria 2702
361 Ga0207688_10048436 3300025901 Bacteria 2375
362 Ga0207688_10252472 3300025901 Bacteria 1068
363 Ga0207680_10010499 3300025903 Bacteria 4634
364 Ga0207647_10061628 3300025904 Bacteria 2288
365 Ga0207699_10210631 3300025906 Bacteria 1322
366 Ga0207645_10018402 3300025907 Bacteria 4596
367 Ga0207645_10088914 3300025907 Bacteria 1986
368 Ga0207643_10005237 3300025908 Bacteria 6937
369 Ga0207643_10007449 3300025908 Bacteria 5873
370 Ga0207643_10098383 3300025908 Bacteria 1713
371 Ga0207705_10323093 3300025909 Bacteria 1186
372 Ga0207684_10027750 3300025910 Bacteria 4822
373 Ga0207684_10244109 3300025910 Bacteria 1549
374 Ga0207654_10107939 3300025911 Bacteria 1726
375 Ga0207707_10048845 3300025912 Bacteria 3686
376 Ga0207707_10088830 3300025912 Bacteria 2700
377 Ga0207695_10022893 3300025913 Bacteria 7077
378 Ga0207695_10138406 3300025913 Bacteria 2386
379 Ga0207671_10042344 3300025914 Bacteria 3370
380 Ga0207671_10157798 3300025914 Bacteria 1756
381 Ga0207671_10212620 3300025914 Bacteria 1513
382 Ga0207663_10035150 3300025916 Bacteria 3003
383 Ga0207660_10022590 3300025917 Bacteria 4239
384 Ga0207660_10032137 3300025917 Bacteria 3621
385 Ga0207660_10206768 3300025917 Bacteria 1535
386 Ga0207662_10087811 3300025918 Bacteria 1908
387 Ga0207662_10315848 3300025918 Unclassified 1042
388 Ga0207657_10000392 3300025919 Bacteria 46205
389 Ga0207657_10016444 3300025919 Bacteria 7136
390 Ga0207649_10172437 3300025920 Bacteria 1508
391 Ga0207652_10172028 3300025921 Bacteria 1944
392 Ga0207652_10198354 3300025921 Bacteria 1806
393 Ga0207652_10339799 3300025921 Bacteria 1355
394 Ga0207646_10321003 3300025922 Bacteria 1399
395 Ga0207646_10392131 3300025922 Bacteria 1254
396 Ga0207681_10369591 3300025923 Bacteria 1152
397 Ga0207650_10001595 3300025925 Bacteria 16196
398 Ga0207659_10084766 3300025926 Bacteria 2352
399 Ga0207659_10097825 3300025926 Bacteria 2205
400 Ga0207687_10013742 3300025927 Bacteria 5287
401 Ga0207687_10031107 3300025927 Bacteria 3605
402 Ga0207687_10064773 3300025927 Bacteria 2593
403 Ga0207687_10093370 3300025927 Bacteria 2200
404 Ga0207687_10153789 3300025927 Bacteria 1758
405 Ga0207687_10207264 3300025927 Bacteria 1536
406 Ga0207687_10353276 3300025927 Bacteria 1198
407 Ga0207687_10467578 3300025927 Unclassified 1048
408 Ga0207700_10038006 3300025928 Bacteria 3491
409 Ga0207644_10124071 3300025931 Bacteria 1969
410 Ga0207644_10151624 3300025931 Bacteria 1794
411 Ga0207644_10363081 3300025931 Bacteria 1178
412 Ga0207690_10030289 3300025932 Bacteria 3449
413 Ga0207690_10303344 3300025932 Bacteria 1250
414 Ga0207690_10388882 3300025932 Unclassified 1110
415 Ga0207706_10286040 3300025933 Bacteria 1437
416 Ga0207686_10017939 3300025934 Bacteria 3998
417 Ga0207686_10038722 3300025934 Bacteria 2887
418 Ga0207709_10001613 3300025935 Bacteria 15346
419 Ga0207709_10041624 3300025935 Bacteria 2758
420 Ga0207709_10064132 3300025935 Bacteria 2305
421 Ga0207709_10064273 3300025935 Bacteria 2303
422 Ga0207709_10250800 3300025935 Bacteria 1293
423 Ga0207670_10048290 3300025936 Bacteria 2839
424 Ga0207669_10014513 3300025937 Bacteria 3951
425 Ga0207669_10033865 3300025937 Bacteria 2889
426 Ga0207669_10127363 3300025937 Bacteria 1742
427 Ga0207704_10007273 3300025938 Bacteria 5219
428 Ga0207704_10097403 3300025938 Bacteria 1951
429 Ga0207665_10027095 3300025939 Bacteria 3786
430 Ga0207691_10014462 3300025940 Bacteria 7524
431 Ga0207691_10035608 3300025940 Bacteria 4618
432 Ga0207711_10079577 3300025941 Bacteria 2861
433 Ga0207711_10130483 3300025941 Bacteria 2253
434 Ga0207711_10151573 3300025941 Bacteria 2092
435 Ga0207711_10236847 3300025941 Bacteria 1673
436 Ga0207689_10025253 3300025942 Bacteria 4979
437 Ga0207661_10003730 3300025944 Bacteria 10614
438 Ga0207661_10245636 3300025944 Bacteria 1589
439 Ga0207661_10267589 3300025944 Bacteria 1524
440 Ga0207661_10298500 3300025944 Bacteria 1444
441 Ga0207667_10026439 3300025949 Bacteria 6341
442 Ga0207667_10057030 3300025949 Bacteria 4101
443 Ga0207667_10125801 3300025949 Bacteria 2640
444 Ga0207667_10176749 3300025949 Bacteria 2193
445 Ga0207651_10185890 3300025960 Bacteria 1653
446 Ga0207712_10057529 3300025961 Bacteria 2744
447 Ga0207712_10333984 3300025961 Bacteria 1255
448 Ga0207712_10448386 3300025961 Bacteria 1094
449 Ga0207668_10019407 3300025972 Bacteria 4298
450 Ga0207668_10233307 3300025972 Bacteria 1485
451 Ga0207668_10268999 3300025972 Bacteria 1392
452 Ga0207668_10339742 3300025972 Bacteria 1252
453 Ga0207640_10127781 3300025981 Bacteria 1832
454 Ga0207640_10196939 3300025981 Bacteria 1523
455 Ga0207640_10237459 3300025981 Bacteria 1406
456 Ga0207658_10263161 3300025986 Bacteria 1471
457 Ga0207703_10457330 3300026035 Bacteria 1193
458 Ga0207678_10010413 3300026067 Bacteria 8163
459 Ga0207678_10015965 3300026067 Bacteria 6596
460 Ga0207678_10065220 3300026067 Bacteria 3128
461 Ga0207708_10005066 3300026075 Bacteria 9717
462 Ga0207708_10005846 3300026075 Bacteria 9103
463 Ga0207708_10018361 3300026075 Bacteria 5268
464 Ga0207708_10078445 3300026075 Bacteria 2536
465 Ga0207702_10108008 3300026078 Bacteria 2469
466 Ga0207648_10000214 3300026089 Bacteria 62323
467 Ga0207648_10034363 3300026089 Bacteria 4469
468 Ga0207648_10390014 3300026089 Bacteria 1260
469 Ga0207676_10015876 3300026095 Bacteria 5446
470 Ga0207676_10266979 3300026095 Bacteria 1548
471 Ga0207676_10404409 3300026095 Bacteria 1277
472 Ga0207675_100003071 3300026118 Bacteria 16378
473 Ga0207675_100012690 3300026118 Bacteria 7874
474 Ga0207675_100114769 3300026118 Bacteria 2544
475 Ga0207675_100479615 3300026118 Bacteria 1236
476 Ga0207675_100812348 3300026118 Unclassified 949
477 Ga0207683_10024530 3300026121 Bacteria 5195
478 Ga0207683_10039127 3300026121 Bacteria 4137
479 Ga0207683_10087160 3300026121 Bacteria 2776
480 Ga0207683_10088034 3300026121 Bacteria 2762
481 Ga0207683_10143973 3300026121 Bacteria 2148
482 Ga0207683_10226527 3300026121 Bacteria 1704
483 Ga0207698_10032256 3300026142 Bacteria 3792
484 Ga0207698_10033236 3300026142 Bacteria 3746
485 Ga0207698_10422020 3300026142 Bacteria 1280
486 Ga0207428_10000108 3300027907 Bacteria 115378
487 Ga0207428_10004375 3300027907 Bacteria 13472
488 Ga0207428_10026324 3300027907 Bacteria 4856
489 Ga0268266_10289439 3300028379 Bacteria 1525
490 Ga0268265_10217053 3300028380 Bacteria 1671
491 Ga0268264_10068857 3300028381 Bacteria 2992
492 Ga0268264_10191505 3300028381 Bacteria 1865
493 Ga0265337_1024111 3300028556 Bacteria 1865
494 Ga0265319_1000846 3300028563 Bacteria 19549
495 Ga0265318_10002860 3300028577 Bacteria 9006
496 Ga0265318_10017257 3300028577 Bacteria 2966
497 Ga0265338_10000705 3300028800 Bacteria 57138
498 Ga0265338_10006416 3300028800 Bacteria 14995
499 Ga0265338_10010871 3300028800 Bacteria 10593
500 Ga0265338_10011986 3300028800 Bacteria 9928
501 Ga0265338_10050515 3300028800 Bacteria 3758
502 Ga0265338_10089148 3300028800 Bacteria 2557
503 Ga0265330_10052007 3300031235 Bacteria 1795
504 Ga0265332_10022521 3300031238 Bacteria 2780
505 Ga0265320_10049854 3300031240 Bacteria 2037
506 Ga0265339_10008169 3300031249 Bacteria 6677
507 Ga0265331_10038770 3300031250 Bacteria 2327
508 Ga0265327_10013262 3300031251 Bacteria 5483
509 Ga0265316_10329961 3300031344 Bacteria 1107
510 Ga0265316_10371680 3300031344 Bacteria 1032
511 Ga0307408_100006161 3300031548 Bacteria 7960
512 Ga0265313_10070231 3300031595 Bacteria 1614
513 Ga0265314_10004955 3300031711 Bacteria 12148
514 Ga0265314_10024298 3300031711 Bacteria 4596
515 Ga0265314_10163158 3300031711 Bacteria 1354
516 Ga0307405_10057524 3300031731 Bacteria 2443
517 Ga0307413_10014618 3300031824 Bacteria 3994
518 Ga0307410_10000753 3300031852 Bacteria 13565
519 Ga0307406_10007192 3300031901 Bacteria 6166
520 Ga0307406_10083003 3300031901 Bacteria 2136
521 Ga0307406_10369647 3300031901 Bacteria 1127
522 Ga0307407_10006605 3300031903 Bacteria 5177
523 Ga0307409_100002792 3300031995 Bacteria 9225
524 Ga0307409_100038186 3300031995 Bacteria 3549
525 Ga0307409_100118439 3300031995 Bacteria 2237
526 Ga0307409_100342001 3300031995 Bacteria 1408
527 Ga0307416_100024078 3300032002 Bacteria 4434
528 Ga0307416_100040203 3300032002 Bacteria 3630
529 Ga0307416_100085026 3300032002 Bacteria 2691
530 Ga0307414_10024401 3300032004 Bacteria 3856
531 Ga0307411_10005161 3300032005 Bacteria 6383
532 Ga0307415_100004291 3300032126 Bacteria 7377
533 Ga0307415_100013991 3300032126 Bacteria 4702
534 Ga0307415_100015243 3300032126 Bacteria 4545
535 Ga0307415_100092651 3300032126 Bacteria 2192
536 Ga0307415_100212441 3300032126 Bacteria 1545
537 Ga0373930_0014563 3300034816 Bacteria 1466
538 Ga0373952_0015967 3300035092 Bacteria 1521
539 Ga0373939_0016486 3300035114 Bacteria 1949
540 Ga0373955_0268369 3300035172 Bacteria 1025
541 Ga0373942_0043368 3300035207 Bacteria 1236
542 Ga0373961_0021072 3300035241 Bacteria 1730
543 Ga0373962_0021485 3300035242 Bacteria 1703
544 Ga0373933_0044316 3300035724 Bacteria 2635
545 Ga0373937_0048175 3300036401 Bacteria 3900
546 Ga0373937_0070326 3300036401 Bacteria 3228
547 Ga0395899_0006132 3300037312 Bacteria 9317
548 Ga0395899_0006949 3300037312 Bacteria 8766
549 Ga0395899_0042994 3300037312 Bacteria 3371
550 Ga0395899_0195268 3300037312 Bacteria 1414
551 Ga0395899_0204096 3300037312 Bacteria 1376
552 Ga0395900_0001348 3300037418 Bacteria 29694
553 Ga0395900_0002485 3300037418 Bacteria 20252
554 Ga0395900_0005014 3300037418 Bacteria 13887
555 Ga0395900_0042283 3300037418 Bacteria 4694
556 Ga0395900_0054097 3300037418 Bacteria 4132
557 Ga0395900_0300839 3300037418 Bacteria 1590
558 Ga0395900_0621507 3300037418 Bacteria 1019
559 Ga0395898_0000734 3300037466 Bacteria 57441
560 Ga0395898_0001605 3300037466 Bacteria 30850
561 Ga0395898_0002159 3300037466 Bacteria 24137
562 Ga0395898_0013840 3300037466 Bacteria 8291
563 Ga0395898_0062682 3300037466 Bacteria 3611
564 Ga0395898_0103317 3300037466 Bacteria 2734
565 Ga0395898_0119162 3300037466 Bacteria 2528
566 Ga0395898_0450519 3300037466 Unclassified 1226
567 Ga0395898_0588594 3300037466 Bacteria 1055
568 Ga0395905_0001663 3300037471 Bacteria 26274
569 Ga0395905_0031928 3300037471 Bacteria 4954
570 Ga0395905_0039353 3300037471 Bacteria 4435
571 Ga0395905_0085783 3300037471 Bacteria 2950
572 Ga0395901_0000352 3300038443 Bacteria 55996
573 Ga0395901_0000586 3300038443 Bacteria 42347
574 Ga0395901_0002002 3300038443 Bacteria 20963
575 Ga0395901_0008678 3300038443 Bacteria 10272
576 Ga0395901_0043859 3300038443 Bacteria 4639
577 Ga0395901_0044840 3300038443 Bacteria 4586
578 Ga0395901_0085829 3300038443 Bacteria 3291
579 Ga0395901_0335710 3300038443 Bacteria 1562
580 Ga0395901_0669183 3300038443 Unclassified 1039
581 Ga0242420_030605 3300038996 Bacteria 997
582 Ga0436360_0239625 3300039438 Bacteria 1922
583 Ga0436360_1307936 3300039438 Bacteria 1994
584 Ga0439448_0003935 3300042005 Bacteria 4167
585 Ga0439448_0023177 3300042005 Bacteria 1934
586 Ga0439448_0061849 3300042005 Bacteria 1238
587 Ga0439455_0007909 3300042012 Bacteria 2265
588 Ga0439463_033115 3300042016 Bacteria 1307
589 Ga0450920_000491 3300042122 Bacteria 6215
590 Ga0450920_035425 3300042122 Bacteria 988
591 Ga0439460_0041508 3300042461 Unclassified 1352
592 Ga0466969_0065281 3300044656 Bacteria 1760
593 Ga0466966_0137232 3300044684 Bacteria 1495
594 Ga0466961_0073557 3300044693 Bacteria 2167
595 Ga0466963_0000671 3300044694 Bacteria 16565
596 Ga0466963_0002247 3300044694 Bacteria 10720
597 Ga0466963_0024363 3300044694 Bacteria 3853
598 Ga0466963_0029826 3300044694 Bacteria 3514
599 Ga0466963_0066267 3300044694 Bacteria 2422
600 Ga0466963_0079629 3300044694 Bacteria 2217
601 Ga0466963_0372739 3300044694 Unclassified 1006
602 Ga0466964_0004331 3300044706 Bacteria 5231
603 Ga0466971_0004864 3300044719 Bacteria 5810
604 Ga0466968_0004480 3300044735 Bacteria 5223
605 Ga0466957_0025155 3300044842 Bacteria 3527
606 Ga0466957_0025548 3300044842 Bacteria 3501
607 Ga0466957_0094771 3300044842 Bacteria 1875
608 Ga0466960_0091452 3300044901 Bacteria 1552
609 Ga0466959_0012975 3300045049 Bacteria 6033
610 Ga0466959_0037501 3300045049 Bacteria 3582
611 Ga0466959_0152642 3300045049 Bacteria 1627
612 Ga0451576_0038419 3300045051 Bacteria 5066
613 Ga0451576_0717287 3300045051 Bacteria 1050
614 Ga0466958_0004545 3300045836 Bacteria 7336
615 Ga0466958_0088961 3300045836 Bacteria 1908
616 Ga0466958_0138610 3300045836 Bacteria 1531
617 Ga0466967_0006742 3300045976 Bacteria 8173
618 Ga0466967_0015544 3300045976 Bacteria 5969
619 Ga0466967_0026310 3300045976 Bacteria 4817
620 Ga0466967_0045222 3300045976 Bacteria 3824
621 Ga0466967_0052620 3300045976 Bacteria 3575
622 Ga0466967_0053156 3300045976 Bacteria 3559
623 Ga0466967_0093004 3300045976 Bacteria 2743
624 Ga0466967_0103792 3300045976 Bacteria 2601
625 Ga0466967_0233871 3300045976 Bacteria 1750
626 Ga0466967_0337126 3300045976 Bacteria 1457
627 Ga0466967_0475593 3300045976 Bacteria 1223
628 Ga0466967_0545223 3300045976 Bacteria 1141
629 Ga0495592_0201287 3300046454 Bacteria 1344
630 Ga0495591_030561 3300046458 Bacteria 1625
631 Ga0495629_0082841 3300046459 Bacteria 2239
632 Ga0495651_0087921 3300046462 Bacteria 2336
633 Ga0495651_0223954 3300046462 Bacteria 1300
634 Ga0495653_0144625 3300046463 Bacteria 1668
635 Ga0495584_0027885 3300046491 Bacteria 2861
636 Ga0495585_0128157 3300046492 Bacteria 1338
637 Ga0495596_0027279 3300046500 Bacteria 2298
638 Ga0495596_0065356 3300046500 Bacteria 1415
639 Ga0495596_0072612 3300046500 Bacteria 1336
640 Ga0495608_0026080 3300046511 Bacteria 3987
641 Ga0495608_0057976 3300046511 Bacteria 2554
642 Ga0495608_0220232 3300046511 Bacteria 1191
643 Ga0495628_0216905 3300046516 Bacteria 1438
644 Ga0495630_0218692 3300046517 Bacteria 1454
645 Ga0495631_0034955 3300046518 Bacteria 2251
646 Ga0495631_0106859 3300046518 Bacteria 1203
647 Ga0495637_0104698 3300046520 Bacteria 1102
648 Ga0495663_0016516 3300046525 Bacteria 2087
649 Ga0495663_0041595 3300046525 Bacteria 1398
650 Ga0495642_0077601 3300046528 Bacteria 1395
651 Ga0495652_0339985 3300046529 Bacteria 1079
652 Ga0495654_0140010 3300046530 Bacteria 1079
653 Ga0495665_0056235 3300046531 Bacteria 2077
654 Ga0495586_0009293 3300046535 Bacteria 5229
655 Ga0495609_0072558 3300046538 Bacteria 1511
656 Ga0495609_0091798 3300046538 Bacteria 1321
657 Ga0495621_0037911 3300046539 Bacteria 1679
658 Ga0495667_0130322 3300046559 Bacteria 1622
659 Ga0495667_0241575 3300046559 Bacteria 1150
660 Ga0495668_0144101 3300046616 Bacteria 1304
661 Ga0495611_0064673 3300046648 Bacteria 1666
662 Ga0495611_0125745 3300046648 Bacteria 1196
663 Ga0495659_0071858 3300046664 Bacteria 1297
664 Ga0495661_0178949 3300046665 Bacteria 1125
665 Ga0495588_0041439 3300046674 Bacteria 2351
666 Ga0495646_0196629 3300046680 Bacteria 1100
667 Ga0495658_0103578 3300046683 Bacteria 1702
668 Ga0495669_0123716 3300046684 Bacteria 1214
669 Ga0495613_0041286 3300046689 Bacteria 3417
670 Ga0495613_0193661 3300046689 Bacteria 1436
671 Ga0495670_0116129 3300046691 Bacteria 1388
672 Ga0495589_0078952 3300046794 Bacteria 1602
673 Ga0495660_0172388 3300046810 Bacteria 1053
674 Ga0495581_0008654 3300047315 Bacteria 5895
675 Ga0495604_0072396 3300047317 Bacteria 2605
676 Ga0495680_0119491 3300047322 Bacteria 1947
677 Ga0495675_0101051 3300047444 Bacteria 1805
678 Ga0495677_0011755 3300047445 Bacteria 3200
679 Ga0495677_0022339 3300047445 Bacteria 2295
680 Ga0495684_0045879 3300047471 Bacteria 3343
681 Ga0495602_0090090 3300048088 Bacteria 2549
682 Ga0495602_0271473 3300048088 Bacteria 1253
683 Ga0495602_0386774 3300048088 Bacteria 1001
684 Ga0496100_0010339 3300048903 Bacteria 5280
685 Ga0496100_0058927 3300048903 Bacteria 2522
686 Ga0496100_0165704 3300048903 Bacteria 1587
687 Ga0496101_0010660 3300048904 Bacteria 6073
688 Ga0496101_0046958 3300048904 Bacteria 3098
689 Ga0496101_0074055 3300048904 Bacteria 2503
690 Ga0496101_0096820 3300048904 Bacteria 2203
691 Ga0496101_0131749 3300048904 Bacteria 1899
692 Ga0496102_0006872 3300048905 Bacteria 9712
693 Ga0496102_0034482 3300048905 Bacteria 4552
694 Ga0496102_0080028 3300048905 Bacteria 3010
695 Ga0496103_0001117 3300048906 Bacteria 18674
696 Ga0496103_0051469 3300048906 Bacteria 2549
697 Ga0496103_0151773 3300048906 Bacteria 1484
698 Ga0496103_0172792 3300048906 Bacteria 1388
699 Ga0496104_0002196 3300048907 Bacteria 16893
700 Ga0496104_0065506 3300048907 Bacteria 3448
701 Ga0496104_0096621 3300048907 Bacteria 2827
702 Ga0496104_0455545 3300048907 Bacteria 1191
703 Ga0496105_0000283 3300048908 Bacteria 33429
704 Ga0496105_0071299 3300048908 Bacteria 2872
705 Ga0496105_0113308 3300048908 Bacteria 2238
706 Ga0496105_0146028 3300048908 Bacteria 1945
707 Ga0496105_0149011 3300048908 Bacteria 1924
708 Ga0496106_0007876 3300048909 Bacteria 7875
709 Ga0496106_0039898 3300048909 Bacteria 3515
710 Ga0496106_0159200 3300048909 Bacteria 1785
711 Ga0496107_0004691 3300048910 Bacteria 9284
712 Ga0496107_0024060 3300048910 Bacteria 4306
713 Ga0496108_0002220 3300048911 Bacteria 15544
714 Ga0496108_0017228 3300048911 Bacteria 5909
715 Ga0496108_0027787 3300048911 Bacteria 4676
716 Ga0496108_0042580 3300048911 Bacteria 3791
717 Ga0496108_0065142 3300048911 Bacteria 3071
718 Ga0496108_0316451 3300048911 Bacteria 1360
719 Ga0496109_0000785 3300048912 Bacteria 26419
720 Ga0496109_0008936 3300048912 Bacteria 8537
721 Ga0496109_0015494 3300048912 Bacteria 6646
722 Ga0496109_0047598 3300048912 Bacteria 3899
723 Ga0496109_0071207 3300048912 Bacteria 3191
724 Ga0496109_0224547 3300048912 Bacteria 1767
725 Ga0496110_0000555 3300048913 Bacteria 25491
726 Ga0496110_0002271 3300048913 Bacteria 14354
727 Ga0496110_0016852 3300048913 Bacteria 6105
728 Ga0496110_0024600 3300048913 Bacteria 5134
729 Ga0496110_0138763 3300048913 Bacteria 2198
730 Ga0496110_0465749 3300048913 Bacteria 1152
731 Ga0496110_0996226 3300048913 Unclassified 745
732 Ga0496111_0000703 3300048914 Bacteria 17719
733 Ga0496111_0004301 3300048914 Bacteria 8977
734 Ga0496111_0008368 3300048914 Bacteria 6840
735 Ga0496111_0088441 3300048914 Bacteria 2269
736 Ga0496112_0000415 3300048915 Bacteria 28101
737 Ga0496112_0010167 3300048915 Bacteria 8525
738 Ga0496112_0045544 3300048915 Bacteria 4300
739 Ga0496112_0074963 3300048915 Bacteria 3346
740 Ga0496112_0111162 3300048915 Bacteria 2710
741 Ga0496112_0148667 3300048915 Bacteria 2310
742 Ga0496113_0000335 3300048916 Bacteria 22374
743 Ga0496113_0012986 3300048916 Bacteria 5620
744 Ga0496113_0019335 3300048916 Bacteria 4762
745 Ga0496113_0248128 3300048916 Bacteria 1421
746 Ga0496113_0420546 3300048916 Bacteria 1073
747 Ga0496114_0001492 3300048917 Bacteria 17771
748 Ga0496114_0084020 3300048917 Bacteria 2695
749 Ga0496114_0258841 3300048917 Bacteria 1532
750 Ga0496114_0267204 3300048917 Bacteria 1507
751 Ga0496114_0357078 3300048917 Bacteria 1293
752 Ga0496115_0020149 3300048918 Bacteria 5141
753 Ga0496115_0089641 3300048918 Bacteria 2512
754 Ga0496115_0130013 3300048918 Bacteria 2075
755 Ga0496115_0230407 3300048918 Bacteria 1528
756 Ga0501031_0010930 3300049568 Bacteria 5912
757 Ga0501032_0060784 3300049569 Bacteria 2534
758 Ga0501033_0072109 3300049570 Bacteria 2536
759 Ga0501034_0179167 3300049571 Bacteria 2084
760 Ga0501036_0006390 3300049572 Bacteria 9565
761 Ga0501036_0113383 3300049572 Bacteria 2291
762 Ga0501037_0024894 3300049573 Bacteria 4424
763 Ga0501038_0072433 3300049574 Bacteria 2920
764 Ga0501039_0027456 3300049575 Bacteria 4377
765 Ga0501040_0012664 3300049576 Bacteria 5531
766 Ga0501041_0003076 3300049577 Bacteria 9584
767 Ga0501041_0041960 3300049577 Bacteria 2779
768 Ga0501042_0005065 3300049578 Bacteria 8455
769 Ga0501042_0010629 3300049578 Bacteria 6182
770 Ga0501043_0013884 3300049579 Bacteria 6302
771 Ga0501043_0381326 3300049579 Bacteria 1067
772 Ga0501046_0005063 3300049580 Bacteria 11816
773 Ga0501046_0051136 3300049580 Bacteria 3262
774 Ga0501047_0132227 3300049581 Bacteria 2375
775 Ga0501047_0145112 3300049581 Bacteria 2251
776 Ga0501047_0294112 3300049581 Bacteria 1467
777 Ga0501048_0009048 3300049582 Bacteria 7495
778 Ga0501067_0017617 3300049583 Bacteria 3953
779 Ga0501067_0024848 3300049583 Bacteria 3322
780 Ga0501068_0005241 3300049584 Bacteria 7076
781 Ga0501068_0016442 3300049584 Bacteria 4265
782 Ga0501068_0034183 3300049584 Bacteria 3032
783 Ga0501068_0127412 3300049584 Bacteria 1590
784 Ga0501069_0004780 3300049585 Bacteria 7009
785 Ga0501069_0014630 3300049585 Bacteria 4196
786 Ga0501069_0042923 3300049585 Bacteria 2502
787 Ga0501069_0082640 3300049585 Bacteria 1810
788 Ga0501070_0000336 3300049586 Bacteria 42631
789 Ga0501070_0076035 3300049586 Bacteria 2780
790 Ga0501070_0117029 3300049586 Bacteria 2201
791 Ga0501070_0584956 3300049586 Bacteria 891
792 Ga0501071_0000851 3300049587 Bacteria 16378
793 Ga0501071_0010736 3300049587 Bacteria 6143
794 Ga0501071_0115874 3300049587 Bacteria 1983
795 Ga0501072_0004260 3300049588 Bacteria 10850
796 Ga0501072_0007485 3300049588 Bacteria 8286
797 Ga0501074_0001907 3300049590 Bacteria 14324
798 Ga0501074_0118728 3300049590 Bacteria 1891
799 Ga0501074_0164022 3300049590 Bacteria 1586
800 Ga0501075_0000839 3300049591 Bacteria 19363
801 Ga0501075_0044049 3300049591 Bacteria 3347
802 Ga0501076_0000358 3300049592 Bacteria 28280
803 Ga0501076_0007761 3300049592 Bacteria 7820
804 Ga0501076_0243392 3300049592 Bacteria 1472
805 Ga0501077_0005112 3300049593 Bacteria 7962
806 Ga0501077_0018701 3300049593 Bacteria 4382
807 Ga0501079_0024061 3300049741 Bacteria 4672
808 Ga0501080_0004255 3300049742 Bacteria 12703
809 Ga0501080_0032874 3300049742 Bacteria 4840
810 Ga0501080_0338318 3300049742 Bacteria 1360
811 Ga0501081_0006931 3300049743 Bacteria 7364
812 Ga0501081_0020550 3300049743 Bacteria 4400
813 Ga0501081_0135777 3300049743 Bacteria 1761
814 Ga0501081_0204250 3300049743 Bacteria 1434
815 Ga0501083_0008044 3300049744 Bacteria 7459
816 Ga0501083_0011606 3300049744 Bacteria 6180
817 Ga0501035_0003674 3300049822 Bacteria 14625
818 Ga0501035_0207517 3300049822 Bacteria 1678
819 Ga0501035_0359033 3300049822 Bacteria 1218
820 Ga0501044_0034087 3300049823 Bacteria 5344
821 Ga0501044_0220790 3300049823 Bacteria 1846
822 Ga0501045_0045002 3300049824 Bacteria 3214
823 Ga0501045_0080369 3300049824 Bacteria 2403
824 Ga0501045_0118073 3300049824 Bacteria 1968
825 Ga0501045_0338899 3300049824 Bacteria 1119
826 nmdc:mga05p37_10095_c1 3300050507 Bacteria 11208
827 nmdc:mga05p37_10918_c1 3300050507 Bacteria 10781
828 nmdc:mga05p37_219348_c1 3300050507 Bacteria 2296
829 nmdc:mga05p37_464866_c1 3300050507 Bacteria 1461
830 nmdc:mga05p37_682426_c1 3300050507 Bacteria 1144
831 nmdc:mga09592_4343_c1 3300050508 Bacteria 11461
832 nmdc:mga06r32_84424_c1 3300050510 Bacteria 3095
833 nmdc:mga08y16_13085_c1 3300050511 Bacteria 8729
834 nmdc:mga08y16_7593_c1 3300050511 Bacteria 11352
835 nmdc:mga0n895_60071_c1 3300050512 Bacteria 3751
836 nmdc:mga0n895_602480_c1 3300050512 Bacteria 1101
837 nmdc:mga0rr50_326886_c1 3300050513 Bacteria 1287
838 nmdc:mga08x19_150061_c1 3300050514 Bacteria 1578
839 nmdc:mga08x19_91437_c1 3300050514 Bacteria 2009
840 nmdc:mga0a205_16103_c2 3300050515 Bacteria 5338
841 nmdc:mga0a205_25675_c1 3300050515 Bacteria 5615
842 nmdc:mga0a205_33357_c1 3300050515 Bacteria 4936
843 nmdc:mga0a205_462481_c1 3300050515 Bacteria 1128
844 nmdc:mga0a205_46692_c1 3300050515 Bacteria 4177
845 Ga0495601_0165389 3300053077 Bacteria 1446
846 Ga0495655_0004823 3300053083 Bacteria 2338
847 Ga0495619_0192305 3300053085 Bacteria 1412
848 Ga0495619_0380509 3300053085 Bacteria 975
849 Ga0501084_0000537 3300054114 Bacteria 28931
850 Ga0501084_0026313 3300054114 Bacteria 4853
851 Ga0501082_0003976 3300060353 Bacteria 12907
852 Ga0501082_0034450 3300060353 Bacteria 4365
853 Ga0466962_0000434 3300061719 Bacteria 18170
854 Ga0466962_0056411 3300061719 Bacteria 1876
855 Ga0530510_0017961 3300061734 Bacteria 5015
856 Ga0530510_0053577 3300061734 Bacteria 2916
857 Ga0530510_0066061 3300061734 Bacteria 2621
858 Ga0530510_0091887 3300061734 Bacteria 2215
859 Ga0530510_0205333 3300061734 Bacteria 1464

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0372739 Ga0466963_0372739_14_697 209
2 3300005563 Ga0068855_100012204 Ga0068855_1000122047 216
3 3300025944 Ga0207661_10245636 Ga0207661_102456362 216
4 3300025949 Ga0207667_10026439 Ga0207667_100264392 216
5 3300048913 Ga0496110_0996226 Ga0496110_0996226_18_722 216
6 3300028563 Ga0265319_1000846 Ga0265319_10008462 220
7 3300028577 Ga0265318_10002860 Ga0265318_100028602 220
8 3300028800 Ga0265338_10010871 Ga0265338_100108719 220
9 3300031240 Ga0265320_10049854 Ga0265320_100498542 220
10 3300031250 Ga0265331_10038770 Ga0265331_100387702 220
11 3300031344 Ga0265316_10371680 Ga0265316_103716802 220
12 3300031711 Ga0265314_10024298 Ga0265314_100242981 220
13 3300045976 Ga0466967_0093004 Ga0466967_0093004_1011_1907 221
14 3300037418 Ga0395900_0300839 Ga0395900_0300839_310_1158 223
15 3300037466 Ga0395898_0062682 Ga0395898_0062682_719_1567 223
16 3300038443 Ga0395901_0008678 Ga0395901_0008678_1547_2395 223
17 3300031344 Ga0265316_10329961 Ga0265316_103299612 224
18 3300044694 Ga0466963_0066267 Ga0466963_0066267_997_1929 224
19 3300046559 Ga0495667_0130322 Ga0495667_0130322_12_713 224
20 3300053085 Ga0495619_0380509 Ga0495619_0380509_242_943 224
21 3300005329 Ga0070683_100205643 Ga0070683_1002056432 226
22 3300005535 Ga0070684_100378390 Ga0070684_1003783902 226
23 3300044842 Ga0466957_0094771 Ga0466957_0094771_934_1830 229
24 3300013105 Ga0157369_10018894 Ga0157369_100188949 230
25 3300045976 Ga0466967_0026310 Ga0466967_0026310_1259_2155 230
26 3300045976 Ga0466967_0545223 Ga0466967_0545223_231_1124 233
27 3300005435 Ga0070714_100157277 Ga0070714_1001572772 234
28 3300031711 Ga0265314_10163158 Ga0265314_101631582 234
29 3300005329 Ga0070683_100171743 Ga0070683_1001717432 235
30 3300005458 Ga0070681_10178703 Ga0070681_101787032 235
31 3300005530 Ga0070679_100227082 Ga0070679_1002270822 235
32 3300005539 Ga0068853_100204900 Ga0068853_1002049002 235
33 3300005563 Ga0068855_100264543 Ga0068855_1002645432 235
34 3300006028 Ga0070717_10611452 Ga0070717_106114521 235
35 3300009545 Ga0105237_10050600 Ga0105237_100506005 235
36 3300009551 Ga0105238_10006788 Ga0105238_100067885 235
37 3300013100 Ga0157373_10024948 Ga0157373_100249482 235
38 3300013104 Ga0157370_10044909 Ga0157370_100449095 235
39 3300013307 Ga0157372_10052407 Ga0157372_100524074 235
40 3300020070 Ga0206356_10907748 Ga0206356_109077482 235
41 3300025913 Ga0207695_10138406 Ga0207695_101384063 235
42 3300025914 Ga0207671_10157798 Ga0207671_101577981 235
43 3300028556 Ga0265337_1024111 Ga0265337_10241112 235
44 3300028800 Ga0265338_10006416 Ga0265338_100064162 235
45 3300031238 Ga0265332_10022521 Ga0265332_100225212 235
46 3300031249 Ga0265339_10008169 Ga0265339_100081694 235
47 3300031595 Ga0265313_10070231 Ga0265313_100702312 235
48 3300031711 Ga0265314_10004955 Ga0265314_100049554 235
49 3300037466 Ga0395898_0588594 Ga0395898_0588594_108_1040 235
50 3300045976 Ga0466967_0337126 Ga0466967_0337126_175_1074 235
51 3300044842 Ga0466957_0025548 Ga0466957_0025548_1397_2293 238
52 3300045836 Ga0466958_0138610 Ga0466958_0138610_170_1066 238
53 3300045976 Ga0466967_0053156 Ga0466967_0053156_1573_2469 238
54 3300048918 Ga0496115_0089641 Ga0496115_0089641_463_1362 238
55 3300061719 Ga0466962_0056411 Ga0466962_0056411_460_1356 238
56 3300044706 Ga0466964_0004331 Ga0466964_0004331_3112_4008 240
57 3300031235 Ga0265330_10052007 Ga0265330_100520072 241
58 3300044694 Ga0466963_0029826 Ga0466963_0029826_679_1578 241
59 3300028800 Ga0265338_10050515 Ga0265338_100505156 242
60 3300005329 Ga0070683_100056634 Ga0070683_1000566343 244
61 3300005336 Ga0070680_100003799 Ga0070680_1000037999 244
62 3300005458 Ga0070681_10009610 Ga0070681_100096107 244
63 3300005530 Ga0070679_100009682 Ga0070679_1000096827 244
64 3300005535 Ga0070684_100006235 Ga0070684_1000062356 244
65 3300005563 Ga0068855_100031221 Ga0068855_1000312212 244
66 3300009093 Ga0105240_10306751 Ga0105240_103067512 244
67 3300009176 Ga0105242_10422111 Ga0105242_104221111 244
68 3300013104 Ga0157370_10154371 Ga0157370_101543712 244
69 3300020070 Ga0206356_11271870 Ga0206356_112718702 244
70 3300020082 Ga0206353_11243256 Ga0206353_112432563 244
71 3300025912 Ga0207707_10048845 Ga0207707_100488452 244
72 3300025917 Ga0207660_10022590 Ga0207660_100225901 244
73 3300025919 Ga0207657_10000392 Ga0207657_1000039220 244
74 3300048913 Ga0496110_0138763 Ga0496110_0138763_391_1293 244
75 3300049583 Ga0501067_0024848 Ga0501067_0024848_412_1242 244
76 3300049585 Ga0501069_0014630 Ga0501069_0014630_2821_3651 244
77 3300005436 Ga0070713_100420627 Ga0070713_1004206271 245
78 3300035724 Ga0373933_0044316 Ga0373933_0044316_1668_2471 245
79 3300048907 Ga0496104_0065506 Ga0496104_0065506_262_1101 245
80 3300048908 Ga0496105_0146028 Ga0496105_0146028_614_1453 245
81 3300049742 Ga0501080_0338318 Ga0501080_0338318_56_868 245
82 3300031995 Ga0307409_100118439 Ga0307409_1001184393 246
83 3300032126 Ga0307415_100212441 Ga0307415_1002124412 246
84 3300042122 Ga0450920_035425 Ga0450920_035425_66_959 246
85 3300049579 Ga0501043_0381326 Ga0501043_0381326_290_1030 246
86 3300049824 Ga0501045_0118073 Ga0501045_0118073_1193_1933 246
87 3300005456 Ga0070678_100206742 Ga0070678_1002067422 247
88 3300005458 Ga0070681_10242256 Ga0070681_102422562 247
89 3300005981 Ga0081538_10092110 Ga0081538_100921102 247
90 3300009176 Ga0105242_10047304 Ga0105242_100473044 247
91 3300026121 Ga0207683_10087160 Ga0207683_100871602 247
92 3300049571 Ga0501034_0179167 Ga0501034_0179167_102_998 247
93 3300049581 Ga0501047_0132227 Ga0501047_0132227_1048_1944 247
94 3300049822 Ga0501035_0359033 Ga0501035_0359033_264_1160 247
95 3300005440 Ga0070705_100044043 Ga0070705_1000440432 248
96 3300005981 Ga0081538_10004835 Ga0081538_100048355 248
97 3300005981 Ga0081538_10031354 Ga0081538_100313542 248
98 3300049824 Ga0501045_0338899 Ga0501045_0338899_119_928 248
99 3300003323 rootH1_10298486 rootH1_102984862 249
100 3300007076 Ga0075435_100188293 Ga0075435_1001882932 249
101 3300049823 Ga0501044_0220790 Ga0501044_0220790_582_1430 250
102 3300028800 Ga0265338_10000705 Ga0265338_1000070542 251
103 3300031251 Ga0265327_10013262 Ga0265327_100132625 251
104 3300035172 Ga0373955_0268369 Ga0373955_0268369_50_940 251
105 3300036401 Ga0373937_0048175 Ga0373937_0048175_470_1360 251
106 3300045836 Ga0466958_0088961 Ga0466958_0088961_27_923 251
107 3300045976 Ga0466967_0015544 Ga0466967_0015544_3306_4145 251
108 3300046511 Ga0495608_0026080 Ga0495608_0026080_2143_3033 251
109 3300046529 Ga0495652_0339985 Ga0495652_0339985_160_1050 251
110 3300046559 Ga0495667_0241575 Ga0495667_0241575_212_1102 251
111 3300047317 Ga0495604_0072396 Ga0495604_0072396_173_1063 251
112 3300047444 Ga0495675_0101051 Ga0495675_0101051_146_1036 251
113 3300047471 Ga0495684_0045879 Ga0495684_0045879_664_1554 251
114 3300048088 Ga0495602_0386774 Ga0495602_0386774_72_962 251
115 3300049584 Ga0501068_0034183 Ga0501068_0034183_1420_2268 251
116 3300005336 Ga0070680_100340706 Ga0070680_1003407062 252
117 3300005444 Ga0070694_100032102 Ga0070694_1000321024 252
118 3300005458 Ga0070681_10146508 Ga0070681_101465082 252
119 3300005545 Ga0070695_100001212 Ga0070695_1000012128 252
120 3300005937 Ga0081455_10066747 Ga0081455_100667471 252
121 3300009093 Ga0105240_10009160 Ga0105240_100091608 252
122 3300009545 Ga0105237_10039745 Ga0105237_100397455 252
123 3300013307 Ga0157372_10020185 Ga0157372_100201855 252
124 3300025913 Ga0207695_10022893 Ga0207695_100228935 252
125 3300025914 Ga0207671_10042344 Ga0207671_100423444 252
126 3300025949 Ga0207667_10176749 Ga0207667_101767492 252
127 3300044694 Ga0466963_0000671 Ga0466963_0000671_84_980 252
128 3300045976 Ga0466967_0475593 Ga0466967_0475593_295_1191 252
129 3300046459 Ga0495629_0082841 Ga0495629_0082841_956_1765 252
130 3300046463 Ga0495653_0144625 Ga0495653_0144625_681_1490 252
131 3300046511 Ga0495608_0220232 Ga0495608_0220232_180_989 252
132 3300047322 Ga0495680_0119491 Ga0495680_0119491_644_1453 252
133 3300048905 Ga0496102_0006872 Ga0496102_0006872_3916_4737 252
134 3300002076 JGI24749J21850_1005718 JGI24749J21850_10057182 253
135 3300005329 Ga0070683_100036210 Ga0070683_1000362104 253
136 3300005331 Ga0070670_100002873 Ga0070670_10000287311 253
137 3300005331 Ga0070670_100148623 Ga0070670_1001486232 253
138 3300005334 Ga0068869_100020150 Ga0068869_1000201501 253
139 3300005337 Ga0070682_100081973 Ga0070682_1000819732 253
140 3300005338 Ga0068868_100043982 Ga0068868_1000439824 253
141 3300005340 Ga0070689_100023937 Ga0070689_1000239372 253
142 3300005343 Ga0070687_100112684 Ga0070687_1001126842 253
143 3300005354 Ga0070675_100085638 Ga0070675_1000856383 253
144 3300005355 Ga0070671_100045043 Ga0070671_1000450432 253
145 3300005356 Ga0070674_100075189 Ga0070674_1000751893 253
146 3300005364 Ga0070673_100018908 Ga0070673_1000189082 253
147 3300005366 Ga0070659_100070384 Ga0070659_1000703843 253
148 3300005439 Ga0070711_100423813 Ga0070711_1004238132 253
149 3300005440 Ga0070705_100160132 Ga0070705_1001601322 253
150 3300005441 Ga0070700_100001364 Ga0070700_1000013649 253
151 3300005444 Ga0070694_100250391 Ga0070694_1002503911 253
152 3300005455 Ga0070663_100152860 Ga0070663_1001528602 253
153 3300005456 Ga0070678_100006943 Ga0070678_1000069436 253
154 3300005459 Ga0068867_100103678 Ga0068867_1001036782 253
155 3300005466 Ga0070685_10004735 Ga0070685_100047353 253
156 3300005518 Ga0070699_100006802 Ga0070699_1000068029 253
157 3300005535 Ga0070684_100050130 Ga0070684_1000501302 253
158 3300005544 Ga0070686_100031350 Ga0070686_1000313502 253
159 3300005547 Ga0070693_100210886 Ga0070693_1002108862 253
160 3300005548 Ga0070665_100013694 Ga0070665_1000136942 253
161 3300005615 Ga0070702_100250049 Ga0070702_1002500492 253
162 3300005618 Ga0068864_100010046 Ga0068864_1000100468 253
163 3300005719 Ga0068861_100557003 Ga0068861_1005570031 253
164 3300005840 Ga0068870_10005803 Ga0068870_100058035 253
165 3300006844 Ga0075428_100070676 Ga0075428_1000706761 253
166 3300006881 Ga0068865_100021473 Ga0068865_1000214733 253
167 3300009147 Ga0114129_10179983 Ga0114129_101799834 253
168 3300009176 Ga0105242_10180473 Ga0105242_101804732 253
169 3300009177 Ga0105248_10218547 Ga0105248_102185472 253
170 3300011119 Ga0105246_10006134 Ga0105246_100061342 253
171 3300011119 Ga0105246_10052146 Ga0105246_100521463 253
172 3300013308 Ga0157375_10014563 Ga0157375_100145636 253
173 3300014325 Ga0163163_10002702 Ga0163163_1000270214 253
174 3300014326 Ga0157380_10120038 Ga0157380_101200382 253
175 3300014745 Ga0157377_10011681 Ga0157377_100116812 253
176 3300017792 Ga0163161_10030576 Ga0163161_100305764 253
177 3300025901 Ga0207688_10007135 Ga0207688_100071353 253
178 3300025907 Ga0207645_10088914 Ga0207645_100889142 253
179 3300025908 Ga0207643_10007449 Ga0207643_100074494 253
180 3300025918 Ga0207662_10315848 Ga0207662_103158481 253
181 3300025925 Ga0207650_10001595 Ga0207650_100015954 253
182 3300025926 Ga0207659_10084766 Ga0207659_100847662 253
183 3300025927 Ga0207687_10031107 Ga0207687_100311072 253
184 3300025931 Ga0207644_10151624 Ga0207644_101516242 253
185 3300025932 Ga0207690_10388882 Ga0207690_103888822 253
186 3300025935 Ga0207709_10041624 Ga0207709_100416242 253
187 3300025938 Ga0207704_10097403 Ga0207704_100974032 253
188 3300025940 Ga0207691_10035608 Ga0207691_100356085 253
189 3300025944 Ga0207661_10267589 Ga0207661_102675892 253
190 3300025972 Ga0207668_10233307 Ga0207668_102333072 253
191 3300025981 Ga0207640_10196939 Ga0207640_101969392 253
192 3300026067 Ga0207678_10065220 Ga0207678_100652203 253
193 3300026075 Ga0207708_10005066 Ga0207708_100050668 253
194 3300026095 Ga0207676_10015876 Ga0207676_100158765 253
195 3300026118 Ga0207675_100812348 Ga0207675_1008123481 253
196 3300026121 Ga0207683_10024530 Ga0207683_100245303 253
197 3300026142 Ga0207698_10422020 Ga0207698_104220202 253
198 3300045976 Ga0466967_0052620 Ga0466967_0052620_506_1426 253
199 3300046462 Ga0495651_0223954 Ga0495651_0223954_241_1098 253
200 3300048088 Ga0495602_0090090 Ga0495602_0090090_426_1283 253
201 3300048912 Ga0496109_0071207 Ga0496109_0071207_2015_2866 253
202 3300048914 Ga0496111_0088441 Ga0496111_0088441_366_1217 253
203 3300048916 Ga0496113_0248128 Ga0496113_0248128_412_1263 253
204 3300049581 Ga0501047_0294112 Ga0501047_0294112_443_1288 253
205 3300049585 Ga0501069_0082640 Ga0501069_0082640_67_912 253
206 3300049590 Ga0501074_0164022 Ga0501074_0164022_562_1407 253
207 3300050507 nmdc:mga05p37_10095_c1 nmdc:mga05p37_10095_c1_5145_5996 253
208 3300050507 nmdc:mga05p37_219348_c1 nmdc:mga05p37_219348_c1_117_968 253
209 3300005434 Ga0070709_10205326 Ga0070709_102053262 254
210 3300005435 Ga0070714_100019569 Ga0070714_1000195695 254
211 3300025906 Ga0207699_10210631 Ga0207699_102106312 254
212 3300045976 Ga0466967_0045222 Ga0466967_0045222_2450_3298 254
213 3300048918 Ga0496115_0230407 Ga0496115_0230407_212_1069 255
214 3300005336 Ga0070680_100344442 Ga0070680_1003444422 256
215 3300005341 Ga0070691_10039543 Ga0070691_100395431 256
216 3300005345 Ga0070692_10124424 Ga0070692_101244242 256
217 3300005366 Ga0070659_100393505 Ga0070659_1003935051 256
218 3300005578 Ga0068854_100241908 Ga0068854_1002419082 256
219 3300005615 Ga0070702_100040736 Ga0070702_1000407362 256
220 3300005937 Ga0081455_10013165 Ga0081455_100131657 256
221 3300009094 Ga0111539_10174445 Ga0111539_101744452 256
222 3300009098 Ga0105245_10080204 Ga0105245_100802042 256
223 3300009148 Ga0105243_10707706 Ga0105243_107077062 256
224 3300010375 Ga0105239_10026235 Ga0105239_100262352 256
225 3300025901 Ga0207688_10037103 Ga0207688_100371032 256
226 3300025927 Ga0207687_10353276 Ga0207687_103532761 256
227 3300025961 Ga0207712_10448386 Ga0207712_104483861 256
228 3300025972 Ga0207668_10339742 Ga0207668_103397422 256
229 3300026075 Ga0207708_10078445 Ga0207708_100784452 256
230 3300026089 Ga0207648_10034363 Ga0207648_100343634 256
231 3300026121 Ga0207683_10226527 Ga0207683_102265272 256
232 3300031548 Ga0307408_100006161 Ga0307408_1000061618 256
233 3300031731 Ga0307405_10057524 Ga0307405_100575242 256
234 3300031824 Ga0307413_10014618 Ga0307413_100146182 256
235 3300031852 Ga0307410_10000753 Ga0307410_1000075313 256
236 3300031901 Ga0307406_10007192 Ga0307406_100071924 256
237 3300031901 Ga0307406_10369647 Ga0307406_103696472 256
238 3300031903 Ga0307407_10006605 Ga0307407_100066056 256
239 3300031995 Ga0307409_100002792 Ga0307409_1000027924 256
240 3300032002 Ga0307416_100040203 Ga0307416_1000402034 256
241 3300032004 Ga0307414_10024401 Ga0307414_100244012 256
242 3300032005 Ga0307411_10005161 Ga0307411_100051614 256
243 3300032126 Ga0307415_100004291 Ga0307415_1000042913 256
244 3300042005 Ga0439448_0003935 Ga0439448_0003935_1488_2312 256
245 3300045051 Ga0451576_0717287 Ga0451576_0717287_97_921 256
246 3300046458 Ga0495591_030561 Ga0495591_030561_357_1181 256
247 3300046518 Ga0495631_0106859 Ga0495631_0106859_330_1154 256
248 3300046520 Ga0495637_0104698 Ga0495637_0104698_236_1060 256
249 3300046525 Ga0495663_0041595 Ga0495663_0041595_123_947 256
250 3300046528 Ga0495642_0077601 Ga0495642_0077601_308_1132 256
251 3300046530 Ga0495654_0140010 Ga0495654_0140010_98_922 256
252 3300046648 Ga0495611_0064673 Ga0495611_0064673_752_1576 256
253 3300046665 Ga0495661_0178949 Ga0495661_0178949_247_1071 256
254 3300047445 Ga0495677_0011755 Ga0495677_0011755_1431_2255 256
255 3300048905 Ga0496102_0080028 Ga0496102_0080028_2170_2994 256
256 3300005436 Ga0070713_100495393 Ga0070713_1004953932 257
257 3300005518 Ga0070699_100298523 Ga0070699_1002985232 257
258 3300005985 Ga0081539_10000620 Ga0081539_1000062074 257
259 3300006028 Ga0070717_10080163 Ga0070717_100801632 257
260 3300025928 Ga0207700_10038006 Ga0207700_100380063 257
261 3300025935 Ga0207709_10064273 Ga0207709_100642732 257
262 3300028800 Ga0265338_10011986 Ga0265338_100119869 257
263 3300039438 Ga0436360_0239625 Ga0436360_0239625_489_1331 257
264 3300045976 Ga0466967_0103792 Ga0466967_0103792_814_1653 257
265 3300046500 Ga0495596_0027279 Ga0495596_0027279_1020_1844 257
266 3300046538 Ga0495609_0072558 Ga0495609_0072558_407_1231 257
267 3300046539 Ga0495621_0037911 Ga0495621_0037911_394_1218 257
268 3300046664 Ga0495659_0071858 Ga0495659_0071858_457_1281 257
269 3300050514 nmdc:mga08x19_150061_c1 nmdc:mga08x19_150061_c1_551_1393 257
270 3300053083 Ga0495655_0004823 Ga0495655_0004823_944_1768 257
271 3300025927 Ga0207687_10207264 Ga0207687_102072642 258
272 3300037418 Ga0395900_0621507 Ga0395900_0621507_71_973 258
273 3300049743 Ga0501081_0204250 Ga0501081_0204250_486_1337 258
274 3300053077 Ga0495601_0165389 Ga0495601_0165389_12_821 258
275 3300061734 Ga0530510_0091887 Ga0530510_0091887_592_1443 258
276 3300009148 Ga0105243_10038804 Ga0105243_100388042 259
277 3300048913 Ga0496110_0465749 Ga0496110_0465749_139_951 259
278 3300049586 Ga0501070_0584956 Ga0501070_0584956_20_868 259
279 3300049592 Ga0501076_0243392 Ga0501076_0243392_253_1152 259
280 3300049743 Ga0501081_0135777 Ga0501081_0135777_80_931 259
281 3300050515 nmdc:mga0a205_462481_c1 nmdc:mga0a205_462481_c1_11_814 259
282 3300005937 Ga0081455_10170483 Ga0081455_101704832 260
283 3300049568 Ga0501031_0010930 Ga0501031_0010930_1233_2132 260
284 3300049569 Ga0501032_0060784 Ga0501032_0060784_1094_1993 260
285 3300049570 Ga0501033_0072109 Ga0501033_0072109_958_1857 260
286 3300049572 Ga0501036_0006390 Ga0501036_0006390_5227_6126 260
287 3300049573 Ga0501037_0024894 Ga0501037_0024894_701_1600 260
288 3300049576 Ga0501040_0012664 Ga0501040_0012664_613_1512 260
289 3300049577 Ga0501041_0003076 Ga0501041_0003076_3634_4533 260
290 3300049578 Ga0501042_0005065 Ga0501042_0005065_3634_4533 260
291 3300049579 Ga0501043_0013884 Ga0501043_0013884_357_1256 260
292 3300049580 Ga0501046_0005063 Ga0501046_0005063_4250_5149 260
293 3300049582 Ga0501048_0009048 Ga0501048_0009048_3794_4693 260
294 3300049584 Ga0501068_0005241 Ga0501068_0005241_2039_2938 260
295 3300049585 Ga0501069_0004780 Ga0501069_0004780_2824_3723 260
296 3300049587 Ga0501071_0010736 Ga0501071_0010736_2497_3396 260
297 3300049588 Ga0501072_0004260 Ga0501072_0004260_8344_9243 260
298 3300049590 Ga0501074_0001907 Ga0501074_0001907_2324_3223 260
299 3300049590 Ga0501074_0118728 Ga0501074_0118728_392_1291 260
300 3300049591 Ga0501075_0000839 Ga0501075_0000839_4629_5528 260
301 3300049592 Ga0501076_0007761 Ga0501076_0007761_4157_5056 260
302 3300049593 Ga0501077_0005112 Ga0501077_0005112_2731_3630 260
303 3300049741 Ga0501079_0024061 Ga0501079_0024061_1716_2615 260
304 3300049742 Ga0501080_0004255 Ga0501080_0004255_9020_9919 260
305 3300049743 Ga0501081_0020550 Ga0501081_0020550_2196_3095 260
306 3300049744 Ga0501083_0008044 Ga0501083_0008044_299_1198 260
307 3300049822 Ga0501035_0003674 Ga0501035_0003674_10829_11728 260
308 3300049823 Ga0501044_0034087 Ga0501044_0034087_1630_2529 260
309 3300049824 Ga0501045_0045002 Ga0501045_0045002_2064_2885 260
310 3300049824 Ga0501045_0080369 Ga0501045_0080369_70_969 260
311 3300054114 Ga0501084_0026313 Ga0501084_0026313_2789_3688 260
312 3300060353 Ga0501082_0003976 Ga0501082_0003976_6860_7759 260
313 3300061734 Ga0530510_0066061 Ga0530510_0066061_129_1028 260
314 3300005354 Ga0070675_100547349 Ga0070675_1005473491 261
315 3300005456 Ga0070678_100048888 Ga0070678_1000488882 261
316 3300005530 Ga0070679_100102599 Ga0070679_1001025993 261
317 3300005563 Ga0068855_100313576 Ga0068855_1003135762 261
318 3300005616 Ga0068852_100349220 Ga0068852_1003492202 261
319 3300005840 Ga0068870_10283741 Ga0068870_102837411 261
320 3300006237 Ga0097621_100303316 Ga0097621_1003033162 261
321 3300006358 Ga0068871_100128712 Ga0068871_1001287122 261
322 3300009098 Ga0105245_10055287 Ga0105245_100552874 261
323 3300009176 Ga0105242_10112371 Ga0105242_101123712 261
324 3300013105 Ga0157369_10026887 Ga0157369_100268876 261
325 3300014326 Ga0157380_10141840 Ga0157380_101418402 261
326 3300020081 Ga0206354_11467900 Ga0206354_114679002 261
327 3300020082 Ga0206353_10727954 Ga0206353_107279542 261
328 3300025908 Ga0207643_10005237 Ga0207643_100052371 261
329 3300025921 Ga0207652_10198354 Ga0207652_101983542 261
330 3300025927 Ga0207687_10153789 Ga0207687_101537891 261
331 3300025937 Ga0207669_10127363 Ga0207669_101273632 261
332 3300026121 Ga0207683_10088034 Ga0207683_100880342 261
333 3300031901 Ga0307406_10083003 Ga0307406_100830032 261
334 3300032002 Ga0307416_100085026 Ga0307416_1000850262 261
335 3300044684 Ga0466966_0137232 Ga0466966_0137232_297_1196 261
336 3300048915 Ga0496112_0074963 Ga0496112_0074963_2208_3017 261
337 3300005336 Ga0070680_100485029 Ga0070680_1004850291 262
338 3300005345 Ga0070692_10089763 Ga0070692_100897632 262
339 3300005440 Ga0070705_100085756 Ga0070705_1000857562 262
340 3300005441 Ga0070700_100074944 Ga0070700_1000749442 262
341 3300005445 Ga0070708_100292466 Ga0070708_1002924662 262
342 3300005459 Ga0068867_100145225 Ga0068867_1001452252 262
343 3300005544 Ga0070686_100135624 Ga0070686_1001356242 262
344 3300005545 Ga0070695_100200930 Ga0070695_1002009302 262
345 3300005563 Ga0068855_100400343 Ga0068855_1004003432 262
346 3300005578 Ga0068854_100093844 Ga0068854_1000938442 262
347 3300005615 Ga0070702_100052589 Ga0070702_1000525893 262
348 3300005843 Ga0068860_100409574 Ga0068860_1004095742 262
349 3300006881 Ga0068865_100395602 Ga0068865_1003956021 262
350 3300014497 Ga0182008_10014699 Ga0182008_100146995 262
351 3300025899 Ga0207642_10052274 Ga0207642_100522742 262
352 3300025918 Ga0207662_10087811 Ga0207662_100878112 262
353 3300025933 Ga0207706_10286040 Ga0207706_102860402 262
354 3300025934 Ga0207686_10038722 Ga0207686_100387224 262
355 3300025986 Ga0207658_10263161 Ga0207658_102631612 262
356 3300026075 Ga0207708_10018361 Ga0207708_100183615 262
357 3300026089 Ga0207648_10390014 Ga0207648_103900142 262
358 3300026118 Ga0207675_100114769 Ga0207675_1001147692 262
359 3300037312 Ga0395899_0204096 Ga0395899_0204096_290_1192 262
360 3300037418 Ga0395900_0042283 Ga0395900_0042283_705_1607 262
361 3300037466 Ga0395898_0001605 Ga0395898_0001605_28259_29161 262
362 3300037471 Ga0395905_0031928 Ga0395905_0031928_2848_3750 262
363 3300038443 Ga0395901_0000352 Ga0395901_0000352_23740_24678 262
364 3300038443 Ga0395901_0669183 Ga0395901_0669183_73_897 262
365 3300038996 Ga0242420_030605 Ga0242420_030605_32_844 262
366 3300044656 Ga0466969_0065281 Ga0466969_0065281_329_1231 262
367 3300044735 Ga0466968_0004480 Ga0466968_0004480_1495_2397 262
368 3300045049 Ga0466959_0012975 Ga0466959_0012975_398_1300 262
369 3300049583 Ga0501067_0017617 Ga0501067_0017617_857_1681 262
370 3300049584 Ga0501068_0016442 Ga0501068_0016442_817_1641 262
371 3300049585 Ga0501069_0042923 Ga0501069_0042923_549_1373 262
372 3300049586 Ga0501070_0076035 Ga0501070_0076035_71_895 262
373 3300049587 Ga0501071_0115874 Ga0501071_0115874_651_1475 262
374 3300007076 Ga0075435_100026229 Ga0075435_1000262293 264
375 3300048917 Ga0496114_0258841 Ga0496114_0258841_102_986 264
376 3300050515 nmdc:mga0a205_25675_c1 nmdc:mga0a205_25675_c1_2991_3878 264
377 3300005547 Ga0070693_100058850 Ga0070693_1000588502 265
378 3300015262 Ga0182007_10037631 Ga0182007_100376312 265
379 3300025941 Ga0207711_10151573 Ga0207711_101515732 265
380 3300037312 Ga0395899_0006132 Ga0395899_0006132_5606_6463 265
381 3300037312 Ga0395899_0195268 Ga0395899_0195268_180_1118 265
382 3300037418 Ga0395900_0001348 Ga0395900_0001348_25963_26820 265
383 3300037418 Ga0395900_0005014 Ga0395900_0005014_11757_12695 265
384 3300037466 Ga0395898_0000734 Ga0395898_0000734_24401_25339 265
385 3300037466 Ga0395898_0002159 Ga0395898_0002159_3987_4844 265
386 3300037471 Ga0395905_0001663 Ga0395905_0001663_22584_23441 265
387 3300038443 Ga0395901_0000586 Ga0395901_0000586_18725_19582 265
388 3300038443 Ga0395901_0043859 Ga0395901_0043859_369_1307 265
389 3300048917 Ga0496114_0357078 Ga0496114_0357078_274_1095 265
390 3300049581 Ga0501047_0145112 Ga0501047_0145112_436_1332 265
391 3300028800 Ga0265338_10089148 Ga0265338_100891483 266
392 3300032126 Ga0307415_100092651 Ga0307415_1000926512 266
393 3300044693 Ga0466961_0073557 Ga0466961_0073557_941_1876 266
394 3300044694 Ga0466963_0002247 Ga0466963_0002247_9045_9980 266
395 3300044719 Ga0466971_0004864 Ga0466971_0004864_4362_5297 266
396 3300044842 Ga0466957_0025155 Ga0466957_0025155_964_1899 266
397 3300045049 Ga0466959_0037501 Ga0466959_0037501_2139_3074 266
398 3300045836 Ga0466958_0004545 Ga0466958_0004545_614_1549 266
399 3300045976 Ga0466967_0233871 Ga0466967_0233871_205_1140 266
400 3300061719 Ga0466962_0000434 Ga0466962_0000434_5171_6106 266
401 3300044694 Ga0466963_0024363 Ga0466963_0024363_536_1432 267
402 3300005339 Ga0070660_100296138 Ga0070660_1002961382 268
403 3300005341 Ga0070691_10049650 Ga0070691_100496501 268
404 3300005438 Ga0070701_10056756 Ga0070701_100567562 268
405 3300005444 Ga0070694_100258732 Ga0070694_1002587322 268
406 3300005445 Ga0070708_100026776 Ga0070708_1000267765 268
407 3300005467 Ga0070706_100059179 Ga0070706_1000591792 268
408 3300005468 Ga0070707_100164074 Ga0070707_1001640743 268
409 3300005471 Ga0070698_100016785 Ga0070698_1000167857 268
410 3300005616 Ga0068852_100135322 Ga0068852_1001353223 268
411 3300025910 Ga0207684_10244109 Ga0207684_102441092 268
412 3300025922 Ga0207646_10321003 Ga0207646_103210032 268
413 3300025927 Ga0207687_10013742 Ga0207687_100137422 268
414 3300045976 Ga0466967_0006742 Ga0466967_0006742_1925_2764 268
415 3300005983 Ga0081540_1033790 Ga0081540_10337902 269
416 3300038443 Ga0395901_0335710 Ga0395901_0335710_82_978 269
417 3300039438 Ga0436360_1307936 Ga0436360_1307936_790_1623 269
418 3300042005 Ga0439448_0061849 Ga0439448_0061849_245_1078 269
419 3300013306 Ga0163162_10538690 Ga0163162_105386902 270
420 3300044694 Ga0466963_0079629 Ga0466963_0079629_1030_1929 270
421 3300044901 Ga0466960_0091452 Ga0466960_0091452_228_1133 270
422 3300048904 Ga0496101_0131749 Ga0496101_0131749_920_1771 270
423 3300048909 Ga0496106_0159200 Ga0496106_0159200_790_1641 270
424 3300048917 Ga0496114_0084020 Ga0496114_0084020_1347_2198 270
425 3300050515 nmdc:mga0a205_33357_c1 nmdc:mga0a205_33357_c1_980_1831 270
426 3300005467 Ga0070706_100018674 Ga0070706_1000186742 271
427 3300005471 Ga0070698_100008125 Ga0070698_1000081259 271
428 3300013105 Ga0157369_10021078 Ga0157369_100210783 271
429 3300025910 Ga0207684_10027750 Ga0207684_100277505 271
430 3300045049 Ga0466959_0152642 Ga0466959_0152642_696_1556 271
431 3300048915 Ga0496112_0045544 Ga0496112_0045544_414_1262 271
432 3300005468 Ga0070707_100279743 Ga0070707_1002797432 273
433 3300036401 Ga0373937_0070326 Ga0373937_0070326_716_1585 274
434 3300046454 Ga0495592_0201287 Ga0495592_0201287_223_1092 274
435 3300046462 Ga0495651_0087921 Ga0495651_0087921_178_1047 274
436 3300046511 Ga0495608_0057976 Ga0495608_0057976_310_1179 274
437 3300046516 Ga0495628_0216905 Ga0495628_0216905_330_1199 274
438 3300046680 Ga0495646_0196629 Ga0495646_0196629_134_1003 274
439 3300048088 Ga0495602_0271473 Ga0495602_0271473_15_884 274
440 3300053085 Ga0495619_0192305 Ga0495619_0192305_455_1324 274
441 3300028577 Ga0265318_10017257 Ga0265318_100172573 278
442 3300014745 Ga0157377_10108023 Ga0157377_101080231 279
443 3300061734 Ga0530510_0205333 Ga0530510_0205333_41_949 279
444 3300005329 Ga0070683_100063871 Ga0070683_1000638713 280
445 3300005340 Ga0070689_100221328 Ga0070689_1002213282 280
446 3300005436 Ga0070713_100160074 Ga0070713_1001600742 280
447 3300005456 Ga0070678_100038226 Ga0070678_1000382261 280
448 3300005458 Ga0070681_10077567 Ga0070681_100775674 280
449 3300005530 Ga0070679_100032107 Ga0070679_1000321075 280
450 3300005535 Ga0070684_100046442 Ga0070684_1000464424 280
451 3300005546 Ga0070696_100103960 Ga0070696_1001039602 280
452 3300005719 Ga0068861_100500156 Ga0068861_1005001561 280
453 3300005937 Ga0081455_10013491 Ga0081455_100134914 280
454 3300005983 Ga0081540_1004951 Ga0081540_10049518 280
455 3300006028 Ga0070717_10179822 Ga0070717_101798222 280
456 3300006058 Ga0075432_10053097 Ga0075432_100530972 280
457 3300006871 Ga0075434_100052545 Ga0075434_1000525455 280
458 3300007076 Ga0075435_100029619 Ga0075435_1000296193 280
459 3300009092 Ga0105250_10105018 Ga0105250_101050181 280
460 3300009093 Ga0105240_10109722 Ga0105240_101097223 280
461 3300009094 Ga0111539_10249453 Ga0111539_102494532 280
462 3300009098 Ga0105245_10195144 Ga0105245_101951442 280
463 3300009098 Ga0105245_10304664 Ga0105245_103046642 280
464 3300009148 Ga0105243_10187462 Ga0105243_101874622 280
465 3300009176 Ga0105242_10024665 Ga0105242_100246655 280
466 3300009545 Ga0105237_10278220 Ga0105237_102782202 280
467 3300013102 Ga0157371_10103642 Ga0157371_101036423 280
468 3300013297 Ga0157378_10194619 Ga0157378_101946192 280
469 3300013306 Ga0163162_10344629 Ga0163162_103446292 280
470 3300013306 Ga0163162_10434426 Ga0163162_104344261 280
471 3300013307 Ga0157372_10330789 Ga0157372_103307892 280
472 3300013308 Ga0157375_10120845 Ga0157375_101208452 280
473 3300014325 Ga0163163_10075938 Ga0163163_100759382 280
474 3300014326 Ga0157380_10187928 Ga0157380_101879282 280
475 3300014969 Ga0157376_10352526 Ga0157376_103525262 280
476 3300025909 Ga0207705_10323093 Ga0207705_103230932 280
477 3300025917 Ga0207660_10206768 Ga0207660_102067682 280
478 3300025981 Ga0207640_10237459 Ga0207640_102374592 280
479 3300026095 Ga0207676_10404409 Ga0207676_104044092 280
480 3300026118 Ga0207675_100479615 Ga0207675_1004796152 280
481 3300027907 Ga0207428_10004375 Ga0207428_100043753 280
482 3300031995 Ga0307409_100038186 Ga0307409_1000381862 280
483 3300032126 Ga0307415_100015243 Ga0307415_1000152435 280
484 3300034816 Ga0373930_0014563 Ga0373930_0014563_220_1098 280
485 3300037312 Ga0395899_0006949 Ga0395899_0006949_1450_2328 280
486 3300037418 Ga0395900_0002485 Ga0395900_0002485_16749_17627 280
487 3300037466 Ga0395898_0013840 Ga0395898_0013840_685_1563 280
488 3300037471 Ga0395905_0039353 Ga0395905_0039353_804_1682 280
489 3300038443 Ga0395901_0002002 Ga0395901_0002002_7493_8371 280
490 3300042005 Ga0439448_0023177 Ga0439448_0023177_560_1438 280
491 3300042012 Ga0439455_0007909 Ga0439455_0007909_685_1563 280
492 3300042016 Ga0439463_033115 Ga0439463_033115_146_1024 280
493 3300042461 Ga0439460_0041508 Ga0439460_0041508_439_1317 280
494 3300045051 Ga0451576_0038419 Ga0451576_0038419_2461_3339 280
495 3300046500 Ga0495596_0065356 Ga0495596_0065356_47_925 280
496 3300046517 Ga0495630_0218692 Ga0495630_0218692_479_1384 280
497 3300046535 Ga0495586_0009293 Ga0495586_0009293_931_1836 280
498 3300046683 Ga0495658_0103578 Ga0495658_0103578_249_1154 280
499 3300046689 Ga0495613_0041286 Ga0495613_0041286_1467_2372 280
500 3300048903 Ga0496100_0010339 Ga0496100_0010339_3481_4359 280
501 3300048904 Ga0496101_0010660 Ga0496101_0010660_955_1833 280
502 3300048904 Ga0496101_0096820 Ga0496101_0096820_775_1653 280
503 3300048905 Ga0496102_0034482 Ga0496102_0034482_440_1318 280
504 3300048906 Ga0496103_0051469 Ga0496103_0051469_1326_2204 280
505 3300048906 Ga0496103_0151773 Ga0496103_0151773_143_1021 280
506 3300048907 Ga0496104_0002196 Ga0496104_0002196_9601_10479 280
507 3300048907 Ga0496104_0455545 Ga0496104_0455545_226_1119 280
508 3300048908 Ga0496105_0000283 Ga0496105_0000283_14104_14982 280
509 3300048908 Ga0496105_0071299 Ga0496105_0071299_1147_2025 280
510 3300048909 Ga0496106_0039898 Ga0496106_0039898_2584_3462 280
511 3300048910 Ga0496107_0024060 Ga0496107_0024060_2971_3849 280
512 3300048911 Ga0496108_0002220 Ga0496108_0002220_6688_7566 280
513 3300048911 Ga0496108_0027787 Ga0496108_0027787_358_1236 280
514 3300048912 Ga0496109_0000785 Ga0496109_0000785_18681_19559 280
515 3300048913 Ga0496110_0000555 Ga0496110_0000555_8486_9364 280
516 3300048913 Ga0496110_0016852 Ga0496110_0016852_1514_2392 280
517 3300048914 Ga0496111_0000703 Ga0496111_0000703_7241_8119 280
518 3300048915 Ga0496112_0000415 Ga0496112_0000415_5495_6373 280
519 3300048915 Ga0496112_0010167 Ga0496112_0010167_939_1817 280
520 3300048916 Ga0496113_0000335 Ga0496113_0000335_19322_20200 280
521 3300048916 Ga0496113_0019335 Ga0496113_0019335_2889_3767 280
522 3300048918 Ga0496115_0130013 Ga0496115_0130013_476_1354 280
523 3300049586 Ga0501070_0000336 Ga0501070_0000336_36996_37895 280
524 3300050507 nmdc:mga05p37_464866_c1 nmdc:mga05p37_464866_c1_401_1279 280
525 3300050507 nmdc:mga05p37_682426_c1 nmdc:mga05p37_682426_c1_259_1128 280
526 3300050510 nmdc:mga06r32_84424_c1 nmdc:mga06r32_84424_c1_1642_2520 280
527 3300050512 nmdc:mga0n895_60071_c1 nmdc:mga0n895_60071_c1_160_1038 280
528 3300050513 nmdc:mga0rr50_326886_c1 nmdc:mga0rr50_326886_c1_250_1128 280
529 3300050514 nmdc:mga08x19_91437_c1 nmdc:mga08x19_91437_c1_1010_1888 280
530 3300050515 nmdc:mga0a205_46692_c1 nmdc:mga0a205_46692_c1_2079_2957 280
531 3300002075 JGI24738J21930_10012998 JGI24738J21930_100129982 281
532 3300002155 JGI24033J26618_1006159 JGI24033J26618_10061591 281
533 3300002244 JGI24742J22300_10026290 JGI24742J22300_100262901 281
534 3300005329 Ga0070683_100013597 Ga0070683_1000135973 281
535 3300005329 Ga0070683_100022464 Ga0070683_1000224643 281
536 3300005329 Ga0070683_100042523 Ga0070683_1000425234 281
537 3300005329 Ga0070683_100091183 Ga0070683_1000911833 281
538 3300005329 Ga0070683_100105441 Ga0070683_1001054412 281
539 3300005329 Ga0070683_100193485 Ga0070683_1001934852 281
540 3300005331 Ga0070670_100093877 Ga0070670_1000938772 281
541 3300005331 Ga0070670_100286507 Ga0070670_1002865072 281
542 3300005334 Ga0068869_100317021 Ga0068869_1003170212 281
543 3300005335 Ga0070666_10129238 Ga0070666_101292382 281
544 3300005336 Ga0070680_100038557 Ga0070680_1000385574 281
545 3300005336 Ga0070680_100071290 Ga0070680_1000712903 281
546 3300005337 Ga0070682_100052554 Ga0070682_1000525543 281
547 3300005337 Ga0070682_100065673 Ga0070682_1000656732 281
548 3300005338 Ga0068868_100099747 Ga0068868_1000997472 281
549 3300005339 Ga0070660_100008149 Ga0070660_1000081499 281
550 3300005340 Ga0070689_100017892 Ga0070689_1000178922 281
551 3300005340 Ga0070689_100334725 Ga0070689_1003347251 281
552 3300005341 Ga0070691_10099365 Ga0070691_100993652 281
553 3300005345 Ga0070692_10038289 Ga0070692_100382892 281
554 3300005347 Ga0070668_100205677 Ga0070668_1002056772 281
555 3300005347 Ga0070668_100206043 Ga0070668_1002060432 281
556 3300005353 Ga0070669_100309655 Ga0070669_1003096552 281
557 3300005354 Ga0070675_100031711 Ga0070675_1000317115 281
558 3300005354 Ga0070675_100299488 Ga0070675_1002994882 281
559 3300005355 Ga0070671_100046486 Ga0070671_1000464862 281
560 3300005355 Ga0070671_100066413 Ga0070671_1000664132 281
561 3300005356 Ga0070674_100020746 Ga0070674_1000207464 281
562 3300005364 Ga0070673_100076592 Ga0070673_1000765922 281
563 3300005365 Ga0070688_100002230 Ga0070688_1000022305 281
564 3300005365 Ga0070688_100024170 Ga0070688_1000241703 281
565 3300005366 Ga0070659_100027432 Ga0070659_1000274324 281
566 3300005366 Ga0070659_100041371 Ga0070659_1000413712 281
567 3300005406 Ga0070703_10043087 Ga0070703_100430872 281
568 3300005437 Ga0070710_10006221 Ga0070710_100062212 281
569 3300005438 Ga0070701_10001690 Ga0070701_1000169010 281
570 3300005438 Ga0070701_10019121 Ga0070701_100191213 281
571 3300005439 Ga0070711_100024667 Ga0070711_1000246672 281
572 3300005440 Ga0070705_100006131 Ga0070705_1000061312 281
573 3300005441 Ga0070700_100024024 Ga0070700_1000240243 281
574 3300005444 Ga0070694_100084676 Ga0070694_1000846762 281
575 3300005445 Ga0070708_100271269 Ga0070708_1002712692 281
576 3300005455 Ga0070663_100044597 Ga0070663_1000445972 281
577 3300005455 Ga0070663_100423019 Ga0070663_1004230191 281
578 3300005456 Ga0070678_100005176 Ga0070678_1000051763 281
579 3300005456 Ga0070678_100131007 Ga0070678_1001310072 281
580 3300005456 Ga0070678_100299492 Ga0070678_1002994921 281
581 3300005457 Ga0070662_100217686 Ga0070662_1002176862 281
582 3300005458 Ga0070681_10063272 Ga0070681_100632723 281
583 3300005458 Ga0070681_10187659 Ga0070681_101876592 281
584 3300005459 Ga0068867_100008996 Ga0068867_1000089966 281
585 3300005466 Ga0070685_10004928 Ga0070685_100049283 281
586 3300005466 Ga0070685_10048036 Ga0070685_100480362 281
587 3300005466 Ga0070685_10164006 Ga0070685_101640062 281
588 3300005530 Ga0070679_100016335 Ga0070679_1000163354 281
589 3300005530 Ga0070679_100200684 Ga0070679_1002006841 281
590 3300005535 Ga0070684_100012640 Ga0070684_1000126403 281
591 3300005535 Ga0070684_100047123 Ga0070684_1000471233 281
592 3300005535 Ga0070684_100280420 Ga0070684_1002804202 281
593 3300005535 Ga0070684_100335151 Ga0070684_1003351512 281
594 3300005539 Ga0068853_100033528 Ga0068853_1000335283 281
595 3300005539 Ga0068853_100137441 Ga0068853_1001374412 281
596 3300005543 Ga0070672_100007417 Ga0070672_1000074175 281
597 3300005543 Ga0070672_100049726 Ga0070672_1000497263 281
598 3300005544 Ga0070686_100004397 Ga0070686_1000043974 281
599 3300005544 Ga0070686_100184335 Ga0070686_1001843352 281
600 3300005545 Ga0070695_100062788 Ga0070695_1000627883 281
601 3300005545 Ga0070695_100292790 Ga0070695_1002927902 281
602 3300005546 Ga0070696_100021632 Ga0070696_1000216322 281
603 3300005546 Ga0070696_100026616 Ga0070696_1000266163 281
604 3300005547 Ga0070693_100026230 Ga0070693_1000262303 281
605 3300005547 Ga0070693_100041337 Ga0070693_1000413372 281
606 3300005547 Ga0070693_100048036 Ga0070693_1000480362 281
607 3300005548 Ga0070665_100013838 Ga0070665_1000138383 281
608 3300005548 Ga0070665_100164820 Ga0070665_1001648202 281
609 3300005549 Ga0070704_100016783 Ga0070704_1000167832 281
610 3300005549 Ga0070704_100140215 Ga0070704_1001402152 281
611 3300005563 Ga0068855_100048007 Ga0068855_1000480075 281
612 3300005563 Ga0068855_100083606 Ga0068855_1000836064 281
613 3300005563 Ga0068855_100202442 Ga0068855_1002024422 281
614 3300005564 Ga0070664_100020852 Ga0070664_1000208523 281
615 3300005564 Ga0070664_100376370 Ga0070664_1003763702 281
616 3300005564 Ga0070664_100381033 Ga0070664_1003810332 281
617 3300005614 Ga0068856_100054765 Ga0068856_1000547654 281
618 3300005615 Ga0070702_100006703 Ga0070702_1000067032 281
619 3300005616 Ga0068852_100028872 Ga0068852_1000288724 281
620 3300005616 Ga0068852_100093451 Ga0068852_1000934513 281
621 3300005617 Ga0068859_100088640 Ga0068859_1000886403 281
622 3300005617 Ga0068859_100545656 Ga0068859_1005456561 281
623 3300005618 Ga0068864_100295216 Ga0068864_1002952161 281
624 3300005718 Ga0068866_10000945 Ga0068866_100009453 281
625 3300005718 Ga0068866_10108928 Ga0068866_101089282 281
626 3300005719 Ga0068861_100007991 Ga0068861_1000079912 281
627 3300005719 Ga0068861_100015257 Ga0068861_1000152575 281
628 3300005842 Ga0068858_100377297 Ga0068858_1003772972 281
629 3300005843 Ga0068860_100069185 Ga0068860_1000691853 281
630 3300005844 Ga0068862_100266282 Ga0068862_1002662821 281
631 3300005844 Ga0068862_100277846 Ga0068862_1002778462 281
632 3300005937 Ga0081455_10022031 Ga0081455_100220315 281
633 3300006058 Ga0075432_10001637 Ga0075432_100016373 281
634 3300006175 Ga0070712_100039004 Ga0070712_1000390042 281
635 3300006237 Ga0097621_100094573 Ga0097621_1000945732 281
636 3300006237 Ga0097621_100287279 Ga0097621_1002872792 281
637 3300006358 Ga0068871_100045501 Ga0068871_1000455012 281
638 3300006844 Ga0075428_100002460 Ga0075428_1000024606 281
639 3300006881 Ga0068865_100002502 Ga0068865_1000025027 281
640 3300006931 Ga0097620_100088640 Ga0097620_1000886402 281
641 3300006931 Ga0097620_100545686 Ga0097620_1005456862 281
642 3300009093 Ga0105240_10335611 Ga0105240_103356112 281
643 3300009093 Ga0105240_10536747 Ga0105240_105367472 281
644 3300009094 Ga0111539_10003095 Ga0111539_1000309522 281
645 3300009094 Ga0111539_10023166 Ga0111539_100231668 281
646 3300009098 Ga0105245_10008244 Ga0105245_100082447 281
647 3300009098 Ga0105245_10014910 Ga0105245_100149104 281
648 3300009098 Ga0105245_10038377 Ga0105245_100383772 281
649 3300009098 Ga0105245_10059555 Ga0105245_100595552 281
650 3300009098 Ga0105245_10769588 Ga0105245_107695881 281
651 3300009101 Ga0105247_10014762 Ga0105247_100147622 281
652 3300009101 Ga0105247_10065217 Ga0105247_100652172 281
653 3300009147 Ga0114129_10006073 Ga0114129_100060733 281
654 3300009148 Ga0105243_10068382 Ga0105243_100683822 281
655 3300009148 Ga0105243_10149932 Ga0105243_101499322 281
656 3300009148 Ga0105243_10286704 Ga0105243_102867042 281
657 3300009174 Ga0105241_10102020 Ga0105241_101020202 281
658 3300009176 Ga0105242_10011727 Ga0105242_100117274 281
659 3300009176 Ga0105242_10278983 Ga0105242_102789831 281
660 3300009177 Ga0105248_10010628 Ga0105248_1001062813 281
661 3300009177 Ga0105248_10186137 Ga0105248_101861372 281
662 3300009177 Ga0105248_10214289 Ga0105248_102142892 281
663 3300009545 Ga0105237_10238800 Ga0105237_102388002 281
664 3300009551 Ga0105238_10005763 Ga0105238_100057632 281
665 3300009553 Ga0105249_10005447 Ga0105249_100054473 281
666 3300009553 Ga0105249_10045346 Ga0105249_100453464 281
667 3300009553 Ga0105249_10148466 Ga0105249_101484662 281
668 3300010375 Ga0105239_10014335 Ga0105239_100143353 281
669 3300010375 Ga0105239_10205199 Ga0105239_102051993 281
670 3300011119 Ga0105246_10049280 Ga0105246_100492803 281
671 3300011119 Ga0105246_10181204 Ga0105246_101812042 281
672 3300012488 Ga0157343_1000626 Ga0157343_10006262 281
673 3300012515 Ga0157338_1001164 Ga0157338_10011641 281
674 3300013102 Ga0157371_10294468 Ga0157371_102944681 281
675 3300013105 Ga0157369_10044616 Ga0157369_100446163 281
676 3300013296 Ga0157374_10292555 Ga0157374_102925552 281
677 3300013297 Ga0157378_10004800 Ga0157378_100048005 281
678 3300013297 Ga0157378_10321430 Ga0157378_103214302 281
679 3300013306 Ga0163162_10009912 Ga0163162_100099123 281
680 3300013306 Ga0163162_10058659 Ga0163162_100586593 281
681 3300013306 Ga0163162_10154976 Ga0163162_101549762 281
682 3300013307 Ga0157372_10020936 Ga0157372_100209363 281
683 3300013307 Ga0157372_10045204 Ga0157372_100452042 281
684 3300013308 Ga0157375_10068190 Ga0157375_100681903 281
685 3300013308 Ga0157375_10073531 Ga0157375_100735314 281
686 3300014326 Ga0157380_10033532 Ga0157380_100335321 281
687 3300014326 Ga0157380_10258709 Ga0157380_102587091 281
688 3300014326 Ga0157380_10281553 Ga0157380_102815532 281
689 3300014968 Ga0157379_10081001 Ga0157379_100810012 281
690 3300014968 Ga0157379_10132878 Ga0157379_101328782 281
691 3300014969 Ga0157376_10003894 Ga0157376_100038945 281
692 3300014969 Ga0157376_10037240 Ga0157376_100372404 281
693 3300017792 Ga0163161_10031897 Ga0163161_100318972 281
694 3300017792 Ga0163161_10461712 Ga0163161_104617121 281
695 3300025315 Ga0207697_10049155 Ga0207697_100491552 281
696 3300025893 Ga0207682_10042232 Ga0207682_100422322 281
697 3300025898 Ga0207692_10015358 Ga0207692_100153584 281
698 3300025899 Ga0207642_10003172 Ga0207642_100031724 281
699 3300025899 Ga0207642_10121729 Ga0207642_101217292 281
700 3300025900 Ga0207710_10037637 Ga0207710_100376372 281
701 3300025901 Ga0207688_10048436 Ga0207688_100484362 281
702 3300025901 Ga0207688_10252472 Ga0207688_102524722 281
703 3300025903 Ga0207680_10010499 Ga0207680_100104992 281
704 3300025904 Ga0207647_10061628 Ga0207647_100616282 281
705 3300025907 Ga0207645_10018402 Ga0207645_100184025 281
706 3300025908 Ga0207643_10098383 Ga0207643_100983832 281
707 3300025911 Ga0207654_10107939 Ga0207654_101079392 281
708 3300025912 Ga0207707_10088830 Ga0207707_100888303 281
709 3300025914 Ga0207671_10212620 Ga0207671_102126202 281
710 3300025916 Ga0207663_10035150 Ga0207663_100351502 281
711 3300025917 Ga0207660_10032137 Ga0207660_100321372 281
712 3300025919 Ga0207657_10016444 Ga0207657_100164443 281
713 3300025920 Ga0207649_10172437 Ga0207649_101724372 281
714 3300025921 Ga0207652_10172028 Ga0207652_101720282 281
715 3300025921 Ga0207652_10339799 Ga0207652_103397992 281
716 3300025922 Ga0207646_10392131 Ga0207646_103921311 281
717 3300025923 Ga0207681_10369591 Ga0207681_103695912 281
718 3300025926 Ga0207659_10097825 Ga0207659_100978252 281
719 3300025927 Ga0207687_10064773 Ga0207687_100647733 281
720 3300025927 Ga0207687_10093370 Ga0207687_100933702 281
721 3300025927 Ga0207687_10467578 Ga0207687_104675781 281
722 3300025931 Ga0207644_10124071 Ga0207644_101240712 281
723 3300025931 Ga0207644_10363081 Ga0207644_103630812 281
724 3300025932 Ga0207690_10030289 Ga0207690_100302892 281
725 3300025932 Ga0207690_10303344 Ga0207690_103033442 281
726 3300025934 Ga0207686_10017939 Ga0207686_100179392 281
727 3300025935 Ga0207709_10001613 Ga0207709_100016136 281
728 3300025935 Ga0207709_10064132 Ga0207709_100641322 281
729 3300025935 Ga0207709_10250800 Ga0207709_102508001 281
730 3300025936 Ga0207670_10048290 Ga0207670_100482903 281
731 3300025937 Ga0207669_10014513 Ga0207669_100145132 281
732 3300025937 Ga0207669_10033865 Ga0207669_100338652 281
733 3300025938 Ga0207704_10007273 Ga0207704_100072732 281
734 3300025939 Ga0207665_10027095 Ga0207665_100270952 281
735 3300025940 Ga0207691_10014462 Ga0207691_100144625 281
736 3300025941 Ga0207711_10079577 Ga0207711_100795772 281
737 3300025941 Ga0207711_10130483 Ga0207711_101304832 281
738 3300025941 Ga0207711_10236847 Ga0207711_102368472 281
739 3300025942 Ga0207689_10025253 Ga0207689_100252533 281
740 3300025944 Ga0207661_10003730 Ga0207661_100037307 281
741 3300025944 Ga0207661_10298500 Ga0207661_102985002 281
742 3300025949 Ga0207667_10057030 Ga0207667_100570302 281
743 3300025949 Ga0207667_10125801 Ga0207667_101258012 281
744 3300025960 Ga0207651_10185890 Ga0207651_101858902 281
745 3300025961 Ga0207712_10057529 Ga0207712_100575293 281
746 3300025961 Ga0207712_10333984 Ga0207712_103339842 281
747 3300025972 Ga0207668_10019407 Ga0207668_100194074 281
748 3300025972 Ga0207668_10268999 Ga0207668_102689992 281
749 3300025981 Ga0207640_10127781 Ga0207640_101277812 281
750 3300026035 Ga0207703_10457330 Ga0207703_104573302 281
751 3300026067 Ga0207678_10010413 Ga0207678_100104137 281
752 3300026067 Ga0207678_10015965 Ga0207678_100159652 281
753 3300026075 Ga0207708_10005846 Ga0207708_100058462 281
754 3300026078 Ga0207702_10108008 Ga0207702_101080082 281
755 3300026089 Ga0207648_10000214 Ga0207648_1000021457 281
756 3300026095 Ga0207676_10266979 Ga0207676_102669792 281
757 3300026118 Ga0207675_100003071 Ga0207675_10000307115 281
758 3300026118 Ga0207675_100012690 Ga0207675_1000126904 281
759 3300026121 Ga0207683_10039127 Ga0207683_100391273 281
760 3300026121 Ga0207683_10143973 Ga0207683_101439731 281
761 3300026142 Ga0207698_10032256 Ga0207698_100322563 281
762 3300026142 Ga0207698_10033236 Ga0207698_100332364 281
763 3300027907 Ga0207428_10000108 Ga0207428_10000108113 281
764 3300027907 Ga0207428_10026324 Ga0207428_100263242 281
765 3300028379 Ga0268266_10289439 Ga0268266_102894392 281
766 3300028380 Ga0268265_10217053 Ga0268265_102170532 281
767 3300028381 Ga0268264_10068857 Ga0268264_100688572 281
768 3300028381 Ga0268264_10191505 Ga0268264_101915052 281
769 3300031995 Ga0307409_100342001 Ga0307409_1003420011 281
770 3300032002 Ga0307416_100024078 Ga0307416_1000240784 281
771 3300032126 Ga0307415_100013991 Ga0307415_1000139915 281
772 3300035092 Ga0373952_0015967 Ga0373952_0015967_73_942 281
773 3300035114 Ga0373939_0016486 Ga0373939_0016486_646_1515 281
774 3300035207 Ga0373942_0043368 Ga0373942_0043368_24_893 281
775 3300035241 Ga0373961_0021072 Ga0373961_0021072_750_1619 281
776 3300035242 Ga0373962_0021485 Ga0373962_0021485_530_1399 281
777 3300037312 Ga0395899_0042994 Ga0395899_0042994_1025_1906 281
778 3300037418 Ga0395900_0054097 Ga0395900_0054097_2237_3118 281
779 3300037466 Ga0395898_0103317 Ga0395898_0103317_1026_1907 281
780 3300037466 Ga0395898_0119162 Ga0395898_0119162_566_1447 281
781 3300037466 Ga0395898_0450519 Ga0395898_0450519_181_1062 281
782 3300037471 Ga0395905_0085783 Ga0395905_0085783_1586_2467 281
783 3300038443 Ga0395901_0044840 Ga0395901_0044840_1936_2817 281
784 3300038443 Ga0395901_0085829 Ga0395901_0085829_109_990 281
785 3300042122 Ga0450920_000491 Ga0450920_000491_1671_2540 281
786 3300046491 Ga0495584_0027885 Ga0495584_0027885_1399_2280 281
787 3300046492 Ga0495585_0128157 Ga0495585_0128157_349_1230 281
788 3300046500 Ga0495596_0072612 Ga0495596_0072612_314_1195 281
789 3300046518 Ga0495631_0034955 Ga0495631_0034955_1080_1949 281
790 3300046525 Ga0495663_0016516 Ga0495663_0016516_386_1267 281
791 3300046531 Ga0495665_0056235 Ga0495665_0056235_1169_2050 281
792 3300046538 Ga0495609_0091798 Ga0495609_0091798_245_1126 281
793 3300046616 Ga0495668_0144101 Ga0495668_0144101_82_963 281
794 3300046648 Ga0495611_0125745 Ga0495611_0125745_210_1091 281
795 3300046674 Ga0495588_0041439 Ga0495588_0041439_1402_2283 281
796 3300046684 Ga0495669_0123716 Ga0495669_0123716_319_1188 281
797 3300046689 Ga0495613_0193661 Ga0495613_0193661_413_1294 281
798 3300046691 Ga0495670_0116129 Ga0495670_0116129_315_1184 281
799 3300046794 Ga0495589_0078952 Ga0495589_0078952_273_1142 281
800 3300046810 Ga0495660_0172388 Ga0495660_0172388_16_885 281
801 3300047315 Ga0495581_0008654 Ga0495581_0008654_2408_3289 281
802 3300047445 Ga0495677_0022339 Ga0495677_0022339_1026_1907 281
803 3300048903 Ga0496100_0058927 Ga0496100_0058927_792_1673 281
804 3300048903 Ga0496100_0165704 Ga0496100_0165704_552_1421 281
805 3300048904 Ga0496101_0046958 Ga0496101_0046958_1240_2121 281
806 3300048904 Ga0496101_0074055 Ga0496101_0074055_101_970 281
807 3300048906 Ga0496103_0001117 Ga0496103_0001117_9657_10538 281
808 3300048906 Ga0496103_0172792 Ga0496103_0172792_395_1264 281
809 3300048907 Ga0496104_0096621 Ga0496104_0096621_1556_2425 281
810 3300048908 Ga0496105_0113308 Ga0496105_0113308_419_1288 281
811 3300048908 Ga0496105_0149011 Ga0496105_0149011_1016_1885 281
812 3300048909 Ga0496106_0007876 Ga0496106_0007876_3494_4375 281
813 3300048910 Ga0496107_0004691 Ga0496107_0004691_1478_2359 281
814 3300048911 Ga0496108_0017228 Ga0496108_0017228_3857_4726 281
815 3300048911 Ga0496108_0042580 Ga0496108_0042580_1772_2641 281
816 3300048911 Ga0496108_0065142 Ga0496108_0065142_1868_2746 281
817 3300048911 Ga0496108_0316451 Ga0496108_0316451_39_908 281
818 3300048912 Ga0496109_0008936 Ga0496109_0008936_3607_4485 281
819 3300048912 Ga0496109_0015494 Ga0496109_0015494_1055_1924 281
820 3300048912 Ga0496109_0047598 Ga0496109_0047598_907_1776 281
821 3300048912 Ga0496109_0224547 Ga0496109_0224547_341_1210 281
822 3300048913 Ga0496110_0002271 Ga0496110_0002271_3249_4127 281
823 3300048913 Ga0496110_0024600 Ga0496110_0024600_1263_2132 281
824 3300048914 Ga0496111_0004301 Ga0496111_0004301_5087_5965 281
825 3300048914 Ga0496111_0008368 Ga0496111_0008368_675_1544 281
826 3300048915 Ga0496112_0111162 Ga0496112_0111162_620_1498 281
827 3300048915 Ga0496112_0148667 Ga0496112_0148667_1332_2201 281
828 3300048916 Ga0496113_0012986 Ga0496113_0012986_1330_2199 281
829 3300048916 Ga0496113_0420546 Ga0496113_0420546_192_1061 281
830 3300048917 Ga0496114_0001492 Ga0496114_0001492_3019_3900 281
831 3300048917 Ga0496114_0267204 Ga0496114_0267204_45_914 281
832 3300048918 Ga0496115_0020149 Ga0496115_0020149_2513_3394 281
833 3300049572 Ga0501036_0113383 Ga0501036_0113383_598_1467 281
834 3300049574 Ga0501038_0072433 Ga0501038_0072433_1274_2143 281
835 3300049575 Ga0501039_0027456 Ga0501039_0027456_2371_3240 281
836 3300049577 Ga0501041_0041960 Ga0501041_0041960_1071_1940 281
837 3300049578 Ga0501042_0010629 Ga0501042_0010629_1613_2482 281
838 3300049580 Ga0501046_0051136 Ga0501046_0051136_1583_2452 281
839 3300049584 Ga0501068_0127412 Ga0501068_0127412_63_932 281
840 3300049586 Ga0501070_0117029 Ga0501070_0117029_804_1673 281
841 3300049587 Ga0501071_0000851 Ga0501071_0000851_804_1673 281
842 3300049588 Ga0501072_0007485 Ga0501072_0007485_5774_6643 281
843 3300049591 Ga0501075_0044049 Ga0501075_0044049_1362_2231 281
844 3300049592 Ga0501076_0000358 Ga0501076_0000358_26170_27039 281
845 3300049593 Ga0501077_0018701 Ga0501077_0018701_2155_3024 281
846 3300049742 Ga0501080_0032874 Ga0501080_0032874_2637_3506 281
847 3300049743 Ga0501081_0006931 Ga0501081_0006931_1756_2625 281
848 3300049744 Ga0501083_0011606 Ga0501083_0011606_4391_5260 281
849 3300049822 Ga0501035_0207517 Ga0501035_0207517_157_1026 281
850 3300050507 nmdc:mga05p37_10918_c1 nmdc:mga05p37_10918_c1_3413_4282 281
851 3300050508 nmdc:mga09592_4343_c1 nmdc:mga09592_4343_c1_5731_6600 281
852 3300050511 nmdc:mga08y16_13085_c1 nmdc:mga08y16_13085_c1_6797_7666 281
853 3300050511 nmdc:mga08y16_7593_c1 nmdc:mga08y16_7593_c1_6194_7063 281
854 3300050512 nmdc:mga0n895_602480_c1 nmdc:mga0n895_602480_c1_55_924 281
855 3300050515 nmdc:mga0a205_16103_c2 nmdc:mga0a205_16103_c2_4069_4938 281
856 3300054114 Ga0501084_0000537 Ga0501084_0000537_1373_2242 281
857 3300060353 Ga0501082_0034450 Ga0501082_0034450_2061_2930 281
858 3300061734 Ga0530510_0017961 Ga0530510_0017961_1390_2259 281
859 3300061734 Ga0530510_0053577 Ga0530510_0053577_1121_1990 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

114

300

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.867 81 269
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.8651 81 270
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.8114 80 269
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7798 73 264
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7778 70 272
ID Description Score Start End Superfamily
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8955 74 270 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8934 74 270 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8812 75 269 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8769 74 275 1.10.3720.10
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.874 74 270 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A6N8VV98-F1-model_v4 ABC transporter permease 0.946 12 274 GO:0005886
GO:0055085
AF-A0A7V8BXH3-F1-model_v4 ABC transporter permease 0.9384 15 279 GO:0005886
GO:0055085
AF-A0A7M2YVS5-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system permease component 0.9336 15 281 GO:0005886
GO:0055085
AF-A0A2V7I453-F1-model_v4 ABC transporter permease 0.933 29 277 GO:0005886
GO:0055085
AF-A0A2V7E7I1-F1-model_v4 ABC transporter permease 0.9303 49 272 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
82.57 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map