F483783
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 859 | 456 | 1718 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300035695|Ga0373927_0026775|Ga0373927_0026775_919_1860 |
| Length | 313 |
| Sequence | VAPVPGNPSSHAFIKNEAYMRPESLPTSDVIGLTKTAPLSRRGFMTASAAVAAGYTLAAGPVRADVIKTNTNGLTAGDARIKVADGEMPGYFARPANAANPPVVLVAMEIFGLHEYIRDVARRLAKLGAFAVAPDYYFRKGDLTRITDIPQLLPLVNAKPDAELLSDLDSTVAWAKSQGADTSRLGIIGFCRGGRTVWEYAAHSPALKAGAAFYGPPVDPPNPLWPKSPMQLAPEMKAAVIGLYGEADSGIPVAQVEAFKAALAANNKTAEFKIYPGAPHGFHADYRASYRKDAAEDAWNQMQAWFRKYGVLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 155 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 160 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 171 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 172 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 177 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 200 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 201 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 202 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 203 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 293 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 294 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 295 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 296 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 321 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 322 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 333 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 336 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 339 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 340 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 342 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 343 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 344 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 345 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 347 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 348 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 350 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 351 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 352 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 354 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 355 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 356 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 358 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 359 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 360 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 362 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 365 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 366 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 368 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 370 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 371 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 372 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 373 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 374 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 375 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 376 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 377 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 378 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 379 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 380 | 2791355199 | |||
| 381 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 382 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 383 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 384 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 385 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 386 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 387 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 388 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 389 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 390 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 391 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 392 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 393 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 394 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 395 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 396 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 397 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 398 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 399 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 400 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 401 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 402 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 403 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 404 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 405 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 406 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 407 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 408 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 409 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 410 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 411 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 412 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 413 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 414 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 415 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 416 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 417 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 418 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 419 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 420 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 421 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 422 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 423 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 424 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 425 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 426 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 427 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 428 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 429 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 430 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 431 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 432 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 433 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 434 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 435 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 436 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 437 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 438 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 439 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 440 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 441 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 442 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 443 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 444 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 445 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 446 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 447 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 448 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 449 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 450 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 451 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 452 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 453 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 454 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 455 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 456 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.74 |
| Metatranscriptomes | 0.12 |
| Isolates | 10.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.13 |
| Nodule | 8.73 |
| Rhizoplane | 5.7 |
| Rhizosphere | 67.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373927_0026775 | 3300035695 | Bacteria | 3768 |
| 2 | LJQas_1014668 | 3300000549 | Bacteria | 919 |
| 3 | JGI24739J22299_10016256 | 3300001989 | Bacteria | 2695 |
| 4 | JGI25406J46586_10000165 | 3300003203 | Bacteria | 29331 |
| 5 | JGI25165J46597_1006630 | 3300003214 | Bacteria | 2029 |
| 6 | JGI25153J46596_10000575 | 3300003215 | Bacteria | 22652 |
| 7 | Ga0055525_1004330 | 3300003759 | Bacteria | 1224 |
| 8 | Ga0070658_10099672 | 3300005327 | Bacteria | 2400 |
| 9 | Ga0070683_100043524 | 3300005329 | Bacteria | 4138 |
| 10 | Ga0068869_100057695 | 3300005334 | Bacteria | 2835 |
| 11 | Ga0068869_100074094 | 3300005334 | Bacteria | 2526 |
| 12 | Ga0070680_100015252 | 3300005336 | Bacteria | 6020 |
| 13 | Ga0070680_100187112 | 3300005336 | Bacteria | 1744 |
| 14 | Ga0070682_100342676 | 3300005337 | Bacteria | 1111 |
| 15 | Ga0068868_100062156 | 3300005338 | Bacteria | 2959 |
| 16 | Ga0070660_100045327 | 3300005339 | Bacteria | 3365 |
| 17 | Ga0070660_100081978 | 3300005339 | Bacteria | 2532 |
| 18 | Ga0070660_100195360 | 3300005339 | Bacteria | 1640 |
| 19 | Ga0070689_100098548 | 3300005340 | Bacteria | 2312 |
| 20 | Ga0070691_10025379 | 3300005341 | Bacteria | 2759 |
| 21 | Ga0070668_100012163 | 3300005347 | Bacteria | 6408 |
| 22 | Ga0070668_100164813 | 3300005347 | Bacteria | 1800 |
| 23 | Ga0070675_100085365 | 3300005354 | Bacteria | 2637 |
| 24 | Ga0070675_100181162 | 3300005354 | Bacteria | 1822 |
| 25 | Ga0070675_100374362 | 3300005354 | Bacteria | 1267 |
| 26 | Ga0070659_100009316 | 3300005366 | Bacteria | 7210 |
| 27 | Ga0070659_100042620 | 3300005366 | Bacteria | 3549 |
| 28 | Ga0070709_10000506 | 3300005434 | Bacteria | 23004 |
| 29 | Ga0070709_10006029 | 3300005434 | Bacteria | 6590 |
| 30 | Ga0070709_10008240 | 3300005434 | Bacteria | 5725 |
| 31 | Ga0070709_10018713 | 3300005434 | Bacteria | 3995 |
| 32 | Ga0070709_10139333 | 3300005434 | Bacteria | 1665 |
| 33 | Ga0070709_10174801 | 3300005434 | Bacteria | 1503 |
| 34 | Ga0070714_100001330 | 3300005435 | Bacteria | 17843 |
| 35 | Ga0070714_100016718 | 3300005435 | Bacteria | 5932 |
| 36 | Ga0070713_100005814 | 3300005436 | Bacteria | 8478 |
| 37 | Ga0070713_100023991 | 3300005436 | Bacteria | 4743 |
| 38 | Ga0070713_100031315 | 3300005436 | Bacteria | 4236 |
| 39 | Ga0070713_100158058 | 3300005436 | Bacteria | 2022 |
| 40 | Ga0070713_100358239 | 3300005436 | Bacteria | 1355 |
| 41 | Ga0070710_10000386 | 3300005437 | Bacteria | 20587 |
| 42 | Ga0070710_10002397 | 3300005437 | Bacteria | 8873 |
| 43 | Ga0070710_10012971 | 3300005437 | Bacteria | 4156 |
| 44 | Ga0070710_10062026 | 3300005437 | Bacteria | 2131 |
| 45 | Ga0070711_100001793 | 3300005439 | Bacteria | 11956 |
| 46 | Ga0070711_100011103 | 3300005439 | Bacteria | 5588 |
| 47 | Ga0070711_100172690 | 3300005439 | Bacteria | 1649 |
| 48 | Ga0070663_100014179 | 3300005455 | Bacteria | 5110 |
| 49 | Ga0070663_100171895 | 3300005455 | Bacteria | 1675 |
| 50 | Ga0070663_100280125 | 3300005455 | Bacteria | 1328 |
| 51 | Ga0070663_100409278 | 3300005455 | Bacteria | 1110 |
| 52 | Ga0070663_100412290 | 3300005455 | Bacteria | 1106 |
| 53 | Ga0070663_100511417 | 3300005455 | Bacteria | 999 |
| 54 | Ga0070678_100084575 | 3300005456 | Bacteria | 2415 |
| 55 | Ga0070662_100017516 | 3300005457 | Bacteria | 4832 |
| 56 | Ga0070681_10005340 | 3300005458 | Bacteria | 12402 |
| 57 | Ga0070679_100020251 | 3300005530 | Bacteria | 6483 |
| 58 | Ga0070679_100156183 | 3300005530 | Bacteria | 2256 |
| 59 | Ga0070684_100014216 | 3300005535 | Bacteria | 6440 |
| 60 | Ga0070684_100015972 | 3300005535 | Bacteria | 6131 |
| 61 | Ga0070684_100175465 | 3300005535 | Bacteria | 1948 |
| 62 | Ga0068853_100002345 | 3300005539 | Bacteria | 14158 |
| 63 | Ga0068853_100208048 | 3300005539 | Bacteria | 1782 |
| 64 | Ga0068853_100232611 | 3300005539 | Bacteria | 1686 |
| 65 | Ga0070695_100012117 | 3300005545 | Bacteria | 5168 |
| 66 | Ga0070695_100198632 | 3300005545 | Bacteria | 1432 |
| 67 | Ga0070696_100012886 | 3300005546 | Bacteria | 5612 |
| 68 | Ga0070693_100067557 | 3300005547 | Bacteria | 2096 |
| 69 | Ga0070693_100153420 | 3300005547 | Bacteria | 1461 |
| 70 | Ga0070693_100169874 | 3300005547 | Bacteria | 1396 |
| 71 | Ga0070665_100008978 | 3300005548 | Bacteria | 10129 |
| 72 | Ga0070665_100013701 | 3300005548 | Bacteria | 8159 |
| 73 | Ga0070665_100124385 | 3300005548 | Bacteria | 2581 |
| 74 | Ga0068855_100035619 | 3300005563 | Bacteria | 5928 |
| 75 | Ga0068855_100123641 | 3300005563 | Bacteria | 2960 |
| 76 | Ga0068855_100288104 | 3300005563 | Bacteria | 1821 |
| 77 | Ga0068855_100746804 | 3300005563 | Bacteria | 1044 |
| 78 | Ga0068857_100070074 | 3300005577 | Bacteria | 3123 |
| 79 | Ga0068856_100081355 | 3300005614 | Bacteria | 3213 |
| 80 | Ga0068856_100292181 | 3300005614 | Bacteria | 1647 |
| 81 | Ga0068852_100093823 | 3300005616 | Bacteria | 2691 |
| 82 | Ga0068852_100474740 | 3300005616 | Bacteria | 1242 |
| 83 | Ga0068859_100072274 | 3300005617 | Bacteria | 3486 |
| 84 | Ga0068859_100253602 | 3300005617 | Bacteria | 1850 |
| 85 | Ga0068859_100292654 | 3300005617 | Bacteria | 1721 |
| 86 | Ga0068859_100417629 | 3300005617 | Bacteria | 1438 |
| 87 | Ga0068864_100068900 | 3300005618 | Bacteria | 3075 |
| 88 | Ga0068864_100070379 | 3300005618 | Bacteria | 3044 |
| 89 | Ga0068864_100119978 | 3300005618 | Bacteria | 2350 |
| 90 | Ga0068866_10056185 | 3300005718 | Bacteria | 2024 |
| 91 | Ga0068866_10073276 | 3300005718 | Bacteria | 1817 |
| 92 | Ga0068861_100462217 | 3300005719 | Bacteria | 1139 |
| 93 | Ga0068851_10013247 | 3300005834 | Bacteria | 3901 |
| 94 | Ga0068851_10198901 | 3300005834 | Bacteria | 1118 |
| 95 | Ga0068863_100242522 | 3300005841 | Bacteria | 1739 |
| 96 | Ga0068863_100559712 | 3300005841 | Bacteria | 1129 |
| 97 | Ga0068858_100194812 | 3300005842 | Bacteria | 1915 |
| 98 | Ga0068858_100579361 | 3300005842 | Bacteria | 1087 |
| 99 | Ga0068860_100000113 | 3300005843 | Bacteria | 130939 |
| 100 | Ga0068860_100182768 | 3300005843 | Bacteria | 2027 |
| 101 | Ga0068862_100258680 | 3300005844 | Bacteria | 1588 |
| 102 | Ga0068862_100483497 | 3300005844 | Bacteria | 1172 |
| 103 | Ga0081455_10000073 | 3300005937 | Bacteria | 107386 |
| 104 | Ga0081455_10045667 | 3300005937 | Bacteria | 3809 |
| 105 | Ga0081455_10228340 | 3300005937 | Bacteria | 1375 |
| 106 | Ga0081540_1001713 | 3300005983 | Bacteria | 18555 |
| 107 | Ga0081540_1003381 | 3300005983 | Bacteria | 12649 |
| 108 | Ga0081540_1048857 | 3300005983 | Bacteria | 2115 |
| 109 | Ga0081540_1062999 | 3300005983 | Bacteria | 1757 |
| 110 | Ga0081539_10000255 | 3300005985 | Bacteria | 123054 |
| 111 | Ga0081539_10119056 | 3300005985 | Bacteria | 1315 |
| 112 | Ga0070717_10019185 | 3300006028 | Bacteria | 5359 |
| 113 | Ga0070717_10416774 | 3300006028 | Bacteria | 1208 |
| 114 | Ga0070717_10512402 | 3300006028 | Bacteria | 1085 |
| 115 | Ga0075365_10017869 | 3300006038 | Bacteria | 4350 |
| 116 | Ga0075365_10101915 | 3300006038 | Bacteria | 1966 |
| 117 | Ga0075365_10142235 | 3300006038 | Bacteria | 1665 |
| 118 | Ga0075365_10365871 | 3300006038 | Bacteria | 1017 |
| 119 | Ga0075368_10001310 | 3300006042 | Bacteria | 7875 |
| 120 | Ga0075368_10053169 | 3300006042 | Bacteria | 1612 |
| 121 | Ga0075364_10034559 | 3300006051 | Bacteria | 3262 |
| 122 | Ga0075364_10094518 | 3300006051 | Bacteria | 1986 |
| 123 | Ga0075364_10094907 | 3300006051 | Bacteria | 1982 |
| 124 | Ga0070715_10072552 | 3300006163 | Bacteria | 1541 |
| 125 | Ga0070716_100013305 | 3300006173 | Bacteria | 4192 |
| 126 | Ga0070716_100188851 | 3300006173 | Bacteria | 1359 |
| 127 | Ga0070716_100369146 | 3300006173 | Bacteria | 1022 |
| 128 | Ga0070712_100008029 | 3300006175 | Bacteria | 6620 |
| 129 | Ga0070712_100051745 | 3300006175 | Bacteria | 2862 |
| 130 | Ga0070712_100458632 | 3300006175 | Bacteria | 1062 |
| 131 | Ga0075362_10057914 | 3300006177 | Bacteria | 1747 |
| 132 | Ga0075362_10152772 | 3300006177 | Bacteria | 1108 |
| 133 | Ga0075367_10104468 | 3300006178 | Bacteria | 1734 |
| 134 | Ga0075366_10024997 | 3300006195 | Bacteria | 3485 |
| 135 | Ga0097621_100132585 | 3300006237 | Bacteria | 2122 |
| 136 | Ga0097621_100189042 | 3300006237 | Bacteria | 1782 |
| 137 | Ga0075370_10016014 | 3300006353 | Bacteria | 4027 |
| 138 | Ga0075370_10020457 | 3300006353 | Bacteria | 3618 |
| 139 | Ga0075370_10021827 | 3300006353 | Bacteria | 3509 |
| 140 | Ga0068871_100056998 | 3300006358 | Bacteria | 3177 |
| 141 | Ga0068871_100219258 | 3300006358 | Bacteria | 1647 |
| 142 | Ga0075428_100109095 | 3300006844 | Bacteria | 3016 |
| 143 | Ga0075431_100449789 | 3300006847 | Bacteria | 1284 |
| 144 | Ga0075433_10004563 | 3300006852 | Bacteria | 10805 |
| 145 | Ga0075433_10202065 | 3300006852 | Bacteria | 1767 |
| 146 | Ga0075434_100088516 | 3300006871 | Bacteria | 3097 |
| 147 | Ga0075434_100101368 | 3300006871 | Unclassified | 2886 |
| 148 | Ga0097620_100072273 | 3300006931 | Bacteria | 3486 |
| 149 | Ga0097620_100253598 | 3300006931 | Bacteria | 1850 |
| 150 | Ga0097620_100292652 | 3300006931 | Bacteria | 1721 |
| 151 | Ga0097620_100417601 | 3300006931 | Bacteria | 1438 |
| 152 | Ga0075435_100189830 | 3300007076 | Bacteria | 1739 |
| 153 | Ga0075435_100542071 | 3300007076 | Bacteria | 1007 |
| 154 | Ga0099795_10007573 | 3300007788 | Bacteria | 3039 |
| 155 | Ga0099795_10027421 | 3300007788 | Bacteria | 1927 |
| 156 | Ga0105240_10009596 | 3300009093 | Bacteria | 13695 |
| 157 | Ga0105240_10545065 | 3300009093 | Bacteria | 1284 |
| 158 | Ga0111539_10377139 | 3300009094 | Bacteria | 1651 |
| 159 | Ga0105245_10618114 | 3300009098 | Bacteria | 1111 |
| 160 | Ga0105247_10001533 | 3300009101 | Bacteria | 16497 |
| 161 | Ga0105247_10026061 | 3300009101 | Bacteria | 3529 |
| 162 | Ga0105247_10058271 | 3300009101 | Bacteria | 2389 |
| 163 | Ga0105247_10079986 | 3300009101 | Bacteria | 2058 |
| 164 | Ga0105247_10155475 | 3300009101 | Bacteria | 1510 |
| 165 | Ga0114129_10028043 | 3300009147 | Bacteria | 7976 |
| 166 | Ga0105241_10010784 | 3300009174 | Bacteria | 6704 |
| 167 | Ga0105241_10010832 | 3300009174 | Bacteria | 6689 |
| 168 | Ga0105241_10232469 | 3300009174 | Bacteria | 1555 |
| 169 | Ga0105248_10055495 | 3300009177 | Bacteria | 4444 |
| 170 | Ga0105248_10428425 | 3300009177 | Bacteria | 1490 |
| 171 | Ga0105248_10714848 | 3300009177 | Bacteria | 1130 |
| 172 | Ga0105237_10035699 | 3300009545 | Bacteria | 5029 |
| 173 | Ga0105237_10106355 | 3300009545 | Bacteria | 2798 |
| 174 | Ga0105237_10366550 | 3300009545 | Bacteria | 1445 |
| 175 | Ga0105237_10614960 | 3300009545 | Bacteria | 1093 |
| 176 | Ga0105238_10009724 | 3300009551 | Bacteria | 9628 |
| 177 | Ga0105238_10015814 | 3300009551 | Bacteria | 7638 |
| 178 | Ga0105238_10044871 | 3300009551 | Bacteria | 4467 |
| 179 | Ga0105238_10169211 | 3300009551 | Bacteria | 2161 |
| 180 | Ga0105238_10242621 | 3300009551 | Bacteria | 1779 |
| 181 | Ga0099796_10003294 | 3300010159 | Bacteria | 3722 |
| 182 | Ga0099796_10007064 | 3300010159 | Bacteria | 2915 |
| 183 | Ga0105239_10011556 | 3300010375 | Bacteria | 9849 |
| 184 | Ga0105239_10066307 | 3300010375 | Bacteria | 3966 |
| 185 | Ga0105239_10084806 | 3300010375 | Bacteria | 3490 |
| 186 | Ga0105239_10144508 | 3300010375 | Bacteria | 2652 |
| 187 | Ga0105246_10195447 | 3300011119 | Bacteria | 1569 |
| 188 | Ga0157371_10023272 | 3300013102 | Bacteria | 4530 |
| 189 | Ga0157370_10088570 | 3300013104 | Bacteria | 2907 |
| 190 | Ga0157369_10034285 | 3300013105 | Bacteria | 5572 |
| 191 | Ga0157374_10062976 | 3300013296 | Bacteria | 3478 |
| 192 | Ga0163162_10189496 | 3300013306 | Bacteria | 2184 |
| 193 | Ga0163162_10343215 | 3300013306 | Bacteria | 1626 |
| 194 | Ga0157372_10154390 | 3300013307 | Bacteria | 2651 |
| 195 | Ga0157372_10206070 | 3300013307 | Bacteria | 2279 |
| 196 | Ga0157375_10169282 | 3300013308 | Bacteria | 2331 |
| 197 | Ga0163163_10028321 | 3300014325 | Bacteria | 5377 |
| 198 | Ga0163163_10031629 | 3300014325 | Bacteria | 5108 |
| 199 | Ga0163163_10044799 | 3300014325 | Bacteria | 4341 |
| 200 | Ga0163163_10883568 | 3300014325 | Bacteria | 957 |
| 201 | Ga0157376_10389523 | 3300014969 | Bacteria | 1344 |
| 202 | Ga0228598_1028294 | 3300024227 | Bacteria | 1103 |
| 203 | Ga0209563_105637 | 3300025230 | Bacteria | 2240 |
| 204 | Ga0209677_101030 | 3300025253 | Bacteria | 13283 |
| 205 | Ga0209233_1001936 | 3300025261 | Bacteria | 7895 |
| 206 | Ga0209758_1004964 | 3300025297 | Bacteria | 10643 |
| 207 | Ga0209758_1011448 | 3300025297 | Bacteria | 5138 |
| 208 | Ga0207426_1017410 | 3300025302 | Bacteria | 2555 |
| 209 | Ga0209257_1025055 | 3300025304 | Bacteria | 2048 |
| 210 | Ga0207656_10009757 | 3300025321 | Bacteria | 3570 |
| 211 | Ga0207696_1056267 | 3300025711 | Bacteria | 1114 |
| 212 | Ga0207682_10066293 | 3300025893 | Bacteria | 1521 |
| 213 | Ga0207692_10002116 | 3300025898 | Bacteria | 7577 |
| 214 | Ga0207692_10020587 | 3300025898 | Bacteria | 3003 |
| 215 | Ga0207692_10045204 | 3300025898 | Bacteria | 2201 |
| 216 | Ga0207692_10064618 | 3300025898 | Bacteria | 1906 |
| 217 | Ga0207710_10013025 | 3300025900 | Bacteria | 3504 |
| 218 | Ga0207647_10003775 | 3300025904 | Bacteria | 11329 |
| 219 | Ga0207685_10001134 | 3300025905 | Bacteria | 5315 |
| 220 | Ga0207685_10133598 | 3300025905 | Bacteria | 1104 |
| 221 | Ga0207699_10000315 | 3300025906 | Bacteria | 25846 |
| 222 | Ga0207699_10166481 | 3300025906 | Bacteria | 1471 |
| 223 | Ga0207699_10204089 | 3300025906 | Bacteria | 1341 |
| 224 | Ga0207643_10051800 | 3300025908 | Bacteria | 2330 |
| 225 | Ga0207705_10070646 | 3300025909 | Bacteria | 2531 |
| 226 | Ga0207654_10061873 | 3300025911 | Bacteria | 2192 |
| 227 | Ga0207707_10000852 | 3300025912 | Bacteria | 29744 |
| 228 | Ga0207707_10020269 | 3300025912 | Bacteria | 5805 |
| 229 | Ga0207707_10021472 | 3300025912 | Bacteria | 5644 |
| 230 | Ga0207695_10089162 | 3300025913 | Bacteria | 3102 |
| 231 | Ga0207671_10021759 | 3300025914 | Bacteria | 4860 |
| 232 | Ga0207671_10033060 | 3300025914 | Bacteria | 3850 |
| 233 | Ga0207671_10048218 | 3300025914 | Bacteria | 3153 |
| 234 | Ga0207671_10151137 | 3300025914 | Bacteria | 1794 |
| 235 | Ga0207693_10001315 | 3300025915 | Bacteria | 22038 |
| 236 | Ga0207693_10003192 | 3300025915 | Bacteria | 14084 |
| 237 | Ga0207693_10044175 | 3300025915 | Bacteria | 3502 |
| 238 | Ga0207693_10068492 | 3300025915 | Bacteria | 2778 |
| 239 | Ga0207693_10074227 | 3300025915 | Bacteria | 2663 |
| 240 | Ga0207693_10220871 | 3300025915 | Bacteria | 1489 |
| 241 | Ga0207663_10004589 | 3300025916 | Bacteria | 6882 |
| 242 | Ga0207663_10035391 | 3300025916 | Bacteria | 2995 |
| 243 | Ga0207663_10189769 | 3300025916 | Bacteria | 1475 |
| 244 | Ga0207663_10222720 | 3300025916 | Bacteria | 1373 |
| 245 | Ga0207663_10242632 | 3300025916 | Bacteria | 1322 |
| 246 | Ga0207660_10035846 | 3300025917 | Bacteria | 3446 |
| 247 | Ga0207662_10248026 | 3300025918 | Bacteria | 1168 |
| 248 | Ga0207657_10001809 | 3300025919 | Bacteria | 23060 |
| 249 | Ga0207657_10069596 | 3300025919 | Bacteria | 2985 |
| 250 | Ga0207657_10117682 | 3300025919 | Bacteria | 2188 |
| 251 | Ga0207652_10024173 | 3300025921 | Bacteria | 5039 |
| 252 | Ga0207652_10054223 | 3300025921 | Bacteria | 3446 |
| 253 | Ga0207652_10278323 | 3300025921 | Bacteria | 1509 |
| 254 | Ga0207694_10109458 | 3300025924 | Bacteria | 2197 |
| 255 | Ga0207694_10309257 | 3300025924 | Bacteria | 1302 |
| 256 | Ga0207650_10035414 | 3300025925 | Bacteria | 3625 |
| 257 | Ga0207687_10420633 | 3300025927 | Bacteria | 1103 |
| 258 | Ga0207700_10012197 | 3300025928 | Bacteria | 5529 |
| 259 | Ga0207700_10028958 | 3300025928 | Bacteria | 3903 |
| 260 | Ga0207700_10042385 | 3300025928 | Bacteria | 3336 |
| 261 | Ga0207700_10096591 | 3300025928 | Bacteria | 2346 |
| 262 | Ga0207700_10153428 | 3300025928 | Bacteria | 1906 |
| 263 | Ga0207664_10009598 | 3300025929 | Bacteria | 6799 |
| 264 | Ga0207664_10031373 | 3300025929 | Bacteria | 4065 |
| 265 | Ga0207664_10155779 | 3300025929 | Bacteria | 1945 |
| 266 | Ga0207664_10163631 | 3300025929 | Bacteria | 1899 |
| 267 | Ga0207690_10017589 | 3300025932 | Bacteria | 4369 |
| 268 | Ga0207690_10198749 | 3300025932 | Bacteria | 1521 |
| 269 | Ga0207690_10213028 | 3300025932 | Bacteria | 1474 |
| 270 | Ga0207706_10153068 | 3300025933 | Bacteria | 2028 |
| 271 | Ga0207670_10075306 | 3300025936 | Bacteria | 2346 |
| 272 | Ga0207669_10008544 | 3300025937 | Bacteria | 4815 |
| 273 | Ga0207704_10262480 | 3300025938 | Bacteria | 1303 |
| 274 | Ga0207665_10001125 | 3300025939 | Bacteria | 17981 |
| 275 | Ga0207665_10002700 | 3300025939 | Bacteria | 11896 |
| 276 | Ga0207665_10113175 | 3300025939 | Bacteria | 1909 |
| 277 | Ga0207689_10020170 | 3300025942 | Bacteria | 5615 |
| 278 | Ga0207689_10145801 | 3300025942 | Bacteria | 1950 |
| 279 | Ga0207679_10084232 | 3300025945 | Bacteria | 2439 |
| 280 | Ga0207679_10617280 | 3300025945 | Bacteria | 978 |
| 281 | Ga0207667_10160532 | 3300025949 | Bacteria | 2312 |
| 282 | Ga0207667_10198924 | 3300025949 | Bacteria | 2056 |
| 283 | Ga0207668_10011404 | 3300025972 | Bacteria | 5398 |
| 284 | Ga0207668_10119743 | 3300025972 | Bacteria | 1991 |
| 285 | Ga0207668_10181033 | 3300025972 | Bacteria | 1662 |
| 286 | Ga0207668_10245383 | 3300025972 | Bacteria | 1451 |
| 287 | Ga0207640_10211011 | 3300025981 | Bacteria | 1479 |
| 288 | Ga0207658_10488385 | 3300025986 | Bacteria | 1095 |
| 289 | Ga0207703_10050169 | 3300026035 | Bacteria | 3376 |
| 290 | Ga0207703_10050909 | 3300026035 | Bacteria | 3354 |
| 291 | Ga0207703_10206321 | 3300026035 | Bacteria | 1749 |
| 292 | Ga0207703_10231537 | 3300026035 | Bacteria | 1656 |
| 293 | Ga0207703_10400047 | 3300026035 | Bacteria | 1274 |
| 294 | Ga0207639_10064297 | 3300026041 | Bacteria | 2844 |
| 295 | Ga0207639_10115154 | 3300026041 | Bacteria | 2198 |
| 296 | Ga0207639_10211061 | 3300026041 | Bacteria | 1671 |
| 297 | Ga0207639_10312384 | 3300026041 | Bacteria | 1393 |
| 298 | Ga0207678_10000337 | 3300026067 | Bacteria | 42242 |
| 299 | Ga0207678_10021070 | 3300026067 | Bacteria | 5715 |
| 300 | Ga0207678_10033154 | 3300026067 | Bacteria | 4500 |
| 301 | Ga0207678_10042251 | 3300026067 | Bacteria | 3950 |
| 302 | Ga0207678_10102649 | 3300026067 | Bacteria | 2441 |
| 303 | Ga0207708_10065447 | 3300026075 | Bacteria | 2778 |
| 304 | Ga0207708_10352876 | 3300026075 | Bacteria | 1207 |
| 305 | Ga0207702_10077004 | 3300026078 | Bacteria | 2883 |
| 306 | Ga0207648_10150898 | 3300026089 | Bacteria | 2050 |
| 307 | Ga0207648_10282059 | 3300026089 | Bacteria | 1486 |
| 308 | Ga0207674_10095816 | 3300026116 | Bacteria | 2953 |
| 309 | Ga0207674_10203567 | 3300026116 | Bacteria | 1929 |
| 310 | Ga0207674_10248758 | 3300026116 | Bacteria | 1725 |
| 311 | Ga0207683_10011948 | 3300026121 | Bacteria | 7411 |
| 312 | Ga0207683_10133197 | 3300026121 | Bacteria | 2236 |
| 313 | Ga0207683_10513344 | 3300026121 | Bacteria | 1107 |
| 314 | Ga0207698_10090822 | 3300026142 | Bacteria | 2498 |
| 315 | Ga0209179_1008511 | 3300027512 | Bacteria | 1731 |
| 316 | Ga0209588_1014704 | 3300027671 | Bacteria | 2399 |
| 317 | Ga0209588_1060221 | 3300027671 | Bacteria | 1227 |
| 318 | Ga0268266_10001147 | 3300028379 | Bacteria | 32898 |
| 319 | Ga0268266_10012847 | 3300028379 | Bacteria | 7230 |
| 320 | Ga0268266_10208799 | 3300028379 | Bacteria | 1790 |
| 321 | Ga0268265_10070496 | 3300028380 | Bacteria | 2718 |
| 322 | Ga0268265_10327782 | 3300028380 | Bacteria | 1389 |
| 323 | Ga0268265_10475331 | 3300028380 | Bacteria | 1172 |
| 324 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 325 | Ga0268264_10218617 | 3300028381 | Bacteria | 1753 |
| 326 | Ga0268264_10435685 | 3300028381 | Bacteria | 1267 |
| 327 | Ga0265336_10007256 | 3300028666 | Bacteria | 3947 |
| 328 | Ga0307517_10000062 | 3300028786 | Bacteria | 145054 |
| 329 | Ga0307517_10145509 | 3300028786 | Bacteria | 1646 |
| 330 | Ga0265338_10000090 | 3300028800 | Bacteria | 171540 |
| 331 | Ga0307511_10114045 | 3300030521 | Bacteria | 1705 |
| 332 | Ga0265760_10063895 | 3300031090 | Bacteria | 1122 |
| 333 | Ga0265330_10014093 | 3300031235 | Bacteria | 3712 |
| 334 | Ga0265330_10093526 | 3300031235 | Bacteria | 1289 |
| 335 | Ga0265332_10000227 | 3300031238 | Bacteria | 45207 |
| 336 | Ga0265332_10100524 | 3300031238 | Bacteria | 1220 |
| 337 | Ga0265328_10091540 | 3300031239 | Bacteria | 1124 |
| 338 | Ga0265325_10010500 | 3300031241 | Bacteria | 5358 |
| 339 | Ga0265340_10001031 | 3300031247 | Bacteria | 15902 |
| 340 | Ga0265340_10004003 | 3300031247 | Bacteria | 8284 |
| 341 | Ga0265340_10023744 | 3300031247 | Bacteria | 3124 |
| 342 | Ga0265340_10049838 | 3300031247 | Bacteria | 2033 |
| 343 | Ga0265339_10007527 | 3300031249 | Bacteria | 7022 |
| 344 | Ga0265331_10018997 | 3300031250 | Bacteria | 3553 |
| 345 | Ga0265331_10035353 | 3300031250 | Bacteria | 2458 |
| 346 | Ga0265316_10091936 | 3300031344 | Bacteria | 2314 |
| 347 | Ga0265316_10197153 | 3300031344 | Bacteria | 1494 |
| 348 | Ga0307513_10099663 | 3300031456 | Bacteria | 2933 |
| 349 | Ga0307508_10000403 | 3300031616 | Bacteria | 51779 |
| 350 | Ga0307508_10040142 | 3300031616 | Bacteria | 4203 |
| 351 | Ga0307508_10043361 | 3300031616 | Bacteria | 4031 |
| 352 | Ga0265314_10030411 | 3300031711 | Bacteria | 3997 |
| 353 | Ga0265342_10000178 | 3300031712 | Bacteria | 70648 |
| 354 | Ga0265342_10013292 | 3300031712 | Bacteria | 5533 |
| 355 | Ga0265342_10104007 | 3300031712 | Bacteria | 1614 |
| 356 | Ga0265342_10147747 | 3300031712 | Bacteria | 1307 |
| 357 | Ga0307516_10011695 | 3300031730 | Bacteria | 9525 |
| 358 | Ga0307516_10140049 | 3300031730 | Bacteria | 2190 |
| 359 | Ga0307416_100642267 | 3300032002 | Bacteria | 1145 |
| 360 | Ga0307507_10024960 | 3300033179 | Bacteria | 6497 |
| 361 | Ga0307510_10060001 | 3300033180 | Bacteria | 3920 |
| 362 | Ga0307510_10127065 | 3300033180 | Bacteria | 2236 |
| 363 | Ga0373958_0001999 | 3300034819 | Bacteria | 2811 |
| 364 | Ga0373934_0162150 | 3300035086 | Bacteria | 917 |
| 365 | Ga0373923_0000940 | 3300035111 | Bacteria | 7790 |
| 366 | Ga0373936_0000142 | 3300035113 | Bacteria | 24935 |
| 367 | Ga0373936_0009685 | 3300035113 | Bacteria | 3632 |
| 368 | Ga0373936_0029308 | 3300035113 | Bacteria | 2166 |
| 369 | Ga0373939_0002723 | 3300035114 | Bacteria | 4146 |
| 370 | Ga0373945_0005237 | 3300035116 | Bacteria | 4146 |
| 371 | Ga0373945_0005308 | 3300035116 | Bacteria | 4124 |
| 372 | Ga0373953_0001908 | 3300035117 | Bacteria | 6180 |
| 373 | Ga0373953_0057994 | 3300035117 | Bacteria | 1577 |
| 374 | Ga0373954_0002012 | 3300035118 | Bacteria | 8443 |
| 375 | Ga0373954_0260456 | 3300035118 | Bacteria | 854 |
| 376 | Ga0373956_0002575 | 3300035119 | Bacteria | 7368 |
| 377 | Ga0373956_0128359 | 3300035119 | Bacteria | 1186 |
| 378 | Ga0373957_0018780 | 3300035120 | Bacteria | 2425 |
| 379 | Ga0373957_0025648 | 3300035120 | Bacteria | 2126 |
| 380 | Ga0373943_0011979 | 3300035170 | Bacteria | 3904 |
| 381 | Ga0373946_0001354 | 3300035171 | Bacteria | 8488 |
| 382 | Ga0373955_0001050 | 3300035172 | Bacteria | 11751 |
| 383 | Ga0373955_0211473 | 3300035172 | Bacteria | 1156 |
| 384 | Ga0373955_0272770 | 3300035172 | Bacteria | 1017 |
| 385 | Ga0373961_0006644 | 3300035241 | Bacteria | 2780 |
| 386 | Ga0373962_0042001 | 3300035242 | Bacteria | 1291 |
| 387 | Ga0373924_0000143 | 3300035410 | Bacteria | 20948 |
| 388 | Ga0373924_0028005 | 3300035410 | Bacteria | 2243 |
| 389 | Ga0373924_0146509 | 3300035410 | Bacteria | 1032 |
| 390 | Ga0373931_0053603 | 3300035691 | Bacteria | 2152 |
| 391 | Ga0373935_0000495 | 3300035692 | Bacteria | 20438 |
| 392 | Ga0373935_0000528 | 3300035692 | Bacteria | 19905 |
| 393 | Ga0373935_0021340 | 3300035692 | Bacteria | 3965 |
| 394 | Ga0373935_0024822 | 3300035692 | Bacteria | 3692 |
| 395 | Ga0373927_0000308 | 3300035695 | Bacteria | 38418 |
| 396 | Ga0373927_0035573 | 3300035695 | Bacteria | 3238 |
| 397 | Ga0373927_0042844 | 3300035695 | Bacteria | 2933 |
| 398 | Ga0373927_0045863 | 3300035695 | Bacteria | 2828 |
| 399 | Ga0373927_0048990 | 3300035695 | Bacteria | 2732 |
| 400 | Ga0373927_0057422 | 3300035695 | Bacteria | 2517 |
| 401 | Ga0373933_0001902 | 3300035724 | Bacteria | 12050 |
| 402 | Ga0373933_0004103 | 3300035724 | Bacteria | 8027 |
| 403 | Ga0373933_0097509 | 3300035724 | Bacteria | 1821 |
| 404 | Ga0373933_0134495 | 3300035724 | Bacteria | 1557 |
| 405 | Ga0373947_0001975 | 3300035725 | Bacteria | 12557 |
| 406 | Ga0373947_0005725 | 3300035725 | Bacteria | 7249 |
| 407 | Ga0373947_0043816 | 3300035725 | Bacteria | 2673 |
| 408 | Ga0373947_0090878 | 3300035725 | Bacteria | 1904 |
| 409 | Ga0373947_0126853 | 3300035725 | Bacteria | 1626 |
| 410 | Ga0373947_0299119 | 3300035725 | Bacteria | 1073 |
| 411 | Ga0373937_0000063 | 3300036401 | Bacteria | 95762 |
| 412 | Ga0373937_0109634 | 3300036401 | Bacteria | 2567 |
| 413 | Ga0373937_0235958 | 3300036401 | Bacteria | 1722 |
| 414 | Ga0373925_0000185 | 3300037068 | Bacteria | 68604 |
| 415 | Ga0373925_0090147 | 3300037068 | Bacteria | 2343 |
| 416 | Ga0373925_0130183 | 3300037068 | Bacteria | 1961 |
| 417 | Ga0395900_0018958 | 3300037418 | Bacteria | 7018 |
| 418 | Ga0395900_0272977 | 3300037418 | Unclassified | 1685 |
| 419 | Ga0395898_0010921 | 3300037466 | Bacteria | 9474 |
| 420 | Ga0395905_0076714 | 3300037471 | Bacteria | 3132 |
| 421 | Ga0395901_0035674 | 3300038443 | Bacteria | 5139 |
| 422 | Ga0395901_0330154 | 3300038443 | Bacteria | 1577 |
| 423 | Ga0436365_0607069 | 3300039437 | Bacteria | 2171 |
| 424 | Ga0436365_1432862 | 3300039437 | Bacteria | 2817 |
| 425 | Ga0436360_0353512 | 3300039438 | Bacteria | 1134 |
| 426 | Ga0436361_0642483 | 3300039447 | Bacteria | 3545 |
| 427 | Ga0436363_1413720 | 3300039450 | Bacteria | 1087 |
| 428 | Ga0451833_1020682 | 3300041491 | Bacteria | 1523 |
| 429 | Ga0451841_0361863 | 3300041498 | Bacteria | 1387 |
| 430 | Ga0466970_0183282 | 3300044765 | Bacteria | 1162 |
| 431 | Ga0466967_0704612 | 3300045976 | Bacteria | 1000 |
| 432 | Ga0495592_0000162 | 3300046454 | Bacteria | 59289 |
| 433 | Ga0495592_0079852 | 3300046454 | Bacteria | 2367 |
| 434 | Ga0495592_0129753 | 3300046454 | Bacteria | 1764 |
| 435 | Ga0495603_0004869 | 3300046455 | Bacteria | 8028 |
| 436 | Ga0495603_0027231 | 3300046455 | Bacteria | 3450 |
| 437 | Ga0495603_0045833 | 3300046455 | Bacteria | 2606 |
| 438 | Ga0495603_0066954 | 3300046455 | Bacteria | 2115 |
| 439 | Ga0495603_0080797 | 3300046455 | Bacteria | 1905 |
| 440 | Ga0495590_0109560 | 3300046457 | Bacteria | 985 |
| 441 | Ga0495629_0000170 | 3300046459 | Bacteria | 57733 |
| 442 | Ga0495629_0207017 | 3300046459 | Bacteria | 1355 |
| 443 | Ga0495629_0306418 | 3300046459 | Bacteria | 1087 |
| 444 | Ga0495638_0200910 | 3300046460 | Bacteria | 1125 |
| 445 | Ga0495641_0002571 | 3300046461 | Bacteria | 14249 |
| 446 | Ga0495641_0089224 | 3300046461 | Bacteria | 1378 |
| 447 | Ga0495651_0000190 | 3300046462 | Bacteria | 46071 |
| 448 | Ga0495651_0032169 | 3300046462 | Bacteria | 4092 |
| 449 | Ga0495653_0011588 | 3300046463 | Bacteria | 7197 |
| 450 | Ga0495653_0104323 | 3300046463 | Bacteria | 2049 |
| 451 | Ga0495580_0017329 | 3300046472 | Bacteria | 5388 |
| 452 | Ga0495582_0000053 | 3300046473 | Bacteria | 58155 |
| 453 | Ga0495639_0142744 | 3300046475 | Bacteria | 1152 |
| 454 | Ga0495662_0000692 | 3300046476 | Bacteria | 15954 |
| 455 | Ga0495662_0001239 | 3300046476 | Bacteria | 12579 |
| 456 | Ga0495664_0000006 | 3300046477 | Bacteria | 407031 |
| 457 | Ga0495664_0032278 | 3300046477 | Bacteria | 3072 |
| 458 | Ga0495664_0033605 | 3300046477 | Bacteria | 3014 |
| 459 | Ga0495664_0044554 | 3300046477 | Bacteria | 2629 |
| 460 | Ga0495584_0108005 | 3300046491 | Bacteria | 1407 |
| 461 | Ga0495584_0222177 | 3300046491 | Bacteria | 960 |
| 462 | Ga0495594_0000267 | 3300046499 | Bacteria | 25600 |
| 463 | Ga0495606_0052387 | 3300046507 | Bacteria | 2654 |
| 464 | Ga0495608_0000002 | 3300046511 | Bacteria | 376403 |
| 465 | Ga0495608_0009669 | 3300046511 | Bacteria | 6727 |
| 466 | Ga0495610_0075023 | 3300046512 | Bacteria | 1567 |
| 467 | Ga0495616_0016545 | 3300046513 | Bacteria | 4080 |
| 468 | Ga0495618_0000001 | 3300046514 | Bacteria | 282202 |
| 469 | Ga0495618_0220549 | 3300046514 | Bacteria | 1196 |
| 470 | Ga0495628_0000004 | 3300046516 | Bacteria | 462184 |
| 471 | Ga0495628_0118293 | 3300046516 | Bacteria | 2034 |
| 472 | Ga0495630_0006844 | 3300046517 | Bacteria | 8127 |
| 473 | Ga0495631_0086109 | 3300046518 | Bacteria | 1353 |
| 474 | Ga0495632_0120662 | 3300046519 | Bacteria | 1225 |
| 475 | Ga0495648_0001690 | 3300046524 | Bacteria | 21355 |
| 476 | Ga0495648_0033620 | 3300046524 | Bacteria | 3346 |
| 477 | Ga0495648_0111587 | 3300046524 | Bacteria | 1487 |
| 478 | Ga0495642_0031105 | 3300046528 | Bacteria | 2139 |
| 479 | Ga0495652_0000007 | 3300046529 | Bacteria | 418163 |
| 480 | Ga0495652_0256485 | 3300046529 | Bacteria | 1293 |
| 481 | Ga0495665_0000132 | 3300046531 | Bacteria | 35776 |
| 482 | Ga0495640_0000004 | 3300046533 | Bacteria | 357515 |
| 483 | Ga0495640_0001291 | 3300046533 | Bacteria | 19684 |
| 484 | Ga0495640_0015413 | 3300046533 | Bacteria | 5753 |
| 485 | Ga0495640_0168809 | 3300046533 | Bacteria | 1398 |
| 486 | Ga0495587_0000002 | 3300046536 | Bacteria | 425485 |
| 487 | Ga0495587_0015115 | 3300046536 | Bacteria | 4824 |
| 488 | Ga0495621_0103384 | 3300046539 | Bacteria | 1086 |
| 489 | Ga0495597_0030349 | 3300046542 | Bacteria | 2464 |
| 490 | Ga0495597_0083184 | 3300046542 | Bacteria | 1367 |
| 491 | Ga0495597_0085406 | 3300046542 | Bacteria | 1345 |
| 492 | Ga0495645_0000008 | 3300046543 | Bacteria | 331530 |
| 493 | Ga0495645_0010809 | 3300046543 | Bacteria | 6412 |
| 494 | Ga0495622_0001348 | 3300046557 | Bacteria | 12543 |
| 495 | Ga0495622_0002929 | 3300046557 | Bacteria | 8141 |
| 496 | Ga0495622_0041556 | 3300046557 | Bacteria | 2138 |
| 497 | Ga0495622_0080095 | 3300046557 | Bacteria | 1503 |
| 498 | Ga0495667_0000006 | 3300046559 | Bacteria | 257523 |
| 499 | Ga0495667_0005418 | 3300046559 | Bacteria | 8627 |
| 500 | Ga0495667_0028437 | 3300046559 | Bacteria | 3764 |
| 501 | Ga0495656_0047694 | 3300046615 | Bacteria | 1817 |
| 502 | Ga0495656_0050859 | 3300046615 | Bacteria | 1771 |
| 503 | Ga0495656_0065503 | 3300046615 | Bacteria | 1598 |
| 504 | Ga0495656_0106833 | 3300046615 | Bacteria | 1303 |
| 505 | Ga0495668_0012998 | 3300046616 | Bacteria | 4927 |
| 506 | Ga0495634_0000001 | 3300046642 | Bacteria | 303746 |
| 507 | Ga0495634_0002240 | 3300046642 | Bacteria | 16205 |
| 508 | Ga0495634_0018593 | 3300046642 | Bacteria | 4944 |
| 509 | Ga0495611_0036090 | 3300046648 | Bacteria | 2192 |
| 510 | Ga0495625_0259145 | 3300046660 | Bacteria | 1126 |
| 511 | Ga0495635_0000004 | 3300046663 | Bacteria | 388068 |
| 512 | Ga0495635_0000488 | 3300046663 | Bacteria | 25029 |
| 513 | Ga0495635_0317353 | 3300046663 | Bacteria | 1043 |
| 514 | Ga0495588_0002203 | 3300046674 | Bacteria | 8346 |
| 515 | Ga0495588_0005592 | 3300046674 | Bacteria | 5603 |
| 516 | Ga0495657_0000104 | 3300046675 | Bacteria | 74754 |
| 517 | Ga0495657_0005629 | 3300046675 | Bacteria | 9887 |
| 518 | Ga0495599_0000003 | 3300046678 | Bacteria | 319085 |
| 519 | Ga0495599_0016569 | 3300046678 | Bacteria | 4576 |
| 520 | Ga0495623_0000033 | 3300046679 | Bacteria | 84372 |
| 521 | Ga0495623_0006603 | 3300046679 | Bacteria | 7553 |
| 522 | Ga0495623_0007892 | 3300046679 | Bacteria | 6923 |
| 523 | Ga0495623_0104473 | 3300046679 | Bacteria | 1723 |
| 524 | Ga0495646_0000001 | 3300046680 | Bacteria | 403396 |
| 525 | Ga0495646_0009689 | 3300046680 | Bacteria | 6115 |
| 526 | Ga0495646_0071730 | 3300046680 | Bacteria | 2037 |
| 527 | Ga0495646_0115748 | 3300046680 | Bacteria | 1522 |
| 528 | Ga0495647_0049145 | 3300046681 | Bacteria | 1633 |
| 529 | Ga0495658_0000326 | 3300046683 | Bacteria | 26625 |
| 530 | Ga0495658_0022246 | 3300046683 | Bacteria | 3350 |
| 531 | Ga0495624_0013743 | 3300046690 | Bacteria | 5514 |
| 532 | Ga0495624_0019391 | 3300046690 | Bacteria | 4541 |
| 533 | Ga0495649_0045033 | 3300046694 | Bacteria | 2407 |
| 534 | Ga0495600_0000098 | 3300046809 | Bacteria | 47938 |
| 535 | Ga0495600_0000650 | 3300046809 | Bacteria | 18011 |
| 536 | Ga0495660_0195389 | 3300046810 | Bacteria | 969 |
| 537 | Ga0495581_0001133 | 3300047315 | Bacteria | 14586 |
| 538 | Ga0495581_0011098 | 3300047315 | Bacteria | 5207 |
| 539 | Ga0495581_0090122 | 3300047315 | Bacteria | 1779 |
| 540 | Ga0495604_0000003 | 3300047317 | Bacteria | 464246 |
| 541 | Ga0495604_0000498 | 3300047317 | Bacteria | 34541 |
| 542 | Ga0495604_0052607 | 3300047317 | Bacteria | 3152 |
| 543 | Ga0495674_0000006 | 3300047319 | Bacteria | 341772 |
| 544 | Ga0495674_0001834 | 3300047319 | Bacteria | 20944 |
| 545 | Ga0495674_0016302 | 3300047319 | Bacteria | 6929 |
| 546 | Ga0495674_0028485 | 3300047319 | Bacteria | 5091 |
| 547 | Ga0495672_0007685 | 3300047320 | Bacteria | 8079 |
| 548 | Ga0495676_0008173 | 3300047321 | Bacteria | 9598 |
| 549 | Ga0495676_0038619 | 3300047321 | Bacteria | 3964 |
| 550 | Ga0495680_0000149 | 3300047322 | Bacteria | 70484 |
| 551 | Ga0495680_0013407 | 3300047322 | Bacteria | 7152 |
| 552 | Ga0495683_0110308 | 3300047323 | Bacteria | 1314 |
| 553 | Ga0495687_011999 | 3300047443 | Bacteria | 4613 |
| 554 | Ga0495675_0000535 | 3300047444 | Bacteria | 24616 |
| 555 | Ga0495675_0022696 | 3300047444 | Bacteria | 4001 |
| 556 | Ga0495677_0015523 | 3300047445 | Bacteria | 2767 |
| 557 | Ga0495684_0000003 | 3300047471 | Bacteria | 331335 |
| 558 | Ga0495684_0282575 | 3300047471 | Bacteria | 1197 |
| 559 | Ga0495593_0000177 | 3300047673 | Bacteria | 32957 |
| 560 | Ga0495602_0000012 | 3300048088 | Bacteria | 200520 |
| 561 | Ga0495602_0027291 | 3300048088 | Bacteria | 5489 |
| 562 | Ga0495602_0267054 | 3300048088 | Bacteria | 1266 |
| 563 | Ga0495614_0078924 | 3300048089 | Bacteria | 1425 |
| 564 | Ga0496101_0050198 | 3300048904 | Bacteria | 3002 |
| 565 | Ga0496101_0155233 | 3300048904 | Bacteria | 1753 |
| 566 | Ga0496101_0287391 | 3300048904 | Bacteria | 1286 |
| 567 | Ga0496102_0017501 | 3300048905 | Bacteria | 6277 |
| 568 | Ga0496102_0079063 | 3300048905 | Bacteria | 3028 |
| 569 | Ga0496102_0159880 | 3300048905 | Bacteria | 2119 |
| 570 | Ga0496102_0262241 | 3300048905 | Bacteria | 1629 |
| 571 | Ga0496102_0265083 | 3300048905 | Bacteria | 1619 |
| 572 | Ga0496102_0767133 | 3300048905 | Bacteria | 887 |
| 573 | Ga0496103_0025616 | 3300048906 | Bacteria | 3566 |
| 574 | Ga0496103_0142593 | 3300048906 | Bacteria | 1533 |
| 575 | Ga0496104_0036927 | 3300048907 | Bacteria | 4568 |
| 576 | Ga0496104_0080212 | 3300048907 | Bacteria | 3111 |
| 577 | Ga0496104_0604980 | 3300048907 | Bacteria | 1006 |
| 578 | Ga0496105_0014472 | 3300048908 | Bacteria | 6281 |
| 579 | Ga0496105_0015437 | 3300048908 | Bacteria | 6087 |
| 580 | Ga0496105_0081970 | 3300048908 | Bacteria | 2665 |
| 581 | Ga0496106_0010975 | 3300048909 | Bacteria | 6697 |
| 582 | Ga0496106_0186206 | 3300048909 | Bacteria | 1649 |
| 583 | Ga0496107_0013514 | 3300048910 | Bacteria | 5708 |
| 584 | Ga0496107_0093819 | 3300048910 | Bacteria | 2195 |
| 585 | Ga0496107_0146499 | 3300048910 | Bacteria | 1746 |
| 586 | Ga0496107_0153829 | 3300048910 | Bacteria | 1702 |
| 587 | Ga0496108_0094243 | 3300048911 | Bacteria | 2548 |
| 588 | Ga0496108_0116962 | 3300048911 | Bacteria | 2284 |
| 589 | Ga0496109_0159816 | 3300048912 | Bacteria | 2111 |
| 590 | Ga0496109_0475972 | 3300048912 | Bacteria | 1179 |
| 591 | Ga0496110_0068905 | 3300048913 | Bacteria | 3132 |
| 592 | Ga0496110_0074545 | 3300048913 | Bacteria | 3014 |
| 593 | Ga0496110_0362059 | 3300048913 | Bacteria | 1321 |
| 594 | Ga0496111_0113665 | 3300048914 | Bacteria | 1995 |
| 595 | Ga0496112_0008432 | 3300048915 | Bacteria | 9230 |
| 596 | Ga0496112_0049558 | 3300048915 | Bacteria | 4117 |
| 597 | Ga0496112_0169472 | 3300048915 | Bacteria | 2149 |
| 598 | Ga0496112_0199224 | 3300048915 | Bacteria | 1962 |
| 599 | Ga0496112_0225277 | 3300048915 | Bacteria | 1830 |
| 600 | Ga0496113_0023942 | 3300048916 | Bacteria | 4335 |
| 601 | Ga0496113_0041640 | 3300048916 | Bacteria | 3390 |
| 602 | Ga0496113_0072765 | 3300048916 | Bacteria | 2617 |
| 603 | Ga0496113_0216856 | 3300048916 | Bacteria | 1524 |
| 604 | Ga0496114_0049252 | 3300048917 | Bacteria | 3505 |
| 605 | Ga0496114_0057140 | 3300048917 | Bacteria | 3257 |
| 606 | Ga0496114_0069331 | 3300048917 | Bacteria | 2961 |
| 607 | Ga0496115_0054832 | 3300048918 | Bacteria | 3201 |
| 608 | Ga0496115_0097067 | 3300048918 | Bacteria | 2413 |
| 609 | Ga0496115_0196421 | 3300048918 | Bacteria | 1667 |
| 610 | Ga0496115_0211067 | 3300048918 | Bacteria | 1603 |
| 611 | Ga0496115_0388025 | 3300048918 | Bacteria | 1135 |
| 612 | Ga0496115_0491343 | 3300048918 | Bacteria | 987 |
| 613 | Ga0496116_0089361 | 3300048919 | Bacteria | 1879 |
| 614 | Ga0496117_0048980 | 3300048920 | Bacteria | 3011 |
| 615 | Ga0496118_0044451 | 3300048921 | Bacteria | 3478 |
| 616 | Ga0496118_0102522 | 3300048921 | Bacteria | 1928 |
| 617 | Ga0496118_0111484 | 3300048921 | Bacteria | 1814 |
| 618 | Ga0496118_0185012 | 3300048921 | Bacteria | 1253 |
| 619 | Ga0496119_0048413 | 3300048922 | Bacteria | 2636 |
| 620 | Ga0496121_0000221 | 3300048924 | Bacteria | 123829 |
| 621 | Ga0496121_0000330 | 3300048924 | Bacteria | 98687 |
| 622 | Ga0496121_0001291 | 3300048924 | Bacteria | 43108 |
| 623 | Ga0496121_0017083 | 3300048924 | Bacteria | 7439 |
| 624 | Ga0496121_0072344 | 3300048924 | Bacteria | 2768 |
| 625 | Ga0496121_0086670 | 3300048924 | Bacteria | 2460 |
| 626 | Ga0496121_0102906 | 3300048924 | Bacteria | 2198 |
| 627 | Ga0496121_0156564 | 3300048924 | Bacteria | 1671 |
| 628 | Ga0496121_0161880 | 3300048924 | Bacteria | 1635 |
| 629 | Ga0496121_0193624 | 3300048924 | Bacteria | 1455 |
| 630 | Ga0496121_0208529 | 3300048924 | Bacteria | 1386 |
| 631 | Ga0496122_0064272 | 3300048925 | Bacteria | 2671 |
| 632 | Ga0496122_0179906 | 3300048925 | Bacteria | 1263 |
| 633 | Ga0496124_0001238 | 3300048927 | Bacteria | 39220 |
| 634 | Ga0496124_0213720 | 3300048927 | Bacteria | 1457 |
| 635 | Ga0496124_0281733 | 3300048927 | Bacteria | 1211 |
| 636 | Ga0496125_0008068 | 3300048928 | Bacteria | 11106 |
| 637 | Ga0496125_0054723 | 3300048928 | Bacteria | 3258 |
| 638 | Ga0496125_0264241 | 3300048928 | Bacteria | 1076 |
| 639 | Ga0496126_0010346 | 3300048929 | Bacteria | 9790 |
| 640 | Ga0496126_0029216 | 3300048929 | Bacteria | 5239 |
| 641 | Ga0496126_0030038 | 3300048929 | Bacteria | 5157 |
| 642 | Ga0496126_0030901 | 3300048929 | Bacteria | 5068 |
| 643 | Ga0496126_0093824 | 3300048929 | Bacteria | 2635 |
| 644 | Ga0496126_0094406 | 3300048929 | Bacteria | 2625 |
| 645 | Ga0496126_0095251 | 3300048929 | Bacteria | 2611 |
| 646 | Ga0496126_0110749 | 3300048929 | Bacteria | 2391 |
| 647 | Ga0496126_0116159 | 3300048929 | Bacteria | 2326 |
| 648 | Ga0496126_0158617 | 3300048929 | Bacteria | 1934 |
| 649 | Ga0495678_027212 | 3300049459 | Bacteria | 2429 |
| 650 | Ga0501031_0000394 | 3300049568 | Bacteria | 25545 |
| 651 | Ga0501032_0000120 | 3300049569 | Bacteria | 64900 |
| 652 | Ga0501032_0029824 | 3300049569 | Bacteria | 3742 |
| 653 | Ga0501033_0001934 | 3300049570 | Bacteria | 18049 |
| 654 | Ga0501033_0083913 | 3300049570 | Bacteria | 2335 |
| 655 | Ga0501033_0165697 | 3300049570 | Bacteria | 1589 |
| 656 | Ga0501034_0000014 | 3300049571 | Bacteria | 297798 |
| 657 | Ga0501034_0000061 | 3300049571 | Bacteria | 195178 |
| 658 | Ga0501036_0000054 | 3300049572 | Bacteria | 74190 |
| 659 | Ga0501036_0026394 | 3300049572 | Bacteria | 4903 |
| 660 | Ga0501037_0000093 | 3300049573 | Bacteria | 83246 |
| 661 | Ga0501038_0000066 | 3300049574 | Bacteria | 86216 |
| 662 | Ga0501038_0032518 | 3300049574 | Bacteria | 4602 |
| 663 | Ga0501039_0000142 | 3300049575 | Bacteria | 48935 |
| 664 | Ga0501039_0000289 | 3300049575 | Bacteria | 35699 |
| 665 | Ga0501043_0001358 | 3300049579 | Bacteria | 21438 |
| 666 | Ga0501043_0374312 | 3300049579 | Bacteria | 1079 |
| 667 | Ga0501046_0002815 | 3300049580 | Bacteria | 16199 |
| 668 | Ga0501046_0009578 | 3300049580 | Bacteria | 8356 |
| 669 | Ga0501047_0000122 | 3300049581 | Bacteria | 95307 |
| 670 | Ga0501047_0000291 | 3300049581 | Bacteria | 57615 |
| 671 | Ga0501047_0038737 | 3300049581 | Bacteria | 4612 |
| 672 | Ga0501048_0000548 | 3300049582 | Bacteria | 26504 |
| 673 | Ga0501048_0000976 | 3300049582 | Bacteria | 21182 |
| 674 | Ga0501067_0000118 | 3300049583 | Bacteria | 44933 |
| 675 | Ga0501067_0005695 | 3300049583 | Bacteria | 6919 |
| 676 | Ga0501067_0108497 | 3300049583 | Bacteria | 1543 |
| 677 | Ga0501068_0015383 | 3300049584 | Bacteria | 4392 |
| 678 | Ga0501070_0022012 | 3300049586 | Bacteria | 5339 |
| 679 | Ga0501070_0042294 | 3300049586 | Bacteria | 3795 |
| 680 | Ga0501070_0082890 | 3300049586 | Bacteria | 2654 |
| 681 | Ga0501070_0485137 | 3300049586 | Bacteria | 994 |
| 682 | Ga0501071_0072261 | 3300049587 | Bacteria | 2516 |
| 683 | Ga0501072_0049721 | 3300049588 | Bacteria | 3300 |
| 684 | Ga0501073_0000146 | 3300049589 | Bacteria | 46947 |
| 685 | Ga0501074_0001004 | 3300049590 | Bacteria | 18312 |
| 686 | Ga0501079_0004827 | 3300049741 | Bacteria | 9985 |
| 687 | Ga0501080_0000010 | 3300049742 | Bacteria | 115062 |
| 688 | Ga0501080_0027156 | 3300049742 | Bacteria | 5323 |
| 689 | Ga0501035_0000034 | 3300049822 | Bacteria | 174589 |
| 690 | Ga0501035_0000099 | 3300049822 | Bacteria | 108224 |
| 691 | Ga0501035_0367960 | 3300049822 | Bacteria | 1200 |
| 692 | Ga0501044_0000039 | 3300049823 | Bacteria | 158218 |
| 693 | Ga0501044_0000367 | 3300049823 | Bacteria | 56521 |
| 694 | nmdc:mga03683_65994_c1 | 3300050489 | Bacteria | 1538 |
| 695 | nmdc:mga03n38_34268_c1 | 3300050490 | Bacteria | 2167 |
| 696 | nmdc:mga00v17_31841_c1 | 3300050491 | Bacteria | 3112 |
| 697 | nmdc:mga0yw44_130991_c1 | 3300050492 | Bacteria | 1624 |
| 698 | nmdc:mga0yw44_31257_c1 | 3300050492 | Bacteria | 3094 |
| 699 | nmdc:mga0yw44_4430_c1 | 3300050492 | Bacteria | 6439 |
| 700 | nmdc:mga0yw44_66574_c1 | 3300050492 | Bacteria | 2223 |
| 701 | nmdc:mga0yw44_7412_c1 | 3300050492 | Bacteria | 5395 |
| 702 | nmdc:mga06z11_67830_c1 | 3300050494 | Bacteria | 1879 |
| 703 | nmdc:mga06z11_98991_c1 | 3300050494 | Bacteria | 1597 |
| 704 | nmdc:mga04h51_83276_c1 | 3300050495 | Bacteria | 1139 |
| 705 | nmdc:mga07m45_114109_c1 | 3300050496 | Bacteria | 1558 |
| 706 | nmdc:mga07m45_19251_c1 | 3300050496 | Bacteria | 3697 |
| 707 | nmdc:mga09592_389107_c1 | 3300050508 | Bacteria | 1205 |
| 708 | nmdc:mga08y16_474409_c1 | 3300050511 | Bacteria | 1274 |
| 709 | nmdc:mga0n895_6786_c1 | 3300050512 | Bacteria | 9769 |
| 710 | nmdc:mga0n895_86178_c1 | 3300050512 | Unclassified | 3137 |
| 711 | nmdc:mga0n895_87559_c1 | 3300050512 | Bacteria | 3112 |
| 712 | nmdc:mga0rr50_73880_c1 | 3300050513 | Unclassified | 2608 |
| 713 | nmdc:mga0a205_66738_c1 | 3300050515 | Bacteria | 3476 |
| 714 | nmdc:mga0sz30_24843_c1 | 3300050516 | Bacteria | 2448 |
| 715 | Ga0495601_0000004 | 3300053077 | Bacteria | 449178 |
| 716 | Ga0495601_0049571 | 3300053077 | Bacteria | 2648 |
| 717 | Ga0495601_0053969 | 3300053077 | Bacteria | 2541 |
| 718 | Ga0495612_0000013 | 3300053078 | Bacteria | 198142 |
| 719 | Ga0495612_0012545 | 3300053078 | Bacteria | 3416 |
| 720 | Ga0500635_0007712 | 3300053080 | Bacteria | 2927 |
| 721 | Ga0500635_0021870 | 3300053080 | Bacteria | 1976 |
| 722 | Ga0495595_0000039 | 3300053084 | Bacteria | 68667 |
| 723 | Ga0495619_0000005 | 3300053085 | Bacteria | 418061 |
| 724 | Ga0495619_0061361 | 3300053085 | Bacteria | 2502 |
| 725 | Ga0500647_0018825 | 3300053091 | Bacteria | 3202 |
| 726 | Ga0500651_0004903 | 3300053093 | Bacteria | 7566 |
| 727 | Ga0500651_0292553 | 3300053093 | Bacteria | 936 |
| 728 | Ga0500566_0000020 | 3300053094 | Bacteria | 83462 |
| 729 | Ga0500566_0010191 | 3300053094 | Bacteria | 5544 |
| 730 | Ga0500566_0037138 | 3300053094 | Bacteria | 2823 |
| 731 | Ga0500640_000957 | 3300053095 | Bacteria | 8166 |
| 732 | Ga0500641_0001024 | 3300053096 | Bacteria | 9936 |
| 733 | Ga0500554_005163 | 3300053102 | Bacteria | 2823 |
| 734 | Ga0500554_009927 | 3300053102 | Bacteria | 2298 |
| 735 | Ga0500569_015557 | 3300053109 | Bacteria | 1908 |
| 736 | Ga0500572_000455 | 3300053111 | Bacteria | 14240 |
| 737 | Ga0500572_000882 | 3300053111 | Bacteria | 9311 |
| 738 | Ga0500594_0049090 | 3300053118 | Bacteria | 1182 |
| 739 | Ga0500595_000977 | 3300053119 | Bacteria | 16054 |
| 740 | Ga0500595_008725 | 3300053119 | Bacteria | 4125 |
| 741 | Ga0500595_008794 | 3300053119 | Bacteria | 4104 |
| 742 | Ga0500595_018339 | 3300053119 | Bacteria | 2561 |
| 743 | Ga0500595_026419 | 3300053119 | Bacteria | 2001 |
| 744 | Ga0500608_005725 | 3300053122 | Bacteria | 4972 |
| 745 | Ga0500614_000134 | 3300053123 | Bacteria | 18035 |
| 746 | Ga0500642_0042106 | 3300053130 | Bacteria | 1978 |
| 747 | Ga0500655_006594 | 3300053133 | Bacteria | 2089 |
| 748 | Ga0500559_0000930 | 3300053136 | Bacteria | 18495 |
| 749 | Ga0500559_0003043 | 3300053136 | Bacteria | 8381 |
| 750 | Ga0500568_0015205 | 3300053139 | Bacteria | 3450 |
| 751 | Ga0500603_000209 | 3300053150 | Bacteria | 15429 |
| 752 | Ga0500603_002632 | 3300053150 | Bacteria | 3908 |
| 753 | Ga0500603_073093 | 3300053150 | Bacteria | 980 |
| 754 | Ga0500622_0041194 | 3300053156 | Bacteria | 2404 |
| 755 | Ga0500627_0080499 | 3300053158 | Bacteria | 1452 |
| 756 | Ga0500630_001295 | 3300053159 | Bacteria | 11762 |
| 757 | Ga0500638_010552 | 3300053162 | Bacteria | 4052 |
| 758 | Ga0500638_086904 | 3300053162 | Bacteria | 1478 |
| 759 | Ga0500639_000111 | 3300053163 | Bacteria | 38862 |
| 760 | Ga0500636_0082938 | 3300053177 | Bacteria | 1845 |
| 761 | Ga0500636_0108588 | 3300053177 | Bacteria | 1570 |
| 762 | Ga0500637_0000941 | 3300053178 | Bacteria | 11795 |
| 763 | Ga0500637_0032604 | 3300053178 | Bacteria | 2905 |
| 764 | Ga0500637_0049480 | 3300053178 | Bacteria | 2392 |
| 765 | Ga0500570_118119 | 3300053724 | Bacteria | 1051 |
| 766 | Ga0500645_024807 | 3300053730 | Bacteria | 1831 |
| 767 | Ga0500596_000483 | 3300053735 | Bacteria | 7448 |
| 768 | Ga0500601_004478 | 3300053737 | Bacteria | 1523 |
| 769 | Ga0501084_0027731 | 3300054114 | Bacteria | 4732 |
| 770 | Ga0500661_000091 | 3300055283 | Bacteria | 14401 |
| 771 | Ga0501082_0118605 | 3300060353 | Bacteria | 2292 |
| 772 | 2507511245 | 2507262055 | Bacteria | 8048963 |
| 773 | 2509151372 | 2508501128 | Bacteria | 8613869 |
| 774 | 2513623684 | 2513237092 | Bacteria | 8341956 |
| 775 | 2513651934 | 2513237095 | Bacteria | 8976980 |
| 776 | 2513672770 | 2513237098 | Bacteria | 9902361 |
| 777 | 2513874857 | 2513237139 | Bacteria | 8737671 |
| 778 | 2513893397 | 2513237141 | Bacteria | 8496279 |
| 779 | 2524470256 | 2524023210 | Bacteria | 9029266 |
| 780 | 2528849260 | 2528768022 | Bacteria | 10457665 |
| 781 | 2617350519 | 2617270735 | Bacteria | 9163226 |
| 782 | 2617373367 | 2617270741 | Bacteria | 8201522 |
| 783 | 2793082715 | |||
| 784 | 2805916860 | 2802429603 | Bacteria | 8777136 |
| 785 | 2818238398 | 2816332527 | Bacteria | 8933356 |
| 786 | 2824663394 | 2824661429 | Bacteria | 9877870 |
| 787 | 2824701953 | 2824696289 | Bacteria | 8335049 |
| 788 | 2824737905 | 2824732956 | Bacteria | 7810675 |
| 789 | 2824773531 | 2824773399 | Bacteria | 8360218 |
| 790 | 2841962140 | 2841957949 | Bacteria | 8652217 |
| 791 | 2847944024 | 2847939898 | Bacteria | 8606328 |
| 792 | 2874619784 | 2874612657 | Bacteria | 8252029 |
| 793 | 2876768766 | 2876761206 | Bacteria | 10111113 |
| 794 | 2879109088 | 2879099564 | Bacteria | 10442239 |
| 795 | 2879134274 | 2879127579 | Bacteria | 8294491 |
| 796 | 2879145913 | 2879142872 | Bacteria | 8267021 |
| 797 | 2885387188 | 2885383462 | Bacteria | 9473874 |
| 798 | 2885410604 | 2885409591 | Bacteria | 9235467 |
| 799 | 2888381274 | 2888378607 | Bacteria | 9652610 |
| 800 | 2888389402 | 2888388044 | Bacteria | 7304136 |
| 801 | 2903775412 | 2903768456 | Bacteria | 9749579 |
| 802 | 2904691525 | 2904690495 | Bacteria | 9412302 |
| 803 | 2908761663 | 2908756301 | Bacteria | 8864324 |
| 804 | 2922362099 | 2922361189 | Bacteria | 7436256 |
| 805 | 2929619302 | 2929615660 | Bacteria | 9193770 |
| 806 | 2929628228 | 2929624759 | Bacteria | 9339455 |
| 807 | 2932785601 | 2932784394 | Bacteria | 9704911 |
| 808 | 2932813814 | 2932809354 | Bacteria | 9135765 |
| 809 | 2932822217 | 2932818245 | Bacteria | 9955613 |
| 810 | 2932830665 | 2932828146 | Bacteria | 9745859 |
| 811 | 2933581223 | 2933577622 | Bacteria | 9116884 |
| 812 | 2935612524 | 2935608549 | Bacteria | 8203142 |
| 813 | 2935620706 | 2935616580 | Bacteria | 9032984 |
| 814 | 2935639784 | 2935638405 | Bacteria | 10015038 |
| 815 | 2935667378 | 2935665750 | Bacteria | 9571747 |
| 816 | 2935677563 | 2935675223 | Bacteria | 9928132 |
| 817 | 2935690495 | 2935684952 | Bacteria | 9590419 |
| 818 | 2935697174 | 2935694250 | Bacteria | 9291695 |
| 819 | 2935705118 | 2935703347 | Bacteria | 10242284 |
| 820 | 2935717809 | 2935713505 | Bacteria | 9608509 |
| 821 | 2935727041 | 2935722832 | Bacteria | 9608746 |
| 822 | 2935735811 | 2935732158 | Bacteria | 9706831 |
| 823 | 2935744918 | 2935741537 | Bacteria | 9707219 |
| 824 | 2935755504 | 2935750917 | Bacteria | 9590372 |
| 825 | 2935761982 | 2935760218 | Bacteria | 9817913 |
| 826 | 2935803481 | 2935801545 | Bacteria | 9301974 |
| 827 | 2935811407 | 2935810662 | Bacteria | 9401221 |
| 828 | 2935824013 | 2935819856 | Bacteria | 8261050 |
| 829 | 2935829267 | 2935827899 | Bacteria | 10038562 |
| 830 | 2935842754 | 2935837841 | Bacteria | 9454360 |
| 831 | 2935852840 | 2935847175 | Bacteria | 8228321 |
| 832 | 2935858514 | 2935855204 | Bacteria | 9035059 |
| 833 | 2935867065 | 2935864058 | Bacteria | 9784707 |
| 834 | 2935877195 | 2935873716 | Bacteria | 9632195 |
| 835 | 2935922219 | 2935916978 | Bacteria | 9113783 |
| 836 | 2935929037 | 2935926038 | Bacteria | 8601059 |
| 837 | 2935935668 | 2935934488 | Bacteria | 8602579 |
| 838 | 2935947234 | 2935942939 | Bacteria | 8599779 |
| 839 | 2935953672 | 2935951376 | Bacteria | 8602333 |
| 840 | 2935968698 | 2935967501 | Bacteria | 8603075 |
| 841 | 2935976909 | 2935975950 | Bacteria | 8347125 |
| 842 | 2935995169 | 2935992306 | Bacteria | 9802711 |
| 843 | 2936004056 | 2936002035 | Bacteria | 9362176 |
| 844 | 2936037989 | 2936037263 | Bacteria | 9446081 |
| 845 | 2940561215 | 2940556831 | Bacteria | 9590747 |
| 846 | 2941544397 | 2941538514 | Bacteria | 9402094 |
| 847 | 3005592849 | 3005587118 | Bacteria | 7794411 |
| 848 | 8006991972 | 8006984368 | Bacteria | 9651211 |
| 849 | 8016516748 | 8016511872 | Bacteria | 9921665 |
| 850 | 8017059815 | 8017057580 | Bacteria | 10023680 |
| 851 | 8019579294 | 8019576017 | Bacteria | 10049540 |
| 852 | 8019597349 | 8019586578 | Bacteria | 10212056 |
| 853 | 8019604338 | 8019597564 | Bacteria | 10041141 |
| 854 | 8019614198 | 8019608314 | Bacteria | 10042931 |
| 855 | 8019624876 | 8019619141 | Bacteria | 9218857 |
| 856 | 8019674696 | 8019668869 | Bacteria | 8791617 |
| 857 | 8019694372 | 8019687851 | Bacteria | 8712826 |
| 858 | 8055749440 | 8055742211 | Bacteria | 9226248 |
| 859 | 8056695967 | 8056689827 | Bacteria | 6712655 |
| 860 | Ga0373927_0026775 | |||
| 861 | LJQas_1014668 | |||
| 862 | JGI24739J22299_10016256 | |||
| 863 | JGI25406J46586_10000165 | |||
| 864 | JGI25165J46597_1006630 | |||
| 865 | JGI25153J46596_10000575 | |||
| 866 | Ga0055525_1004330 | |||
| 867 | Ga0070658_10099672 | |||
| 868 | Ga0070683_100043524 | |||
| 869 | Ga0068869_100057695 | |||
| 870 | Ga0068869_100074094 | |||
| 871 | Ga0070680_100015252 | |||
| 872 | Ga0070680_100187112 | |||
| 873 | Ga0070682_100342676 | |||
| 874 | Ga0068868_100062156 | |||
| 875 | Ga0070660_100045327 | |||
| 876 | Ga0070660_100081978 | |||
| 877 | Ga0070660_100195360 | |||
| 878 | Ga0070689_100098548 | |||
| 879 | Ga0070691_10025379 | |||
| 880 | Ga0070668_100012163 | |||
| 881 | Ga0070668_100164813 | |||
| 882 | Ga0070675_100085365 | |||
| 883 | Ga0070675_100181162 | |||
| 884 | Ga0070675_100374362 | |||
| 885 | Ga0070659_100009316 | |||
| 886 | Ga0070659_100042620 | |||
| 887 | Ga0070709_10000506 | |||
| 888 | Ga0070709_10006029 | |||
| 889 | Ga0070709_10008240 | |||
| 890 | Ga0070709_10018713 | |||
| 891 | Ga0070709_10139333 | |||
| 892 | Ga0070709_10174801 | |||
| 893 | Ga0070714_100001330 | |||
| 894 | Ga0070714_100016718 | |||
| 895 | Ga0070713_100005814 | |||
| 896 | Ga0070713_100023991 | |||
| 897 | Ga0070713_100031315 | |||
| 898 | Ga0070713_100158058 | |||
| 899 | Ga0070713_100358239 | |||
| 900 | Ga0070710_10000386 | |||
| 901 | Ga0070710_10002397 | |||
| 902 | Ga0070710_10012971 | |||
| 903 | Ga0070710_10062026 | |||
| 904 | Ga0070711_100001793 | |||
| 905 | Ga0070711_100011103 | |||
| 906 | Ga0070711_100172690 | |||
| 907 | Ga0070663_100014179 | |||
| 908 | Ga0070663_100171895 | |||
| 909 | Ga0070663_100280125 | |||
| 910 | Ga0070663_100409278 | |||
| 911 | Ga0070663_100412290 | |||
| 912 | Ga0070663_100511417 | |||
| 913 | Ga0070678_100084575 | |||
| 914 | Ga0070662_100017516 | |||
| 915 | Ga0070681_10005340 | |||
| 916 | Ga0070679_100020251 | |||
| 917 | Ga0070679_100156183 | |||
| 918 | Ga0070684_100014216 | |||
| 919 | Ga0070684_100015972 | |||
| 920 | Ga0070684_100175465 | |||
| 921 | Ga0068853_100002345 | |||
| 922 | Ga0068853_100208048 | |||
| 923 | Ga0068853_100232611 | |||
| 924 | Ga0070695_100012117 | |||
| 925 | Ga0070695_100198632 | |||
| 926 | Ga0070696_100012886 | |||
| 927 | Ga0070693_100067557 | |||
| 928 | Ga0070693_100153420 | |||
| 929 | Ga0070693_100169874 | |||
| 930 | Ga0070665_100008978 | |||
| 931 | Ga0070665_100013701 | |||
| 932 | Ga0070665_100124385 | |||
| 933 | Ga0068855_100035619 | |||
| 934 | Ga0068855_100123641 | |||
| 935 | Ga0068855_100288104 | |||
| 936 | Ga0068855_100746804 | |||
| 937 | Ga0068857_100070074 | |||
| 938 | Ga0068856_100081355 | |||
| 939 | Ga0068856_100292181 | |||
| 940 | Ga0068852_100093823 | |||
| 941 | Ga0068852_100474740 | |||
| 942 | Ga0068859_100072274 | |||
| 943 | Ga0068859_100253602 | |||
| 944 | Ga0068859_100292654 | |||
| 945 | Ga0068859_100417629 | |||
| 946 | Ga0068864_100068900 | |||
| 947 | Ga0068864_100070379 | |||
| 948 | Ga0068864_100119978 | |||
| 949 | Ga0068866_10056185 | |||
| 950 | Ga0068866_10073276 | |||
| 951 | Ga0068861_100462217 | |||
| 952 | Ga0068851_10013247 | |||
| 953 | Ga0068851_10198901 | |||
| 954 | Ga0068863_100242522 | |||
| 955 | Ga0068863_100559712 | |||
| 956 | Ga0068858_100194812 | |||
| 957 | Ga0068858_100579361 | |||
| 958 | Ga0068860_100000113 | |||
| 959 | Ga0068860_100182768 | |||
| 960 | Ga0068862_100258680 | |||
| 961 | Ga0068862_100483497 | |||
| 962 | Ga0081455_10000073 | |||
| 963 | Ga0081455_10045667 | |||
| 964 | Ga0081455_10228340 | |||
| 965 | Ga0081540_1001713 | |||
| 966 | Ga0081540_1003381 | |||
| 967 | Ga0081540_1048857 | |||
| 968 | Ga0081540_1062999 | |||
| 969 | Ga0081539_10000255 | |||
| 970 | Ga0081539_10119056 | |||
| 971 | Ga0070717_10019185 | |||
| 972 | Ga0070717_10416774 | |||
| 973 | Ga0070717_10512402 | |||
| 974 | Ga0075365_10017869 | |||
| 975 | Ga0075365_10101915 | |||
| 976 | Ga0075365_10142235 | |||
| 977 | Ga0075365_10365871 | |||
| 978 | Ga0075368_10001310 | |||
| 979 | Ga0075368_10053169 | |||
| 980 | Ga0075364_10034559 | |||
| 981 | Ga0075364_10094518 | |||
| 982 | Ga0075364_10094907 | |||
| 983 | Ga0070715_10072552 | |||
| 984 | Ga0070716_100013305 | |||
| 985 | Ga0070716_100188851 | |||
| 986 | Ga0070716_100369146 | |||
| 987 | Ga0070712_100008029 | |||
| 988 | Ga0070712_100051745 | |||
| 989 | Ga0070712_100458632 | |||
| 990 | Ga0075362_10057914 | |||
| 991 | Ga0075362_10152772 | |||
| 992 | Ga0075367_10104468 | |||
| 993 | Ga0075366_10024997 | |||
| 994 | Ga0097621_100132585 | |||
| 995 | Ga0097621_100189042 | |||
| 996 | Ga0075370_10016014 | |||
| 997 | Ga0075370_10020457 | |||
| 998 | Ga0075370_10021827 | |||
| 999 | Ga0068871_100056998 | |||
| 1000 | Ga0068871_100219258 | |||
| 1001 | Ga0075428_100109095 | |||
| 1002 | Ga0075431_100449789 | |||
| 1003 | Ga0075433_10004563 | |||
| 1004 | Ga0075433_10202065 | |||
| 1005 | Ga0075434_100088516 | |||
| 1006 | Ga0075434_100101368 | |||
| 1007 | Ga0097620_100072273 | |||
| 1008 | Ga0097620_100253598 | |||
| 1009 | Ga0097620_100292652 | |||
| 1010 | Ga0097620_100417601 | |||
| 1011 | Ga0075435_100189830 | |||
| 1012 | Ga0075435_100542071 | |||
| 1013 | Ga0099795_10007573 | |||
| 1014 | Ga0099795_10027421 | |||
| 1015 | Ga0105240_10009596 | |||
| 1016 | Ga0105240_10545065 | |||
| 1017 | Ga0111539_10377139 | |||
| 1018 | Ga0105245_10618114 | |||
| 1019 | Ga0105247_10001533 | |||
| 1020 | Ga0105247_10026061 | |||
| 1021 | Ga0105247_10058271 | |||
| 1022 | Ga0105247_10079986 | |||
| 1023 | Ga0105247_10155475 | |||
| 1024 | Ga0114129_10028043 | |||
| 1025 | Ga0105241_10010784 | |||
| 1026 | Ga0105241_10010832 | |||
| 1027 | Ga0105241_10232469 | |||
| 1028 | Ga0105248_10055495 | |||
| 1029 | Ga0105248_10428425 | |||
| 1030 | Ga0105248_10714848 | |||
| 1031 | Ga0105237_10035699 | |||
| 1032 | Ga0105237_10106355 | |||
| 1033 | Ga0105237_10366550 | |||
| 1034 | Ga0105237_10614960 | |||
| 1035 | Ga0105238_10009724 | |||
| 1036 | Ga0105238_10015814 | |||
| 1037 | Ga0105238_10044871 | |||
| 1038 | Ga0105238_10169211 | |||
| 1039 | Ga0105238_10242621 | |||
| 1040 | Ga0099796_10003294 | |||
| 1041 | Ga0099796_10007064 | |||
| 1042 | Ga0105239_10011556 | |||
| 1043 | Ga0105239_10066307 | |||
| 1044 | Ga0105239_10084806 | |||
| 1045 | Ga0105239_10144508 | |||
| 1046 | Ga0105246_10195447 | |||
| 1047 | Ga0157371_10023272 | |||
| 1048 | Ga0157370_10088570 | |||
| 1049 | Ga0157369_10034285 | |||
| 1050 | Ga0157374_10062976 | |||
| 1051 | Ga0163162_10189496 | |||
| 1052 | Ga0163162_10343215 | |||
| 1053 | Ga0157372_10154390 | |||
| 1054 | Ga0157372_10206070 | |||
| 1055 | Ga0157375_10169282 | |||
| 1056 | Ga0163163_10028321 | |||
| 1057 | Ga0163163_10031629 | |||
| 1058 | Ga0163163_10044799 | |||
| 1059 | Ga0163163_10883568 | |||
| 1060 | Ga0157376_10389523 | |||
| 1061 | Ga0228598_1028294 | |||
| 1062 | Ga0209563_105637 | |||
| 1063 | Ga0209677_101030 | |||
| 1064 | Ga0209233_1001936 | |||
| 1065 | Ga0209758_1004964 | |||
| 1066 | Ga0209758_1011448 | |||
| 1067 | Ga0207426_1017410 | |||
| 1068 | Ga0209257_1025055 | |||
| 1069 | Ga0207656_10009757 | |||
| 1070 | Ga0207696_1056267 | |||
| 1071 | Ga0207682_10066293 | |||
| 1072 | Ga0207692_10002116 | |||
| 1073 | Ga0207692_10020587 | |||
| 1074 | Ga0207692_10045204 | |||
| 1075 | Ga0207692_10064618 | |||
| 1076 | Ga0207710_10013025 | |||
| 1077 | Ga0207647_10003775 | |||
| 1078 | Ga0207685_10001134 | |||
| 1079 | Ga0207685_10133598 | |||
| 1080 | Ga0207699_10000315 | |||
| 1081 | Ga0207699_10166481 | |||
| 1082 | Ga0207699_10204089 | |||
| 1083 | Ga0207643_10051800 | |||
| 1084 | Ga0207705_10070646 | |||
| 1085 | Ga0207654_10061873 | |||
| 1086 | Ga0207707_10000852 | |||
| 1087 | Ga0207707_10020269 | |||
| 1088 | Ga0207707_10021472 | |||
| 1089 | Ga0207695_10089162 | |||
| 1090 | Ga0207671_10021759 | |||
| 1091 | Ga0207671_10033060 | |||
| 1092 | Ga0207671_10048218 | |||
| 1093 | Ga0207671_10151137 | |||
| 1094 | Ga0207693_10001315 | |||
| 1095 | Ga0207693_10003192 | |||
| 1096 | Ga0207693_10044175 | |||
| 1097 | Ga0207693_10068492 | |||
| 1098 | Ga0207693_10074227 | |||
| 1099 | Ga0207693_10220871 | |||
| 1100 | Ga0207663_10004589 | |||
| 1101 | Ga0207663_10035391 | |||
| 1102 | Ga0207663_10189769 | |||
| 1103 | Ga0207663_10222720 | |||
| 1104 | Ga0207663_10242632 | |||
| 1105 | Ga0207660_10035846 | |||
| 1106 | Ga0207662_10248026 | |||
| 1107 | Ga0207657_10001809 | |||
| 1108 | Ga0207657_10069596 | |||
| 1109 | Ga0207657_10117682 | |||
| 1110 | Ga0207652_10024173 | |||
| 1111 | Ga0207652_10054223 | |||
| 1112 | Ga0207652_10278323 | |||
| 1113 | Ga0207694_10109458 | |||
| 1114 | Ga0207694_10309257 | |||
| 1115 | Ga0207650_10035414 | |||
| 1116 | Ga0207687_10420633 | |||
| 1117 | Ga0207700_10012197 | |||
| 1118 | Ga0207700_10028958 | |||
| 1119 | Ga0207700_10042385 | |||
| 1120 | Ga0207700_10096591 | |||
| 1121 | Ga0207700_10153428 | |||
| 1122 | Ga0207664_10009598 | |||
| 1123 | Ga0207664_10031373 | |||
| 1124 | Ga0207664_10155779 | |||
| 1125 | Ga0207664_10163631 | |||
| 1126 | Ga0207690_10017589 | |||
| 1127 | Ga0207690_10198749 | |||
| 1128 | Ga0207690_10213028 | |||
| 1129 | Ga0207706_10153068 | |||
| 1130 | Ga0207670_10075306 | |||
| 1131 | Ga0207669_10008544 | |||
| 1132 | Ga0207704_10262480 | |||
| 1133 | Ga0207665_10001125 | |||
| 1134 | Ga0207665_10002700 | |||
| 1135 | Ga0207665_10113175 | |||
| 1136 | Ga0207689_10020170 | |||
| 1137 | Ga0207689_10145801 | |||
| 1138 | Ga0207679_10084232 | |||
| 1139 | Ga0207679_10617280 | |||
| 1140 | Ga0207667_10160532 | |||
| 1141 | Ga0207667_10198924 | |||
| 1142 | Ga0207668_10011404 | |||
| 1143 | Ga0207668_10119743 | |||
| 1144 | Ga0207668_10181033 | |||
| 1145 | Ga0207668_10245383 | |||
| 1146 | Ga0207640_10211011 | |||
| 1147 | Ga0207658_10488385 | |||
| 1148 | Ga0207703_10050169 | |||
| 1149 | Ga0207703_10050909 | |||
| 1150 | Ga0207703_10206321 | |||
| 1151 | Ga0207703_10231537 | |||
| 1152 | Ga0207703_10400047 | |||
| 1153 | Ga0207639_10064297 | |||
| 1154 | Ga0207639_10115154 | |||
| 1155 | Ga0207639_10211061 | |||
| 1156 | Ga0207639_10312384 | |||
| 1157 | Ga0207678_10000337 | |||
| 1158 | Ga0207678_10021070 | |||
| 1159 | Ga0207678_10033154 | |||
| 1160 | Ga0207678_10042251 | |||
| 1161 | Ga0207678_10102649 | |||
| 1162 | Ga0207708_10065447 | |||
| 1163 | Ga0207708_10352876 | |||
| 1164 | Ga0207702_10077004 | |||
| 1165 | Ga0207648_10150898 | |||
| 1166 | Ga0207648_10282059 | |||
| 1167 | Ga0207674_10095816 | |||
| 1168 | Ga0207674_10203567 | |||
| 1169 | Ga0207674_10248758 | |||
| 1170 | Ga0207683_10011948 | |||
| 1171 | Ga0207683_10133197 | |||
| 1172 | Ga0207683_10513344 | |||
| 1173 | Ga0207698_10090822 | |||
| 1174 | Ga0209179_1008511 | |||
| 1175 | Ga0209588_1014704 | |||
| 1176 | Ga0209588_1060221 | |||
| 1177 | Ga0268266_10001147 | |||
| 1178 | Ga0268266_10012847 | |||
| 1179 | Ga0268266_10208799 | |||
| 1180 | Ga0268265_10070496 | |||
| 1181 | Ga0268265_10327782 | |||
| 1182 | Ga0268265_10475331 | |||
| 1183 | Ga0268264_10000035 | |||
| 1184 | Ga0268264_10218617 | |||
| 1185 | Ga0268264_10435685 | |||
| 1186 | Ga0265336_10007256 | |||
| 1187 | Ga0307517_10000062 | |||
| 1188 | Ga0307517_10145509 | |||
| 1189 | Ga0265338_10000090 | |||
| 1190 | Ga0307511_10114045 | |||
| 1191 | Ga0265760_10063895 | |||
| 1192 | Ga0265330_10014093 | |||
| 1193 | Ga0265330_10093526 | |||
| 1194 | Ga0265332_10000227 | |||
| 1195 | Ga0265332_10100524 | |||
| 1196 | Ga0265328_10091540 | |||
| 1197 | Ga0265325_10010500 | |||
| 1198 | Ga0265340_10001031 | |||
| 1199 | Ga0265340_10004003 | |||
| 1200 | Ga0265340_10023744 | |||
| 1201 | Ga0265340_10049838 | |||
| 1202 | Ga0265339_10007527 | |||
| 1203 | Ga0265331_10018997 | |||
| 1204 | Ga0265331_10035353 | |||
| 1205 | Ga0265316_10091936 | |||
| 1206 | Ga0265316_10197153 | |||
| 1207 | Ga0307513_10099663 | |||
| 1208 | Ga0307508_10000403 | |||
| 1209 | Ga0307508_10040142 | |||
| 1210 | Ga0307508_10043361 | |||
| 1211 | Ga0265314_10030411 | |||
| 1212 | Ga0265342_10000178 | |||
| 1213 | Ga0265342_10013292 | |||
| 1214 | Ga0265342_10104007 | |||
| 1215 | Ga0265342_10147747 | |||
| 1216 | Ga0307516_10011695 | |||
| 1217 | Ga0307516_10140049 | |||
| 1218 | Ga0307416_100642267 | |||
| 1219 | Ga0307507_10024960 | |||
| 1220 | Ga0307510_10060001 | |||
| 1221 | Ga0307510_10127065 | |||
| 1222 | Ga0373958_0001999 | |||
| 1223 | Ga0373934_0162150 | |||
| 1224 | Ga0373923_0000940 | |||
| 1225 | Ga0373936_0000142 | |||
| 1226 | Ga0373936_0009685 | |||
| 1227 | Ga0373936_0029308 | |||
| 1228 | Ga0373939_0002723 | |||
| 1229 | Ga0373945_0005237 | |||
| 1230 | Ga0373945_0005308 | |||
| 1231 | Ga0373953_0001908 | |||
| 1232 | Ga0373953_0057994 | |||
| 1233 | Ga0373954_0002012 | |||
| 1234 | Ga0373954_0260456 | |||
| 1235 | Ga0373956_0002575 | |||
| 1236 | Ga0373956_0128359 | |||
| 1237 | Ga0373957_0018780 | |||
| 1238 | Ga0373957_0025648 | |||
| 1239 | Ga0373943_0011979 | |||
| 1240 | Ga0373946_0001354 | |||
| 1241 | Ga0373955_0001050 | |||
| 1242 | Ga0373955_0211473 | |||
| 1243 | Ga0373955_0272770 | |||
| 1244 | Ga0373961_0006644 | |||
| 1245 | Ga0373962_0042001 | |||
| 1246 | Ga0373924_0000143 | |||
| 1247 | Ga0373924_0028005 | |||
| 1248 | Ga0373924_0146509 | |||
| 1249 | Ga0373931_0053603 | |||
| 1250 | Ga0373935_0000495 | |||
| 1251 | Ga0373935_0000528 | |||
| 1252 | Ga0373935_0021340 | |||
| 1253 | Ga0373935_0024822 | |||
| 1254 | Ga0373927_0000308 | |||
| 1255 | Ga0373927_0035573 | |||
| 1256 | Ga0373927_0042844 | |||
| 1257 | Ga0373927_0045863 | |||
| 1258 | Ga0373927_0048990 | |||
| 1259 | Ga0373927_0057422 | |||
| 1260 | Ga0373933_0001902 | |||
| 1261 | Ga0373933_0004103 | |||
| 1262 | Ga0373933_0097509 | |||
| 1263 | Ga0373933_0134495 | |||
| 1264 | Ga0373947_0001975 | |||
| 1265 | Ga0373947_0005725 | |||
| 1266 | Ga0373947_0043816 | |||
| 1267 | Ga0373947_0090878 | |||
| 1268 | Ga0373947_0126853 | |||
| 1269 | Ga0373947_0299119 | |||
| 1270 | Ga0373937_0000063 | |||
| 1271 | Ga0373937_0109634 | |||
| 1272 | Ga0373937_0235958 | |||
| 1273 | Ga0373925_0000185 | |||
| 1274 | Ga0373925_0090147 | |||
| 1275 | Ga0373925_0130183 | |||
| 1276 | Ga0395900_0018958 | |||
| 1277 | Ga0395900_0272977 | |||
| 1278 | Ga0395898_0010921 | |||
| 1279 | Ga0395905_0076714 | |||
| 1280 | Ga0395901_0035674 | |||
| 1281 | Ga0395901_0330154 | |||
| 1282 | Ga0436365_0607069 | |||
| 1283 | Ga0436365_1432862 | |||
| 1284 | Ga0436360_0353512 | |||
| 1285 | Ga0436361_0642483 | |||
| 1286 | Ga0436363_1413720 | |||
| 1287 | Ga0451833_1020682 | |||
| 1288 | Ga0451841_0361863 | |||
| 1289 | Ga0466970_0183282 | |||
| 1290 | Ga0466967_0704612 | |||
| 1291 | Ga0495592_0000162 | |||
| 1292 | Ga0495592_0079852 | |||
| 1293 | Ga0495592_0129753 | |||
| 1294 | Ga0495603_0004869 | |||
| 1295 | Ga0495603_0027231 | |||
| 1296 | Ga0495603_0045833 | |||
| 1297 | Ga0495603_0066954 | |||
| 1298 | Ga0495603_0080797 | |||
| 1299 | Ga0495590_0109560 | |||
| 1300 | Ga0495629_0000170 | |||
| 1301 | Ga0495629_0207017 | |||
| 1302 | Ga0495629_0306418 | |||
| 1303 | Ga0495638_0200910 | |||
| 1304 | Ga0495641_0002571 | |||
| 1305 | Ga0495641_0089224 | |||
| 1306 | Ga0495651_0000190 | |||
| 1307 | Ga0495651_0032169 | |||
| 1308 | Ga0495653_0011588 | |||
| 1309 | Ga0495653_0104323 | |||
| 1310 | Ga0495580_0017329 | |||
| 1311 | Ga0495582_0000053 | |||
| 1312 | Ga0495639_0142744 | |||
| 1313 | Ga0495662_0000692 | |||
| 1314 | Ga0495662_0001239 | |||
| 1315 | Ga0495664_0000006 | |||
| 1316 | Ga0495664_0032278 | |||
| 1317 | Ga0495664_0033605 | |||
| 1318 | Ga0495664_0044554 | |||
| 1319 | Ga0495584_0108005 | |||
| 1320 | Ga0495584_0222177 | |||
| 1321 | Ga0495594_0000267 | |||
| 1322 | Ga0495606_0052387 | |||
| 1323 | Ga0495608_0000002 | |||
| 1324 | Ga0495608_0009669 | |||
| 1325 | Ga0495610_0075023 | |||
| 1326 | Ga0495616_0016545 | |||
| 1327 | Ga0495618_0000001 | |||
| 1328 | Ga0495618_0220549 | |||
| 1329 | Ga0495628_0000004 | |||
| 1330 | Ga0495628_0118293 | |||
| 1331 | Ga0495630_0006844 | |||
| 1332 | Ga0495631_0086109 | |||
| 1333 | Ga0495632_0120662 | |||
| 1334 | Ga0495648_0001690 | |||
| 1335 | Ga0495648_0033620 | |||
| 1336 | Ga0495648_0111587 | |||
| 1337 | Ga0495642_0031105 | |||
| 1338 | Ga0495652_0000007 | |||
| 1339 | Ga0495652_0256485 | |||
| 1340 | Ga0495665_0000132 | |||
| 1341 | Ga0495640_0000004 | |||
| 1342 | Ga0495640_0001291 | |||
| 1343 | Ga0495640_0015413 | |||
| 1344 | Ga0495640_0168809 | |||
| 1345 | Ga0495587_0000002 | |||
| 1346 | Ga0495587_0015115 | |||
| 1347 | Ga0495621_0103384 | |||
| 1348 | Ga0495597_0030349 | |||
| 1349 | Ga0495597_0083184 | |||
| 1350 | Ga0495597_0085406 | |||
| 1351 | Ga0495645_0000008 | |||
| 1352 | Ga0495645_0010809 | |||
| 1353 | Ga0495622_0001348 | |||
| 1354 | Ga0495622_0002929 | |||
| 1355 | Ga0495622_0041556 | |||
| 1356 | Ga0495622_0080095 | |||
| 1357 | Ga0495667_0000006 | |||
| 1358 | Ga0495667_0005418 | |||
| 1359 | Ga0495667_0028437 | |||
| 1360 | Ga0495656_0047694 | |||
| 1361 | Ga0495656_0050859 | |||
| 1362 | Ga0495656_0065503 | |||
| 1363 | Ga0495656_0106833 | |||
| 1364 | Ga0495668_0012998 | |||
| 1365 | Ga0495634_0000001 | |||
| 1366 | Ga0495634_0002240 | |||
| 1367 | Ga0495634_0018593 | |||
| 1368 | Ga0495611_0036090 | |||
| 1369 | Ga0495625_0259145 | |||
| 1370 | Ga0495635_0000004 | |||
| 1371 | Ga0495635_0000488 | |||
| 1372 | Ga0495635_0317353 | |||
| 1373 | Ga0495588_0002203 | |||
| 1374 | Ga0495588_0005592 | |||
| 1375 | Ga0495657_0000104 | |||
| 1376 | Ga0495657_0005629 | |||
| 1377 | Ga0495599_0000003 | |||
| 1378 | Ga0495599_0016569 | |||
| 1379 | Ga0495623_0000033 | |||
| 1380 | Ga0495623_0006603 | |||
| 1381 | Ga0495623_0007892 | |||
| 1382 | Ga0495623_0104473 | |||
| 1383 | Ga0495646_0000001 | |||
| 1384 | Ga0495646_0009689 | |||
| 1385 | Ga0495646_0071730 | |||
| 1386 | Ga0495646_0115748 | |||
| 1387 | Ga0495647_0049145 | |||
| 1388 | Ga0495658_0000326 | |||
| 1389 | Ga0495658_0022246 | |||
| 1390 | Ga0495624_0013743 | |||
| 1391 | Ga0495624_0019391 | |||
| 1392 | Ga0495649_0045033 | |||
| 1393 | Ga0495600_0000098 | |||
| 1394 | Ga0495600_0000650 | |||
| 1395 | Ga0495660_0195389 | |||
| 1396 | Ga0495581_0001133 | |||
| 1397 | Ga0495581_0011098 | |||
| 1398 | Ga0495581_0090122 | |||
| 1399 | Ga0495604_0000003 | |||
| 1400 | Ga0495604_0000498 | |||
| 1401 | Ga0495604_0052607 | |||
| 1402 | Ga0495674_0000006 | |||
| 1403 | Ga0495674_0001834 | |||
| 1404 | Ga0495674_0016302 | |||
| 1405 | Ga0495674_0028485 | |||
| 1406 | Ga0495672_0007685 | |||
| 1407 | Ga0495676_0008173 | |||
| 1408 | Ga0495676_0038619 | |||
| 1409 | Ga0495680_0000149 | |||
| 1410 | Ga0495680_0013407 | |||
| 1411 | Ga0495683_0110308 | |||
| 1412 | Ga0495687_011999 | |||
| 1413 | Ga0495675_0000535 | |||
| 1414 | Ga0495675_0022696 | |||
| 1415 | Ga0495677_0015523 | |||
| 1416 | Ga0495684_0000003 | |||
| 1417 | Ga0495684_0282575 | |||
| 1418 | Ga0495593_0000177 | |||
| 1419 | Ga0495602_0000012 | |||
| 1420 | Ga0495602_0027291 | |||
| 1421 | Ga0495602_0267054 | |||
| 1422 | Ga0495614_0078924 | |||
| 1423 | Ga0496101_0050198 | |||
| 1424 | Ga0496101_0155233 | |||
| 1425 | Ga0496101_0287391 | |||
| 1426 | Ga0496102_0017501 | |||
| 1427 | Ga0496102_0079063 | |||
| 1428 | Ga0496102_0159880 | |||
| 1429 | Ga0496102_0262241 | |||
| 1430 | Ga0496102_0265083 | |||
| 1431 | Ga0496102_0767133 | |||
| 1432 | Ga0496103_0025616 | |||
| 1433 | Ga0496103_0142593 | |||
| 1434 | Ga0496104_0036927 | |||
| 1435 | Ga0496104_0080212 | |||
| 1436 | Ga0496104_0604980 | |||
| 1437 | Ga0496105_0014472 | |||
| 1438 | Ga0496105_0015437 | |||
| 1439 | Ga0496105_0081970 | |||
| 1440 | Ga0496106_0010975 | |||
| 1441 | Ga0496106_0186206 | |||
| 1442 | Ga0496107_0013514 | |||
| 1443 | Ga0496107_0093819 | |||
| 1444 | Ga0496107_0146499 | |||
| 1445 | Ga0496107_0153829 | |||
| 1446 | Ga0496108_0094243 | |||
| 1447 | Ga0496108_0116962 | |||
| 1448 | Ga0496109_0159816 | |||
| 1449 | Ga0496109_0475972 | |||
| 1450 | Ga0496110_0068905 | |||
| 1451 | Ga0496110_0074545 | |||
| 1452 | Ga0496110_0362059 | |||
| 1453 | Ga0496111_0113665 | |||
| 1454 | Ga0496112_0008432 | |||
| 1455 | Ga0496112_0049558 | |||
| 1456 | Ga0496112_0169472 | |||
| 1457 | Ga0496112_0199224 | |||
| 1458 | Ga0496112_0225277 | |||
| 1459 | Ga0496113_0023942 | |||
| 1460 | Ga0496113_0041640 | |||
| 1461 | Ga0496113_0072765 | |||
| 1462 | Ga0496113_0216856 | |||
| 1463 | Ga0496114_0049252 | |||
| 1464 | Ga0496114_0057140 | |||
| 1465 | Ga0496114_0069331 | |||
| 1466 | Ga0496115_0054832 | |||
| 1467 | Ga0496115_0097067 | |||
| 1468 | Ga0496115_0196421 | |||
| 1469 | Ga0496115_0211067 | |||
| 1470 | Ga0496115_0388025 | |||
| 1471 | Ga0496115_0491343 | |||
| 1472 | Ga0496116_0089361 | |||
| 1473 | Ga0496117_0048980 | |||
| 1474 | Ga0496118_0044451 | |||
| 1475 | Ga0496118_0102522 | |||
| 1476 | Ga0496118_0111484 | |||
| 1477 | Ga0496118_0185012 | |||
| 1478 | Ga0496119_0048413 | |||
| 1479 | Ga0496121_0000221 | |||
| 1480 | Ga0496121_0000330 | |||
| 1481 | Ga0496121_0001291 | |||
| 1482 | Ga0496121_0017083 | |||
| 1483 | Ga0496121_0072344 | |||
| 1484 | Ga0496121_0086670 | |||
| 1485 | Ga0496121_0102906 | |||
| 1486 | Ga0496121_0156564 | |||
| 1487 | Ga0496121_0161880 | |||
| 1488 | Ga0496121_0193624 | |||
| 1489 | Ga0496121_0208529 | |||
| 1490 | Ga0496122_0064272 | |||
| 1491 | Ga0496122_0179906 | |||
| 1492 | Ga0496124_0001238 | |||
| 1493 | Ga0496124_0213720 | |||
| 1494 | Ga0496124_0281733 | |||
| 1495 | Ga0496125_0008068 | |||
| 1496 | Ga0496125_0054723 | |||
| 1497 | Ga0496125_0264241 | |||
| 1498 | Ga0496126_0010346 | |||
| 1499 | Ga0496126_0029216 | |||
| 1500 | Ga0496126_0030038 | |||
| 1501 | Ga0496126_0030901 | |||
| 1502 | Ga0496126_0093824 | |||
| 1503 | Ga0496126_0094406 | |||
| 1504 | Ga0496126_0095251 | |||
| 1505 | Ga0496126_0110749 | |||
| 1506 | Ga0496126_0116159 | |||
| 1507 | Ga0496126_0158617 | |||
| 1508 | Ga0495678_027212 | |||
| 1509 | Ga0501031_0000394 | |||
| 1510 | Ga0501032_0000120 | |||
| 1511 | Ga0501032_0029824 | |||
| 1512 | Ga0501033_0001934 | |||
| 1513 | Ga0501033_0083913 | |||
| 1514 | Ga0501033_0165697 | |||
| 1515 | Ga0501034_0000014 | |||
| 1516 | Ga0501034_0000061 | |||
| 1517 | Ga0501036_0000054 | |||
| 1518 | Ga0501036_0026394 | |||
| 1519 | Ga0501037_0000093 | |||
| 1520 | Ga0501038_0000066 | |||
| 1521 | Ga0501038_0032518 | |||
| 1522 | Ga0501039_0000142 | |||
| 1523 | Ga0501039_0000289 | |||
| 1524 | Ga0501043_0001358 | |||
| 1525 | Ga0501043_0374312 | |||
| 1526 | Ga0501046_0002815 | |||
| 1527 | Ga0501046_0009578 | |||
| 1528 | Ga0501047_0000122 | |||
| 1529 | Ga0501047_0000291 | |||
| 1530 | Ga0501047_0038737 | |||
| 1531 | Ga0501048_0000548 | |||
| 1532 | Ga0501048_0000976 | |||
| 1533 | Ga0501067_0000118 | |||
| 1534 | Ga0501067_0005695 | |||
| 1535 | Ga0501067_0108497 | |||
| 1536 | Ga0501068_0015383 | |||
| 1537 | Ga0501070_0022012 | |||
| 1538 | Ga0501070_0042294 | |||
| 1539 | Ga0501070_0082890 | |||
| 1540 | Ga0501070_0485137 | |||
| 1541 | Ga0501071_0072261 | |||
| 1542 | Ga0501072_0049721 | |||
| 1543 | Ga0501073_0000146 | |||
| 1544 | Ga0501074_0001004 | |||
| 1545 | Ga0501079_0004827 | |||
| 1546 | Ga0501080_0000010 | |||
| 1547 | Ga0501080_0027156 | |||
| 1548 | Ga0501035_0000034 | |||
| 1549 | Ga0501035_0000099 | |||
| 1550 | Ga0501035_0367960 | |||
| 1551 | Ga0501044_0000039 | |||
| 1552 | Ga0501044_0000367 | |||
| 1553 | nmdc:mga03683_65994_c1 | |||
| 1554 | nmdc:mga03n38_34268_c1 | |||
| 1555 | nmdc:mga00v17_31841_c1 | |||
| 1556 | nmdc:mga0yw44_130991_c1 | |||
| 1557 | nmdc:mga0yw44_31257_c1 | |||
| 1558 | nmdc:mga0yw44_4430_c1 | |||
| 1559 | nmdc:mga0yw44_66574_c1 | |||
| 1560 | nmdc:mga0yw44_7412_c1 | |||
| 1561 | nmdc:mga06z11_67830_c1 | |||
| 1562 | nmdc:mga06z11_98991_c1 | |||
| 1563 | nmdc:mga04h51_83276_c1 | |||
| 1564 | nmdc:mga07m45_114109_c1 | |||
| 1565 | nmdc:mga07m45_19251_c1 | |||
| 1566 | nmdc:mga09592_389107_c1 | |||
| 1567 | nmdc:mga08y16_474409_c1 | |||
| 1568 | nmdc:mga0n895_6786_c1 | |||
| 1569 | nmdc:mga0n895_86178_c1 | |||
| 1570 | nmdc:mga0n895_87559_c1 | |||
| 1571 | nmdc:mga0rr50_73880_c1 | |||
| 1572 | nmdc:mga0a205_66738_c1 | |||
| 1573 | nmdc:mga0sz30_24843_c1 | |||
| 1574 | Ga0495601_0000004 | |||
| 1575 | Ga0495601_0049571 | |||
| 1576 | Ga0495601_0053969 | |||
| 1577 | Ga0495612_0000013 | |||
| 1578 | Ga0495612_0012545 | |||
| 1579 | Ga0500635_0007712 | |||
| 1580 | Ga0500635_0021870 | |||
| 1581 | Ga0495595_0000039 | |||
| 1582 | Ga0495619_0000005 | |||
| 1583 | Ga0495619_0061361 | |||
| 1584 | Ga0500647_0018825 | |||
| 1585 | Ga0500651_0004903 | |||
| 1586 | Ga0500651_0292553 | |||
| 1587 | Ga0500566_0000020 | |||
| 1588 | Ga0500566_0010191 | |||
| 1589 | Ga0500566_0037138 | |||
| 1590 | Ga0500640_000957 | |||
| 1591 | Ga0500641_0001024 | |||
| 1592 | Ga0500554_005163 | |||
| 1593 | Ga0500554_009927 | |||
| 1594 | Ga0500569_015557 | |||
| 1595 | Ga0500572_000455 | |||
| 1596 | Ga0500572_000882 | |||
| 1597 | Ga0500594_0049090 | |||
| 1598 | Ga0500595_000977 | |||
| 1599 | Ga0500595_008725 | |||
| 1600 | Ga0500595_008794 | |||
| 1601 | Ga0500595_018339 | |||
| 1602 | Ga0500595_026419 | |||
| 1603 | Ga0500608_005725 | |||
| 1604 | Ga0500614_000134 | |||
| 1605 | Ga0500642_0042106 | |||
| 1606 | Ga0500655_006594 | |||
| 1607 | Ga0500559_0000930 | |||
| 1608 | Ga0500559_0003043 | |||
| 1609 | Ga0500568_0015205 | |||
| 1610 | Ga0500603_000209 | |||
| 1611 | Ga0500603_002632 | |||
| 1612 | Ga0500603_073093 | |||
| 1613 | Ga0500622_0041194 | |||
| 1614 | Ga0500627_0080499 | |||
| 1615 | Ga0500630_001295 | |||
| 1616 | Ga0500638_010552 | |||
| 1617 | Ga0500638_086904 | |||
| 1618 | Ga0500639_000111 | |||
| 1619 | Ga0500636_0082938 | |||
| 1620 | Ga0500636_0108588 | |||
| 1621 | Ga0500637_0000941 | |||
| 1622 | Ga0500637_0032604 | |||
| 1623 | Ga0500637_0049480 | |||
| 1624 | Ga0500570_118119 | |||
| 1625 | Ga0500645_024807 | |||
| 1626 | Ga0500596_000483 | |||
| 1627 | Ga0500601_004478 | |||
| 1628 | Ga0501084_0027731 | |||
| 1629 | Ga0500661_000091 | |||
| 1630 | Ga0501082_0118605 | |||
| 1631 | 2507511245 | |||
| 1632 | 2509151372 | |||
| 1633 | 2513623684 | |||
| 1634 | 2513651934 | |||
| 1635 | 2513672770 | |||
| 1636 | 2513874857 | |||
| 1637 | 2513893397 | |||
| 1638 | 2524470256 | |||
| 1639 | 2528849260 | |||
| 1640 | 2617350519 | |||
| 1641 | 2617373367 | |||
| 1642 | 2793082715 | |||
| 1643 | 2805916860 | |||
| 1644 | 2818238398 | |||
| 1645 | 2824663394 | |||
| 1646 | 2824701953 | |||
| 1647 | 2824737905 | |||
| 1648 | 2824773531 | |||
| 1649 | 2841962140 | |||
| 1650 | 2847944024 | |||
| 1651 | 2874619784 | |||
| 1652 | 2876768766 | |||
| 1653 | 2879109088 | |||
| 1654 | 2879134274 | |||
| 1655 | 2879145913 | |||
| 1656 | 2885387188 | |||
| 1657 | 2885410604 | |||
| 1658 | 2888381274 | |||
| 1659 | 2888389402 | |||
| 1660 | 2903775412 | |||
| 1661 | 2904691525 | |||
| 1662 | 2908761663 | |||
| 1663 | 2922362099 | |||
| 1664 | 2929619302 | |||
| 1665 | 2929628228 | |||
| 1666 | 2932785601 | |||
| 1667 | 2932813814 | |||
| 1668 | 2932822217 | |||
| 1669 | 2932830665 | |||
| 1670 | 2933581223 | |||
| 1671 | 2935612524 | |||
| 1672 | 2935620706 | |||
| 1673 | 2935639784 | |||
| 1674 | 2935667378 | |||
| 1675 | 2935677563 | |||
| 1676 | 2935690495 | |||
| 1677 | 2935697174 | |||
| 1678 | 2935705118 | |||
| 1679 | 2935717809 | |||
| 1680 | 2935727041 | |||
| 1681 | 2935735811 | |||
| 1682 | 2935744918 | |||
| 1683 | 2935755504 | |||
| 1684 | 2935761982 | |||
| 1685 | 2935803481 | |||
| 1686 | 2935811407 | |||
| 1687 | 2935824013 | |||
| 1688 | 2935829267 | |||
| 1689 | 2935842754 | |||
| 1690 | 2935852840 | |||
| 1691 | 2935858514 | |||
| 1692 | 2935867065 | |||
| 1693 | 2935877195 | |||
| 1694 | 2935922219 | |||
| 1695 | 2935929037 | |||
| 1696 | 2935935668 | |||
| 1697 | 2935947234 | |||
| 1698 | 2935953672 | |||
| 1699 | 2935968698 | |||
| 1700 | 2935976909 | |||
| 1701 | 2935995169 | |||
| 1702 | 2936004056 | |||
| 1703 | 2936037989 | |||
| 1704 | 2940561215 | |||
| 1705 | 2941544397 | |||
| 1706 | 3005592849 | |||
| 1707 | 8006991972 | |||
| 1708 | 8016516748 | |||
| 1709 | 8017059815 | |||
| 1710 | 8019579294 | |||
| 1711 | 8019597349 | |||
| 1712 | 8019604338 | |||
| 1713 | 8019614198 | |||
| 1714 | 8019624876 | |||
| 1715 | 8019674696 | |||
| 1716 | 8019694372 | |||
| 1717 | 8055749440 | |||
| 1718 | 8056695967 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f67-assembly1.cif.gz_A | crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 | 0.9596 | 55 | 291 |
| 3f67-assembly1.cif.gz_A | crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 | 0.9441 | 55 | 291 |
| 4zv9-assembly6.cif.gz_F | 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai | 0.8818 | 54 | 291 |
| 8g3d-assembly1.cif.gz_3D | 48-nm doublet microtubule from tetrahymena thermophila strain k40r | 0.8653 | 43 | 291 |
| 1ggv-assembly1.cif.gz_A | crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) | 0.8605 | 61 | 291 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f67A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9501 | 55 | 291 | 3.40.50.1820 |
| 3f67A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9383 | 55 | 291 | 3.40.50.1820 |
| 4zv9B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8941 | 54 | 291 | 3.40.50.1820 |
| af_I6XF92_3_241_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8938 | 58 | 288 | 3.40.50.1820 |
| af_Q54MZ9_1_255_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8842 | 56 | 291 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537QQY5-F1-model_v4 | Dienelactone hydrolase family protein | 0.9901 | 162 | 293 |
GO:0016787
|
| AF-A0A2V6PZB4-F1-model_v4 | Dienelactone hydrolase domain-containing protein | 0.9873 | 175 | 293 |
GO:0016787
|
| AF-A0A376RS75-F1-model_v4 | Putative hydrolase | 0.9872 | 142 | 291 |
GO:0016787
|
| AF-A0A447PSE4-F1-model_v4 | Dienelactone hydrolase (EC 3.1.1.45) | 0.9865 | 141 | 291 |
GO:0008806
|
| AF-A0A485B8N0-F1-model_v4 | Dienelactone hydrolase family | 0.9864 | 170 | 292 |
GO:0016787
|