F483785

General Info

Members Datasets Scaffolds Average Seq Length
859 414 1718 345

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0044844|Ga0395905_0044844_250_1374
Length 374
Sequence MHMARNWRVSWNKRAAAKLINQHFYQEHPMSITPQEALSRCIEHREIFHDEMLSLFRQIMRGEMSPVMIAALTMGLRVKKETIGEIAAAAQVMREFATKVDVANPDKLLDIVGTGGDGAHTFNISTTALFAVAAAGGHVAKHGGRSVSSSSGSADAMEALGVHINLKPELVARSIEQTGIGFMFAPNHHAAMKHAAPVRKELGVRTIFNILGPLTNPAGAANILMGVFHPDLVGIQVRVLQRLGAKRAVVVWGRDNLDEVTLGAGTLVGELIDGEIREYEIHPEDFGLPMAATRNLKVASAAESKVKMLEALDNKPGAVRDIVALNAGTALYAAGVASSIADGLAKAQEALASGAARAKMEEFVKVTQELGRLA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
151 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
161 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
192 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
215 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
229 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
249 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
282 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
283 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
288 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
328 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
343 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
344 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
345 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
346 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
347 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
348 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
352 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
353 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
354 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
355 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
356 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
357 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
358 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
359 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
360 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
361 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
362 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
363 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
364 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
365 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
366 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
367 2643221638 Duganella sp. Root336D2 Isolate Unclassified
368 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
369 2643221645 Massilia sp. Root351 Isolate Unclassified
370 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
371 2643221664 Massilia sp. Root418 Isolate Unclassified
372 2738541280 Massilia sp. GV090 Isolate Unclassified
373 2738541297 Duganella sp. GV083 Isolate Unclassified
374 2738541300 Massilia sp. GV016 Isolate Unclassified
375 2738541357 Duganella sp. GV053 Isolate Unclassified
376 2738543003 Duganella sp. GV066 Isolate Unclassified
377 2738543018 Massilia sp. GV045 Isolate Unclassified
378 2738543026 Duganella sp. GV089 Isolate Unclassified
379 2738543029 Duganella sp. GV039 Isolate Unclassified
380 2738543030 Massilia sp. GV097 Isolate Unclassified
381 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
382 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
383 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
384 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
385 2818991436 Collimonas arenae 515 Isolate Unclassified
386 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
387 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
388 2821131069 Duganella sp. 1224 Isolate Unclassified
389 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
390 2842711865 Duganella sp. R-73148 Isolate Unclassified
391 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
392 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
393 2857553236 Duganella sp. R-74557 Isolate Unclassified
394 2857558681 Duganella sp. R-74565 Isolate Unclassified
395 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
396 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
397 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
398 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
399 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
400 2904424332 Duganella sp. 1411 Isolate Rhizosphere
401 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
402 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
403 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
404 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
405 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
406 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
407 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
408 2919476304 Duganella sp. 3397 Isolate Unclassified
409 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
410 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
411 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
412 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
413 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
414 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.78
Metatranscriptomes 0
Isolates 7.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.83
Nodule 1.51
Rhizoplane 3.03
Rhizosphere 68.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0044844 3300037471 Bacteria 4148
2 JGI25155J39150_1000336 3300002704 Bacteria 15086
3 JGI25155J39150_1000485 3300002704 Bacteria 9807
4 JGI25156J39149_1000063 3300002705 Bacteria 84312
5 JGI25156J39149_1000267 3300002705 Bacteria 35297
6 JGI25154J39366_1000412 3300002738 Bacteria 23116
7 JGI25154J39366_1000739 3300002738 Bacteria 14651
8 JGI25154J39366_1000845 3300002738 Bacteria 13292
9 JGI25154J39366_1001209 3300002738 Bacteria 9784
10 JGI25154J39366_1002200 3300002738 Bacteria 5398
11 JGI25158J39367_1003079 3300002739 Bacteria 2624
12 JGI25157J39369_1000082 3300002741 Bacteria 84303
13 JGI25157J39369_1000372 3300002741 Bacteria 30863
14 JGI25157J39369_1000495 3300002741 Bacteria 24307
15 JGI25152J39213_1000953 3300002773 Bacteria 14121
16 JGI25150J39212_1000910 3300002774 Bacteria 9622
17 JGI25150J39212_1003626 3300002774 Bacteria 3583
18 JGI25159J45721_1002200 3300002987 Bacteria 7576
19 JGI25151J46595_10001452 3300003187 Bacteria 16075
20 JGI25153J46596_10018531 3300003215 Bacteria 2700
21 JGI25160J50197_1003453 3300003354 Bacteria 7072
22 Ga0055538_1000062 3300003751 Bacteria 105260
23 Ga0055539_1000093 3300003752 Bacteria 105260
24 Ga0055539_1000303 3300003752 Bacteria 26405
25 Ga0055539_1000782 3300003752 Bacteria 7614
26 Ga0055533_1000043 3300003756 Bacteria 229262
27 Ga0055533_1000105 3300003756 Bacteria 105260
28 Ga0055532_1000034 3300003758 Bacteria 210984
29 Ga0055525_1000018 3300003759 Bacteria 393974
30 Ga0055525_1000137 3300003759 Bacteria 105260
31 Ga0055525_1001495 3300003759 Bacteria 4035
32 Ga0055535_1000859 3300003761 Bacteria 21484
33 Ga0055529_1000152 3300003763 Bacteria 98133
34 Ga0055529_1000725 3300003763 Bacteria 21544
35 Ga0055526_1000079 3300003771 Bacteria 89698
36 Ga0055526_1000690 3300003771 Bacteria 25815
37 Ga0055526_1001033 3300003771 Bacteria 20365
38 Ga0055526_1003493 3300003771 Bacteria 9959
39 Ga0055537_1000580 3300003773 Bacteria 20336
40 Ga0055537_1002871 3300003773 Bacteria 5518
41 Ga0055524_1000237 3300003775 Bacteria 57951
42 Ga0055524_1000899 3300003775 Bacteria 19266
43 Ga0055524_1001534 3300003775 Bacteria 13059
44 Ga0055524_1003281 3300003775 Bacteria 7917
45 Ga0055524_1008782 3300003775 Bacteria 4168
46 Ga0055524_1015153 3300003775 Bacteria 2822
47 Ga0055536_1000249 3300003781 Bacteria 42682
48 Ga0055534_1000283 3300003784 Bacteria 34520
49 Ga0055534_1003569 3300003784 Bacteria 4836
50 Ga0055534_1005272 3300003784 Bacteria 3500
51 Ga0055528_1000495 3300003790 Bacteria 31111
52 Ga0055528_1002751 3300003790 Bacteria 9215
53 Ga0055530_10005914 3300003791 Bacteria 5645
54 Ga0055530_10006075 3300003791 Bacteria 5515
55 Ga0055530_10006432 3300003791 Bacteria 5252
56 Ga0055530_10023984 3300003791 Bacteria 1741
57 Ga0055531_10020369 3300003794 Bacteria 2625
58 Ga0055531_10034762 3300003794 Bacteria 1592
59 Ga0055541_1000063 3300003841 Bacteria 105260
60 Ga0055543_1001129 3300004625 Bacteria 11441
61 Ga0055543_1003826 3300004625 Bacteria 4273
62 Ga0065165_1002857 3300005262 Bacteria 13394
63 Ga0065165_1003337 3300005262 Bacteria 11441
64 Ga0065165_1004075 3300005262 Bacteria 9468
65 Ga0070658_10124620 3300005327 Bacteria 2143
66 Ga0070676_10128521 3300005328 Bacteria 1599
67 Ga0070690_100037236 3300005330 Bacteria 3065
68 Ga0070670_100086718 3300005331 Bacteria 2690
69 Ga0070680_100167915 3300005336 Bacteria 1846
70 Ga0070660_100016657 3300005339 Bacteria 5341
71 Ga0070660_100044451 3300005339 Bacteria 3398
72 Ga0070687_100031300 3300005343 Bacteria 2609
73 Ga0070671_100026430 3300005355 Bacteria 4769
74 Ga0070673_100032700 3300005364 Bacteria 3921
75 Ga0070688_100052640 3300005365 Bacteria 2544
76 Ga0070659_100001752 3300005366 Bacteria 15587
77 Ga0070714_100135023 3300005435 Bacteria 2208
78 Ga0070705_100041313 3300005440 Bacteria 2628
79 Ga0070694_100004413 3300005444 Bacteria 8458
80 Ga0070662_100057197 3300005457 Bacteria 2833
81 Ga0070681_10014878 3300005458 Bacteria 7736
82 Ga0070699_100021479 3300005518 Bacteria 5566
83 Ga0070697_100149328 3300005536 Bacteria 1969
84 Ga0070695_100020091 3300005545 Bacteria 4074
85 Ga0070695_100051921 3300005545 Bacteria 2632
86 Ga0070704_100033986 3300005549 Bacteria 3453
87 Ga0070704_100129543 3300005549 Bacteria 1953
88 Ga0068855_100009264 3300005563 Bacteria 11894
89 Ga0068855_100035272 3300005563 Bacteria 5958
90 Ga0068855_100062362 3300005563 Bacteria 4352
91 Ga0068855_100120182 3300005563 Bacteria 3007
92 Ga0068855_100249658 3300005563 Bacteria 1979
93 Ga0068855_100317591 3300005563 Bacteria 1722
94 Ga0070664_100003553 3300005564 Bacteria 12597
95 Ga0068857_100004849 3300005577 Bacteria 11404
96 Ga0068857_100367839 3300005577 Bacteria 1334
97 Ga0068854_100017165 3300005578 Bacteria 4840
98 Ga0068854_100119599 3300005578 Bacteria 1998
99 Ga0068856_100002505 3300005614 Bacteria 18902
100 Ga0068856_100317250 3300005614 Bacteria 1576
101 Ga0068852_100004430 3300005616 Bacteria 9925
102 Ga0068864_100032966 3300005618 Bacteria 4402
103 Ga0068861_100036671 3300005719 Bacteria 3641
104 Ga0068863_100067354 3300005841 Bacteria 3386
105 Ga0068862_100019436 3300005844 Bacteria 5670
106 Ga0081539_10000365 3300005985 Bacteria 99063
107 Ga0075367_10043698 3300006178 Bacteria 2624
108 Ga0075366_10019447 3300006195 Bacteria 3929
109 Ga0075366_10066646 3300006195 Bacteria 2142
110 Ga0075370_10011458 3300006353 Bacteria 4660
111 Ga0075428_100301946 3300006844 Bacteria 1721
112 Ga0075430_100008118 3300006846 Bacteria 8872
113 Ga0075430_100011586 3300006846 Bacteria 7498
114 Ga0075430_100179064 3300006846 Bacteria 1763
115 Ga0075431_100039309 3300006847 Bacteria 4874
116 Ga0075431_100226597 3300006847 Bacteria 1905
117 Ga0068865_100001729 3300006881 Bacteria 12820
118 Ga0075436_100119909 3300006914 Bacteria 1840
119 Ga0079104_1000012 3300006946 Bacteria 355143
120 Ga0079104_1005592 3300006946 Bacteria 4978
121 Ga0099826_10000010 3300006948 Bacteria 314346
122 Ga0099826_10000024 3300006948 Bacteria 148974
123 Ga0099794_10016101 3300007265 Bacteria 3310
124 Ga0105251_10007888 3300009011 Bacteria 6472
125 Ga0105244_10003441 3300009036 Bacteria 11284
126 Ga0105244_10035827 3300009036 Bacteria 2604
127 Ga0105240_10001608 3300009093 Bacteria 38292
128 Ga0105240_10016336 3300009093 Bacteria 10052
129 Ga0105240_10158169 3300009093 Bacteria 2693
130 Ga0105240_10161523 3300009093 Bacteria 2661
131 Ga0105240_10190542 3300009093 Bacteria 2412
132 Ga0111539_10335889 3300009094 Bacteria 1759
133 Ga0114129_10589096 3300009147 Bacteria 1442
134 Ga0105248_10004608 3300009177 Bacteria 15258
135 Ga0105237_10010944 3300009545 Bacteria 9627
136 Ga0105237_10359562 3300009545 Bacteria 1460
137 Ga0105238_10000763 3300009551 Bacteria 33477
138 Ga0105239_10010387 3300010375 Bacteria 10421
139 Ga0105246_10023704 3300011119 Bacteria 3975
140 Ga0157371_10000018 3300013102 Bacteria 310522
141 Ga0157369_10019171 3300013105 Bacteria 7655
142 Ga0157378_10007501 3300013297 Bacteria 9526
143 Ga0182008_10056599 3300014497 Bacteria 1937
144 Ga0182006_1000033 3300015261 Bacteria 238180
145 Ga0182006_1000080 3300015261 Bacteria 122163
146 Ga0182006_1025436 3300015261 Bacteria 2431
147 Ga0182007_10000042 3300015262 Bacteria 111840
148 Ga0182007_10005353 3300015262 Bacteria 5653
149 Ga0182007_10021481 3300015262 Bacteria 2292
150 Ga0182005_1000016 3300015265 Bacteria 346889
151 Ga0182005_1000024 3300015265 Bacteria 238256
152 Ga0163161_10012023 3300017792 Bacteria 6004
153 Ga0163161_10012229 3300017792 Bacteria 5953
154 Ga0213872_10047661 3300021361 Bacteria 1948
155 Ga0213872_10049654 3300021361 Bacteria 1905
156 Ga0209435_100007 3300025206 Bacteria 516857
157 Ga0209435_100176 3300025206 Bacteria 19214
158 Ga0209436_100769 3300025208 Bacteria 13300
159 Ga0209436_104031 3300025208 Bacteria 3712
160 Ga0209784_100021 3300025224 Bacteria 408534
161 Ga0209566_100119 3300025225 Bacteria 105312
162 Ga0209674_100036 3300025226 Bacteria 408534
163 Ga0209674_100067 3300025226 Bacteria 253824
164 Ga0209147_100017 3300025229 Bacteria 516857
165 Ga0209563_100011 3300025230 Bacteria 1187808
166 Ga0209563_100040 3300025230 Bacteria 408534
167 Ga0209563_100068 3300025230 Bacteria 254802
168 Ga0207427_101402 3300025231 Bacteria 8811
169 Ga0209437_100332 3300025233 Bacteria 58796
170 Ga0209258_100129 3300025242 Bacteria 176515
171 Ga0209258_101277 3300025242 Bacteria 9457
172 Ga0209258_101777 3300025242 Bacteria 6621
173 Ga0207425_1000021 3300025245 Bacteria 367537
174 Ga0207425_1000050 3300025245 Bacteria 177008
175 Ga0207425_1000829 3300025245 Bacteria 15420
176 Ga0209646_1000044 3300025246 Bacteria 334596
177 Ga0209646_1000107 3300025246 Bacteria 163112
178 Ga0209646_1000190 3300025246 Bacteria 75772
179 Ga0209646_1000244 3300025246 Bacteria 55661
180 Ga0209026_1000004 3300025250 Bacteria 949012
181 Ga0209026_1000063 3300025250 Bacteria 211324
182 Ga0209677_100023 3300025253 Bacteria 408534
183 Ga0209677_100049 3300025253 Bacteria 180721
184 Ga0209677_100413 3300025253 Bacteria 25541
185 Ga0209759_1000003 3300025256 Bacteria 792130
186 Ga0209759_1000048 3300025256 Bacteria 224817
187 Ga0209759_1000198 3300025256 Bacteria 95052
188 Ga0209759_1003928 3300025256 Bacteria 5727
189 Ga0209759_1004764 3300025256 Bacteria 4958
190 Ga0209759_1020166 3300025256 Bacteria 1556
191 Ga0209129_1000020 3300025258 Bacteria 457053
192 Ga0209565_1000055 3300025263 Bacteria 201184
193 Ga0209565_1000677 3300025263 Bacteria 21295
194 Ga0209565_1009659 3300025263 Bacteria 2432
195 Ga0209565_1011047 3300025263 Bacteria 2215
196 Ga0209455_1000070 3300025272 Bacteria 307867
197 Ga0209455_1000083 3300025272 Bacteria 255660
198 Ga0209673_1000040 3300025273 Bacteria 312633
199 Ga0209673_1003338 3300025273 Bacteria 9600
200 Ga0209673_1004762 3300025273 Bacteria 7131
201 Ga0209130_1000169 3300025284 Bacteria 95167
202 Ga0209130_1002260 3300025284 Bacteria 9942
203 Ga0209130_1006585 3300025284 Bacteria 3748
204 Ga0209675_1000052 3300025291 Bacteria 201332
205 Ga0209675_1000156 3300025291 Bacteria 88813
206 Ga0209675_1000753 3300025291 Bacteria 21816
207 Ga0209675_1001299 3300025291 Bacteria 14837
208 Ga0209675_1003114 3300025291 Bacteria 8083
209 Ga0209676_1000364 3300025292 Bacteria 85375
210 Ga0209025_1000417 3300025294 Bacteria 85342
211 Ga0209025_1000473 3300025294 Bacteria 78078
212 Ga0209025_1000516 3300025294 Bacteria 73496
213 Ga0209025_1001876 3300025294 Bacteria 24626
214 Ga0209025_1002453 3300025294 Bacteria 19596
215 Ga0209564_1000027 3300025295 Bacteria 518458
216 Ga0209564_1000047 3300025295 Bacteria 368031
217 Ga0209564_1000063 3300025295 Bacteria 318515
218 Ga0209564_1000271 3300025295 Bacteria 108422
219 Ga0209564_1000658 3300025295 Bacteria 51441
220 Ga0209564_1000709 3300025295 Bacteria 48568
221 Ga0209564_1001666 3300025295 Bacteria 21297
222 Ga0209758_1000288 3300025297 Bacteria 99096
223 Ga0209758_1000436 3300025297 Bacteria 70342
224 Ga0209050_1000050 3300025298 Bacteria 362578
225 Ga0209050_1000335 3300025298 Bacteria 93521
226 Ga0209050_1001698 3300025298 Bacteria 22016
227 Ga0209256_1000045 3300025299 Bacteria 325506
228 Ga0209256_1000054 3300025299 Bacteria 298431
229 Ga0209256_1000079 3300025299 Bacteria 225382
230 Ga0209256_1000100 3300025299 Bacteria 201246
231 Ga0209256_1000754 3300025299 Bacteria 42096
232 Ga0209256_1001531 3300025299 Bacteria 23281
233 Ga0209256_1003694 3300025299 Bacteria 10398
234 Ga0209256_1035264 3300025299 Bacteria 1323
235 Ga0207426_1003112 3300025302 Bacteria 9466
236 Ga0209051_1006479 3300025303 Bacteria 6592
237 Ga0209051_1017263 3300025303 Bacteria 3230
238 Ga0209051_1028245 3300025303 Bacteria 2219
239 Ga0209257_1001336 3300025304 Bacteria 29943
240 Ga0207696_1053792 3300025711 Bacteria 1145
241 Ga0207655_1001651 3300025728 Bacteria 19767
242 Ga0207713_1064026 3300025735 Bacteria 1386
243 Ga0207699_10201555 3300025906 Bacteria 1349
244 Ga0207645_10053286 3300025907 Bacteria 2585
245 Ga0207695_10008939 3300025913 Bacteria 12470
246 Ga0207695_10012318 3300025913 Bacteria 10275
247 Ga0207695_10025241 3300025913 Bacteria 6658
248 Ga0207695_10070196 3300025913 Bacteria 3582
249 Ga0207695_10136114 3300025913 Bacteria 2409
250 Ga0207671_10004652 3300025914 Bacteria 12996
251 Ga0207671_10092910 3300025914 Bacteria 2275
252 Ga0207660_10078923 3300025917 Bacteria 2414
253 Ga0207662_10041525 3300025918 Bacteria 2708
254 Ga0207662_10109316 3300025918 Bacteria 1722
255 Ga0207657_10008924 3300025919 Bacteria 10132
256 Ga0207657_10012688 3300025919 Bacteria 8304
257 Ga0207649_10024118 3300025920 Bacteria 3532
258 Ga0207694_10000343 3300025924 Bacteria 44142
259 Ga0207650_10063319 3300025925 Bacteria 2765
260 Ga0207690_10000951 3300025932 Bacteria 18563
261 Ga0207706_10051130 3300025933 Bacteria 3650
262 Ga0207709_10039485 3300025935 Bacteria 2819
263 Ga0207704_10018780 3300025938 Bacteria 3617
264 Ga0207711_10036832 3300025941 Bacteria 4152
265 Ga0207689_10018288 3300025942 Bacteria 5915
266 Ga0207689_10050545 3300025942 Bacteria 3427
267 Ga0207679_10004406 3300025945 Bacteria 8766
268 Ga0207667_10000912 3300025949 Bacteria 37632
269 Ga0207667_10007366 3300025949 Bacteria 13242
270 Ga0207667_10041134 3300025949 Bacteria 4917
271 Ga0207667_10067556 3300025949 Bacteria 3723
272 Ga0207667_10098677 3300025949 Bacteria 3014
273 Ga0207667_10228908 3300025949 Bacteria 1904
274 Ga0207651_10014547 3300025960 Bacteria 4548
275 Ga0207640_10041316 3300025981 Bacteria 2932
276 Ga0207640_10074203 3300025981 Bacteria 2302
277 Ga0207703_10187047 3300026035 Bacteria 1831
278 Ga0207702_10001231 3300026078 Bacteria 25873
279 Ga0207648_10210122 3300026089 Bacteria 1727
280 Ga0207674_10090346 3300026116 Bacteria 3054
281 Ga0207698_10284985 3300026142 Bacteria 1530
282 Ga0209281_1000039 3300027111 Bacteria 355150
283 Ga0209282_1000009 3300027666 Bacteria 233366
284 Ga0209282_1000032 3300027666 Bacteria 149218
285 Ga0209971_1014001 3300027682 Bacteria 1901
286 Ga0209974_10048755 3300027876 Bacteria 1420
287 Ga0209974_10051497 3300027876 Bacteria 1385
288 Ga0268265_10009579 3300028380 Bacteria 6541
289 Ga0268264_10084747 3300028381 Bacteria 2718
290 Ga0265336_10000371 3300028666 Bacteria 28840
291 Ga0307517_10163511 3300028786 Bacteria 1486
292 Ga0307515_10001889 3300028794 Bacteria 46606
293 Ga0307515_10062795 3300028794 Bacteria 5236
294 Ga0307515_10137784 3300028794 Bacteria 2639
295 Ga0307515_10209697 3300028794 Bacteria 1796
296 Ga0265324_10004594 3300029957 Bacteria 6172
297 Ga0265324_10026135 3300029957 Bacteria 2067
298 Ga0316181_1137224 3300030744 Bacteria 4539
299 Ga0316182_1156105 3300030745 Bacteria 2669
300 Ga0265330_10009515 3300031235 Bacteria 4615
301 Ga0265332_10000253 3300031238 Bacteria 42715
302 Ga0265325_10006633 3300031241 Bacteria 7004
303 Ga0265329_10001506 3300031242 Bacteria 11154
304 Ga0265331_10004185 3300031250 Bacteria 9045
305 Ga0265327_10015618 3300031251 Bacteria 4886
306 Ga0265327_10020732 3300031251 Bacteria 3993
307 Ga0265316_10004517 3300031344 Bacteria 13828
308 Ga0265316_10114733 3300031344 Bacteria 2037
309 Ga0307408_100000432 3300031548 Bacteria 37289
310 Ga0307408_100002407 3300031548 Bacteria 13173
311 Ga0307408_100010617 3300031548 Bacteria 6076
312 Ga0307408_100227442 3300031548 Bacteria 1525
313 Ga0307408_100253356 3300031548 Bacteria 1453
314 Ga0307408_100275698 3300031548 Bacteria 1398
315 Ga0307508_10018336 3300031616 Bacteria 6361
316 Ga0265314_10008929 3300031711 Bacteria 8538
317 Ga0265314_10017740 3300031711 Bacteria 5577
318 Ga0307516_10000048 3300031730 Bacteria 130378
319 Ga0307516_10002257 3300031730 Bacteria 26000
320 Ga0307516_10030751 3300031730 Bacteria 5415
321 Ga0307412_10282814 3300031911 Bacteria 1303
322 Ga0307416_100000975 3300032002 Bacteria 15137
323 Ga0373926_0010863 3300035083 Bacteria 3057
324 Ga0373928_0015985 3300035084 Bacteria 1532
325 Ga0373943_0180795 3300035170 Bacteria 1159
326 Ga0373955_0080618 3300035172 Bacteria 1838
327 Ga0373924_0006584 3300035410 Bacteria 4165
328 Ga0373931_0015826 3300035691 Bacteria 3703
329 Ga0373933_0039388 3300035724 Bacteria 2780
330 Ga0373937_0001073 3300036401 Bacteria 23083
331 Ga0395899_0002806 3300037312 Bacteria 14038
332 Ga0395899_0003830 3300037312 Bacteria 11871
333 Ga0395899_0018674 3300037312 Bacteria 5269
334 Ga0395899_0030258 3300037312 Bacteria 4072
335 Ga0395899_0179380 3300037312 Bacteria 1488
336 Ga0395900_0000904 3300037418 Bacteria 39054
337 Ga0395900_0006506 3300037418 Bacteria 12173
338 Ga0395900_0031672 3300037418 Bacteria 5435
339 Ga0395900_0035466 3300037418 Bacteria 5137
340 Ga0395900_0285887 3300037418 Bacteria 1639
341 Ga0395900_0334820 3300037418 Bacteria 1490
342 Ga0395898_0001196 3300037466 Bacteria 39243
343 Ga0395898_0144923 3300037466 Bacteria 2273
344 Ga0395905_0000161 3300037471 Bacteria 111197
345 Ga0395905_0010442 3300037471 Bacteria 9034
346 Ga0395905_0021728 3300037471 Bacteria 6070
347 Ga0395905_0027336 3300037471 Bacteria 5379
348 Ga0395905_0036632 3300037471 Bacteria 4608
349 Ga0395905_0055914 3300037471 Bacteria 3693
350 Ga0395905_0068537 3300037471 Bacteria 3322
351 Ga0395901_0002710 3300038443 Bacteria 17843
352 Ga0395901_0002897 3300038443 Bacteria 17321
353 Ga0395901_0005821 3300038443 Bacteria 12479
354 Ga0395901_0066242 3300038443 Bacteria 3762
355 Ga0395901_0403054 3300038443 Bacteria 1405
356 Ga0395901_0410996 3300038443 Bacteria 1389
357 Ga0400490_04196 3300038726 Bacteria 8292
358 Ga0436361_0013073 3300039447 Bacteria 17617
359 Ga0436361_0303014 3300039447 Bacteria 21994
360 Ga0436361_0314274 3300039447 Bacteria 1808
361 Ga0436361_0319505 3300039447 Bacteria 9115
362 Ga0436361_0511425 3300039447 Bacteria 1344
363 Ga0436361_0865310 3300039447 Bacteria 2352
364 Ga0436361_0930389 3300039447 Bacteria 10390
365 Ga0436361_1142583 3300039447 Bacteria 2713
366 Ga0436361_1189474 3300039447 Bacteria 2881
367 Ga0451789_1013970 3300041443 Bacteria 2229
368 Ga0439441_009995 3300042001 Bacteria 1582
369 Ga0439451_028011 3300042009 Bacteria 1136
370 Ga0450898_004347 3300042134 Bacteria 2090
371 Ga0439446_0016659 3300042156 Bacteria 2048
372 Ga0439435_0028631 3300042436 Bacteria 1498
373 Ga0439460_0011810 3300042461 Bacteria 2257
374 Ga0451577_0070287 3300042876 Bacteria 3122
375 Ga0451577_0084653 3300042876 Bacteria 2829
376 Ga0466969_0002316 3300044656 Bacteria 10167
377 Ga0466969_0007117 3300044656 Bacteria 5954
378 Ga0466972_0000420 3300044658 Bacteria 22023
379 Ga0466972_0003973 3300044658 Bacteria 7370
380 Ga0466972_0011040 3300044658 Bacteria 4535
381 Ga0466972_0065816 3300044658 Bacteria 1733
382 Ga0466965_0002121 3300044683 Bacteria 8329
383 Ga0466965_0019993 3300044683 Bacteria 3216
384 Ga0466965_0020012 3300044683 Bacteria 3215
385 Ga0466965_0029552 3300044683 Bacteria 2667
386 Ga0466965_0036795 3300044683 Bacteria 2402
387 Ga0466966_0001854 3300044684 Bacteria 13710
388 Ga0466966_0029228 3300044684 Bacteria 3587
389 Ga0466966_0029262 3300044684 Bacteria 3584
390 Ga0466961_0007476 3300044693 Bacteria 6948
391 Ga0466961_0027488 3300044693 Bacteria 3658
392 Ga0466964_0004187 3300044706 Bacteria 5308
393 Ga0466964_0045872 3300044706 Bacteria 1780
394 Ga0466971_0008161 3300044719 Bacteria 4563
395 Ga0466971_0018165 3300044719 Bacteria 3113
396 Ga0466968_0003902 3300044735 Bacteria 5531
397 Ga0466970_0002134 3300044765 Bacteria 9544
398 Ga0466957_0001920 3300044842 Bacteria 11037
399 Ga0466957_0015104 3300044842 Bacteria 4506
400 Ga0466957_0076144 3300044842 Bacteria 2083
401 Ga0466957_0133066 3300044842 Bacteria 1595
402 Ga0466959_0001954 3300045049 Bacteria 12989
403 Ga0466959_0025858 3300045049 Bacteria 4353
404 Ga0466959_0068023 3300045049 Bacteria 2581
405 Ga0466959_0093076 3300045049 Bacteria 2163
406 Ga0451576_0001583 3300045051 Bacteria 38253
407 Ga0451576_0082220 3300045051 Bacteria 3349
408 Ga0451576_0291462 3300045051 Bacteria 1706
409 Ga0466958_0070166 3300045836 Bacteria 2143
410 Ga0495617_000022 3300046452 Bacteria 185975
411 Ga0495617_000075 3300046452 Bacteria 78250
412 Ga0495617_001209 3300046452 Bacteria 11631
413 Ga0495617_018396 3300046452 Bacteria 2362
414 Ga0495627_000011 3300046453 Bacteria 354522
415 Ga0495627_000398 3300046453 Bacteria 38966
416 Ga0495592_0002825 3300046454 Bacteria 12317
417 Ga0495603_0044746 3300046455 Bacteria 2641
418 Ga0495603_0046856 3300046455 Bacteria 2575
419 Ga0495590_0000057 3300046457 Bacteria 93720
420 Ga0495590_0000143 3300046457 Bacteria 43197
421 Ga0495590_0005737 3300046457 Bacteria 4877
422 Ga0495591_000799 3300046458 Bacteria 22321
423 Ga0495629_0020396 3300046459 Bacteria 4733
424 Ga0495629_0041378 3300046459 Bacteria 3242
425 Ga0495638_0001680 3300046460 Bacteria 19581
426 Ga0495651_0002596 3300046462 Bacteria 13971
427 Ga0495653_0000044 3300046463 Bacteria 115591
428 Ga0495653_0028893 3300046463 Bacteria 4432
429 Ga0495653_0062600 3300046463 Bacteria 2810
430 Ga0495650_0000082 3300046471 Bacteria 239477
431 Ga0495650_0000100 3300046471 Bacteria 213752
432 Ga0495650_0001173 3300046471 Bacteria 27987
433 Ga0495650_0001749 3300046471 Bacteria 19780
434 Ga0495650_0002119 3300046471 Bacteria 16976
435 Ga0495650_0008196 3300046471 Bacteria 6141
436 Ga0495650_0012103 3300046471 Bacteria 4666
437 Ga0495582_0027191 3300046473 Bacteria 3134
438 Ga0495582_0038957 3300046473 Bacteria 2616
439 Ga0495605_0000098 3300046474 Bacteria 109816
440 Ga0495605_0000153 3300046474 Bacteria 88955
441 Ga0495605_0002046 3300046474 Bacteria 12721
442 Ga0495605_0020353 3300046474 Bacteria 3526
443 Ga0495605_0037236 3300046474 Bacteria 2448
444 Ga0495584_0000232 3300046491 Bacteria 40218
445 Ga0495584_0000729 3300046491 Bacteria 21708
446 Ga0495584_0002317 3300046491 Bacteria 10849
447 Ga0495584_0009911 3300046491 Bacteria 4896
448 Ga0495584_0067745 3300046491 Bacteria 1793
449 Ga0495584_0094799 3300046491 Bacteria 1506
450 Ga0495584_0147235 3300046491 Bacteria 1196
451 Ga0495585_0000023 3300046492 Bacteria 149218
452 Ga0495585_0000152 3300046492 Bacteria 74325
453 Ga0495585_0000444 3300046492 Bacteria 39574
454 Ga0495585_0022247 3300046492 Bacteria 3639
455 Ga0495585_0036679 3300046492 Bacteria 2763
456 Ga0495585_0063062 3300046492 Bacteria 2034
457 Ga0495585_0065031 3300046492 Bacteria 1998
458 Ga0495585_0142084 3300046492 Bacteria 1256
459 Ga0495594_0068128 3300046499 Bacteria 1976
460 Ga0495596_0000032 3300046500 Bacteria 102282
461 Ga0495596_0000683 3300046500 Bacteria 21108
462 Ga0495596_0001270 3300046500 Bacteria 14619
463 Ga0495596_0004904 3300046500 Bacteria 6418
464 Ga0495596_0019014 3300046500 Bacteria 2826
465 Ga0495596_0039062 3300046500 Bacteria 1875
466 Ga0495596_0047804 3300046500 Bacteria 1678
467 Ga0495607_0009757 3300046501 Bacteria 6480
468 Ga0495607_0013841 3300046501 Bacteria 5271
469 Ga0495607_0034462 3300046501 Bacteria 3071
470 Ga0495607_0053231 3300046501 Bacteria 2340
471 Ga0495607_0060494 3300046501 Bacteria 2155
472 Ga0495583_0000106 3300046506 Bacteria 140932
473 Ga0495583_0000150 3300046506 Bacteria 117772
474 Ga0495583_0000517 3300046506 Bacteria 55159
475 Ga0495583_0000597 3300046506 Bacteria 49120
476 Ga0495583_0001383 3300046506 Bacteria 24824
477 Ga0495583_0001918 3300046506 Bacteria 19228
478 Ga0495606_0000080 3300046507 Bacteria 161866
479 Ga0495606_0000090 3300046507 Bacteria 154737
480 Ga0495606_0000099 3300046507 Bacteria 150950
481 Ga0495606_0000524 3300046507 Bacteria 62049
482 Ga0495606_0000600 3300046507 Bacteria 57013
483 Ga0495606_0001629 3300046507 Bacteria 29255
484 Ga0495606_0002603 3300046507 Bacteria 20634
485 Ga0495606_0086803 3300046507 Bacteria 1932
486 Ga0495608_0026406 3300046511 Bacteria 3959
487 Ga0495608_0026533 3300046511 Bacteria 3948
488 Ga0495608_0127594 3300046511 Bacteria 1629
489 Ga0495610_0000017 3300046512 Bacteria 365675
490 Ga0495610_0000668 3300046512 Bacteria 33359
491 Ga0495610_0002272 3300046512 Bacteria 16239
492 Ga0495610_0013362 3300046512 Bacteria 4884
493 Ga0495610_0043732 3300046512 Bacteria 2228
494 Ga0495616_0000490 3300046513 Bacteria 30167
495 Ga0495616_0002388 3300046513 Bacteria 12495
496 Ga0495616_0004647 3300046513 Bacteria 8621
497 Ga0495616_0006823 3300046513 Bacteria 6878
498 Ga0495616_0016924 3300046513 Bacteria 4026
499 Ga0495616_0018885 3300046513 Bacteria 3769
500 Ga0495616_0029168 3300046513 Bacteria 2915
501 Ga0495616_0034548 3300046513 Bacteria 2625
502 Ga0495616_0073217 3300046513 Bacteria 1653
503 Ga0495618_0063746 3300046514 Bacteria 2341
504 Ga0495628_0000382 3300046516 Bacteria 40502
505 Ga0495628_0002078 3300046516 Bacteria 18185
506 Ga0495630_0246662 3300046517 Bacteria 1364
507 Ga0495631_0001332 3300046518 Bacteria 15128
508 Ga0495631_0001436 3300046518 Bacteria 14479
509 Ga0495631_0023308 3300046518 Bacteria 2870
510 Ga0495631_0065120 3300046518 Bacteria 1577
511 Ga0495632_0000052 3300046519 Bacteria 132992
512 Ga0495632_0000396 3300046519 Bacteria 40964
513 Ga0495632_0001555 3300046519 Bacteria 18930
514 Ga0495632_0003734 3300046519 Bacteria 10656
515 Ga0495632_0012494 3300046519 Bacteria 4897
516 Ga0495632_0013833 3300046519 Bacteria 4588
517 Ga0495637_0000018 3300046520 Bacteria 186671
518 Ga0495637_0000195 3300046520 Bacteria 47191
519 Ga0495643_0000109 3300046522 Bacteria 135859
520 Ga0495643_0000250 3300046522 Bacteria 78905
521 Ga0495643_0001163 3300046522 Bacteria 25714
522 Ga0495643_0003256 3300046522 Bacteria 12009
523 Ga0495643_0021689 3300046522 Bacteria 3679
524 Ga0495643_0025569 3300046522 Bacteria 3339
525 Ga0495643_0039737 3300046522 Bacteria 2572
526 Ga0495644_0001124 3300046523 Bacteria 10982
527 Ga0495644_0003935 3300046523 Bacteria 5846
528 Ga0495648_0001108 3300046524 Bacteria 27307
529 Ga0495648_0001296 3300046524 Bacteria 24870
530 Ga0495648_0001297 3300046524 Bacteria 24870
531 Ga0495648_0001425 3300046524 Bacteria 23386
532 Ga0495648_0003753 3300046524 Bacteria 13223
533 Ga0495648_0012427 3300046524 Bacteria 6353
534 Ga0495648_0012934 3300046524 Bacteria 6198
535 Ga0495648_0015868 3300046524 Bacteria 5445
536 Ga0495648_0030615 3300046524 Bacteria 3555
537 Ga0495666_0006871 3300046526 Bacteria 5714
538 Ga0495666_0007557 3300046526 Bacteria 5437
539 Ga0495642_0000529 3300046528 Bacteria 19421
540 Ga0495642_0002545 3300046528 Bacteria 7372
541 Ga0495642_0003891 3300046528 Bacteria 5852
542 Ga0495642_0004563 3300046528 Bacteria 5366
543 Ga0495642_0011219 3300046528 Bacteria 3437
544 Ga0495642_0014230 3300046528 Bacteria 3082
545 Ga0495642_0042536 3300046528 Bacteria 1851
546 Ga0495642_0068412 3300046528 Bacteria 1482
547 Ga0495654_0000030 3300046530 Bacteria 216715
548 Ga0495654_0018430 3300046530 Bacteria 3658
549 Ga0495654_0021405 3300046530 Bacteria 3363
550 Ga0495654_0031775 3300046530 Bacteria 2679
551 Ga0495665_0001301 3300046531 Bacteria 13308
552 Ga0495665_0024697 3300046531 Bacteria 3228
553 Ga0495665_0034596 3300046531 Bacteria 2701
554 Ga0495586_0115342 3300046535 Bacteria 1497
555 Ga0495587_0051879 3300046536 Bacteria 2422
556 Ga0495598_0015527 3300046537 Bacteria 1925
557 Ga0495609_0002820 3300046538 Bacteria 10412
558 Ga0495609_0005405 3300046538 Bacteria 6723
559 Ga0495609_0007869 3300046538 Bacteria 5269
560 Ga0495609_0008324 3300046538 Bacteria 5084
561 Ga0495621_0013856 3300046539 Bacteria 2542
562 Ga0495597_0001115 3300046542 Bacteria 20308
563 Ga0495597_0001285 3300046542 Bacteria 18457
564 Ga0495597_0001411 3300046542 Bacteria 17326
565 Ga0495597_0002378 3300046542 Bacteria 12035
566 Ga0495597_0018630 3300046542 Bacteria 3255
567 Ga0495597_0022362 3300046542 Bacteria 2933
568 Ga0495597_0073848 3300046542 Bacteria 1465
569 Ga0495645_0068890 3300046543 Bacteria 2554
570 Ga0495622_0000044 3300046557 Bacteria 115528
571 Ga0495622_0004973 3300046557 Bacteria 6157
572 Ga0495633_0000917 3300046558 Bacteria 24985
573 Ga0495633_0003343 3300046558 Bacteria 10770
574 Ga0495633_0006937 3300046558 Bacteria 6622
575 Ga0495633_0059388 3300046558 Bacteria 1793
576 Ga0495668_0000035 3300046616 Bacteria 240241
577 Ga0495668_0000211 3300046616 Bacteria 84615
578 Ga0495668_0000286 3300046616 Bacteria 69771
579 Ga0495668_0000939 3300046616 Bacteria 32535
580 Ga0495668_0001545 3300046616 Bacteria 21835
581 Ga0495668_0004452 3300046616 Bacteria 9939
582 Ga0495668_0004605 3300046616 Bacteria 9699
583 Ga0495668_0012596 3300046616 Bacteria 5014
584 Ga0495668_0097325 3300046616 Bacteria 1610
585 Ga0495611_0001030 3300046648 Bacteria 14761
586 Ga0495611_0003988 3300046648 Bacteria 6425
587 Ga0495611_0006487 3300046648 Bacteria 4986
588 Ga0495611_0012387 3300046648 Bacteria 3626
589 Ga0495611_0024927 3300046648 Bacteria 2603
590 Ga0495611_0050001 3300046648 Bacteria 1882
591 Ga0495625_0000338 3300046660 Bacteria 71524
592 Ga0495625_0001765 3300046660 Bacteria 25007
593 Ga0495625_0002807 3300046660 Bacteria 18358
594 Ga0495625_0016076 3300046660 Bacteria 5897
595 Ga0495625_0032153 3300046660 Bacteria 3895
596 Ga0495625_0032657 3300046660 Bacteria 3857
597 Ga0495659_0000139 3300046664 Bacteria 32158
598 Ga0495659_0006513 3300046664 Bacteria 3687
599 Ga0495659_0012720 3300046664 Bacteria 2731
600 Ga0495659_0021812 3300046664 Bacteria 2161
601 Ga0495661_0004739 3300046665 Bacteria 9770
602 Ga0495661_0014026 3300046665 Bacteria 5371
603 Ga0495661_0028811 3300046665 Bacteria 3550
604 Ga0495661_0064889 3300046665 Bacteria 2152
605 Ga0495661_0146768 3300046665 Bacteria 1277
606 Ga0495588_0056552 3300046674 Bacteria 2025
607 Ga0495599_0009879 3300046678 Bacteria 5840
608 Ga0495623_0019111 3300046679 Bacteria 4426
609 Ga0495647_0004533 3300046681 Bacteria 4519
610 Ga0495647_0034374 3300046681 Bacteria 1898
611 Ga0495658_0216304 3300046683 Bacteria 1198
612 Ga0495669_0000101 3300046684 Bacteria 53876
613 Ga0495669_0000495 3300046684 Bacteria 18130
614 Ga0495669_0001145 3300046684 Bacteria 10993
615 Ga0495613_0026824 3300046689 Bacteria 4290
616 Ga0495613_0111034 3300046689 Bacteria 1975
617 Ga0495624_0004359 3300046690 Bacteria 10375
618 Ga0495624_0020490 3300046690 Bacteria 4400
619 Ga0495624_0083235 3300046690 Bacteria 1979
620 Ga0495670_0000859 3300046691 Bacteria 14714
621 Ga0495670_0045941 3300046691 Bacteria 2180
622 Ga0495671_0000087 3300046692 Bacteria 87327
623 Ga0495671_0000605 3300046692 Bacteria 26398
624 Ga0495671_0003108 3300046692 Bacteria 10317
625 Ga0495671_0003330 3300046692 Bacteria 9927
626 Ga0495671_0003550 3300046692 Bacteria 9532
627 Ga0495671_0038095 3300046692 Bacteria 2431
628 Ga0495649_0000194 3300046694 Bacteria 53689
629 Ga0495649_0000702 3300046694 Bacteria 27319
630 Ga0495649_0016852 3300046694 Bacteria 4136
631 Ga0495649_0027581 3300046694 Bacteria 3150
632 Ga0495589_0001516 3300046794 Bacteria 13354
633 Ga0495589_0018768 3300046794 Bacteria 3545
634 Ga0495660_0004751 3300046810 Bacteria 8199
635 Ga0495660_0028271 3300046810 Bacteria 3169
636 Ga0495581_0001539 3300047315 Bacteria 12859
637 Ga0495604_0053804 3300047317 Bacteria 3109
638 Ga0495604_0071554 3300047317 Bacteria 2623
639 Ga0495636_0003424 3300047318 Bacteria 6152
640 Ga0495636_0004254 3300047318 Bacteria 5617
641 Ga0495636_0011954 3300047318 Bacteria 3439
642 Ga0495636_0120545 3300047318 Bacteria 1160
643 Ga0495672_0000013 3300047320 Bacteria 511827
644 Ga0495672_0000064 3300047320 Bacteria 195158
645 Ga0495672_0000512 3300047320 Bacteria 44570
646 Ga0495672_0001189 3300047320 Bacteria 26357
647 Ga0495672_0004405 3300047320 Bacteria 11546
648 Ga0495672_0033064 3300047320 Bacteria 3208
649 Ga0495672_0084898 3300047320 Bacteria 1755
650 Ga0495676_0000015 3300047321 Bacteria 199492
651 Ga0495680_0058066 3300047322 Bacteria 2991
652 Ga0495683_0000036 3300047323 Bacteria 144974
653 Ga0495683_0005881 3300047323 Bacteria 6742
654 Ga0495683_0006168 3300047323 Bacteria 6571
655 Ga0495683_0035949 3300047323 Bacteria 2516
656 Ga0495687_000057 3300047443 Bacteria 186224
657 Ga0495687_001055 3300047443 Bacteria 27247
658 Ga0495687_001122 3300047443 Bacteria 26027
659 Ga0495687_007401 3300047443 Bacteria 6469
660 Ga0495677_0000948 3300047445 Bacteria 11680
661 Ga0495677_0005204 3300047445 Bacteria 4948
662 Ga0495677_0005995 3300047445 Bacteria 4600
663 Ga0495679_001332 3300047446 Bacteria 14284
664 Ga0495679_019405 3300047446 Bacteria 2389
665 Ga0495685_000299 3300047447 Bacteria 16305
666 Ga0495685_032368 3300047447 Bacteria 1796
667 Ga0495673_0000069 3300047469 Bacteria 218170
668 Ga0495673_0000203 3300047469 Bacteria 89918
669 Ga0495673_0000236 3300047469 Bacteria 79618
670 Ga0495681_0001009 3300047470 Bacteria 21583
671 Ga0495686_0000620 3300047472 Bacteria 48981
672 Ga0495686_0001028 3300047472 Bacteria 33622
673 Ga0495686_0006069 3300047472 Bacteria 9368
674 Ga0495686_0065437 3300047472 Bacteria 2247
675 Ga0495686_0066701 3300047472 Bacteria 2223
676 Ga0495615_0004412 3300048090 Bacteria 2456
677 Ga0495626_0000998 3300048091 Bacteria 24336
678 Ga0495626_0001757 3300048091 Bacteria 16497
679 Ga0495626_0002805 3300048091 Bacteria 11678
680 Ga0495626_0005031 3300048091 Bacteria 7893
681 Ga0495626_0021084 3300048091 Bacteria 3239
682 Ga0495626_0023637 3300048091 Bacteria 3022
683 Ga0495626_0052127 3300048091 Bacteria 1886
684 Ga0495626_0094330 3300048091 Bacteria 1312
685 Ga0496101_0088835 3300048904 Bacteria 2296
686 Ga0496102_0000068 3300048905 Bacteria 156306
687 Ga0496102_0000478 3300048905 Bacteria 44372
688 Ga0496102_0003174 3300048905 Bacteria 13940
689 Ga0496102_0008640 3300048905 Bacteria 8741
690 Ga0496102_0017344 3300048905 Bacteria 6306
691 Ga0496102_0060082 3300048905 Bacteria 3477
692 Ga0496102_0292601 3300048905 Bacteria 1535
693 Ga0496103_0039346 3300048906 Bacteria 2905
694 Ga0496104_0072060 3300048907 Bacteria 3285
695 Ga0496104_0247654 3300048907 Bacteria 1695
696 Ga0496107_0131596 3300048910 Bacteria 1847
697 Ga0496108_0232857 3300048911 Bacteria 1602
698 Ga0496108_0248307 3300048911 Bacteria 1548
699 Ga0496109_0010698 3300048912 Bacteria 7850
700 Ga0496110_0000092 3300048913 Bacteria 48035
701 Ga0496110_0067148 3300048913 Bacteria 3173
702 Ga0496110_0313389 3300048913 Bacteria 1429
703 Ga0496111_0085754 3300048914 Bacteria 2303
704 Ga0496111_0104260 3300048914 Bacteria 2086
705 Ga0496112_0012572 3300048915 Bacteria 7778
706 Ga0496113_0009523 3300048916 Bacteria 6371
707 Ga0496114_0039685 3300048917 Bacteria 3896
708 Ga0496114_0079489 3300048917 Bacteria 2768
709 Ga0496116_0010336 3300048919 Bacteria 7838
710 Ga0496116_0044055 3300048919 Bacteria 3034
711 Ga0496116_0050153 3300048919 Bacteria 2783
712 Ga0496121_0018725 3300048924 Bacteria 6964
713 Ga0496121_0043951 3300048924 Bacteria 3862
714 Ga0496121_0057712 3300048924 Bacteria 3215
715 Ga0496121_0057725 3300048924 Bacteria 3215
716 Ga0496121_0106030 3300048924 Bacteria 2155
717 Ga0496121_0282190 3300048924 Bacteria 1135
718 Ga0496122_0003525 3300048925 Bacteria 20479
719 Ga0496122_0004616 3300048925 Bacteria 16951
720 Ga0496122_0020064 3300048925 Bacteria 6067
721 Ga0496122_0114896 3300048925 Bacteria 1755
722 Ga0496123_0000084 3300048926 Bacteria 187479
723 Ga0496123_0001425 3300048926 Bacteria 33435
724 Ga0496123_0003683 3300048926 Bacteria 16896
725 Ga0496123_0004216 3300048926 Bacteria 15340
726 Ga0496125_0000368 3300048928 Bacteria 84924
727 Ga0496125_0002558 3300048928 Bacteria 23425
728 Ga0496125_0089020 3300048928 Bacteria 2323
729 Ga0496125_0090062 3300048928 Bacteria 2304
730 Ga0496126_0114487 3300048929 Bacteria 2346
731 Ga0495678_000010 3300049459 Bacteria 357896
732 Ga0495678_000034 3300049459 Bacteria 207827
733 Ga0495678_000095 3300049459 Bacteria 109532
734 Ga0495678_000383 3300049459 Bacteria 44894
735 Ga0495678_001376 3300049459 Bacteria 19384
736 Ga0495678_009739 3300049459 Bacteria 4722
737 Ga0495678_013065 3300049459 Bacteria 3913
738 Ga0495678_013343 3300049459 Bacteria 3861
739 Ga0495682_0000089 3300049460 Bacteria 80020
740 Ga0495682_0000432 3300049460 Bacteria 29176
741 Ga0501031_0164943 3300049568 Bacteria 1448
742 Ga0501034_0015538 3300049571 Bacteria 7819
743 Ga0501036_0005297 3300049572 Bacteria 10438
744 Ga0501038_0138702 3300049574 Bacteria 1991
745 Ga0501038_0242228 3300049574 Bacteria 1431
746 Ga0501040_0004246 3300049576 Bacteria 9326
747 Ga0501040_0034002 3300049576 Bacteria 3455
748 Ga0501041_0000171 3300049577 Bacteria 29019
749 Ga0501041_0015653 3300049577 Bacteria 4505
750 Ga0501041_0187064 3300049577 Bacteria 1297
751 Ga0501042_0148935 3300049578 Bacteria 1687
752 Ga0501042_0243691 3300049578 Bacteria 1297
753 Ga0501043_0070467 3300049579 Bacteria 2746
754 Ga0501046_0283386 3300049580 Bacteria 1213
755 Ga0501048_0002988 3300049582 Bacteria 12906
756 Ga0501048_0192145 3300049582 Bacteria 1447
757 Ga0501069_0053281 3300049585 Bacteria 2253
758 Ga0501070_0002373 3300049586 Bacteria 16519
759 Ga0501071_0075261 3300049587 Bacteria 2464
760 Ga0501072_0001613 3300049588 Bacteria 16851
761 Ga0501072_0002668 3300049588 Bacteria 13378
762 Ga0501073_0235668 3300049589 Bacteria 1264
763 Ga0501075_0006883 3300049591 Bacteria 7852
764 Ga0501076_0000429 3300049592 Bacteria 26487
765 Ga0501076_0003325 3300049592 Bacteria 11276
766 Ga0501077_0201709 3300049593 Bacteria 1264
767 Ga0501227_004729 3300049665 Bacteria 2921
768 Ga0501238_001560 3300049671 Bacteria 2659
769 Ga0501079_0046536 3300049741 Bacteria 3347
770 Ga0501080_0016392 3300049742 Bacteria 6844
771 Ga0501081_0000857 3300049743 Bacteria 17972
772 Ga0501279_002860 3300049775 Bacteria 2250
773 Ga0501035_0006010 3300049822 Bacteria 11433
774 Ga0501035_0290214 3300049822 Bacteria 1381
775 nmdc:mga0k408_40413_c1 3300050493 Bacteria 2684
776 nmdc:mga0k408_49769_c1 3300050493 Bacteria 2426
777 nmdc:mga07m45_666_c1 3300050496 Bacteria 14578
778 nmdc:mga07m45_68728_c1 3300050496 Bacteria 2014
779 nmdc:mga0qj67_10786_c1 3300050509 Bacteria 6834
780 nmdc:mga08y16_311260_c1 3300050511 Bacteria 1622
781 nmdc:mga08x19_17547_c1 3300050514 Bacteria 4381
782 nmdc:mga08x19_49650_c1 3300050514 Bacteria 2691
783 Ga0495601_0011317 3300053077 Bacteria 5332
784 Ga0495595_0131424 3300053084 Bacteria 1224
785 Ga0495619_0037112 3300053085 Bacteria 3174
786 Ga0500578_0000067 3300053086 Bacteria 115659
787 Ga0500593_004818 3300053117 Bacteria 5258
788 Ga0500618_000653 3300053125 Bacteria 20633
789 Ga0500574_000047 3300053141 Bacteria 14143
790 Ga0500586_000912 3300053145 Bacteria 6084
791 Ga0500619_000149 3300053154 Bacteria 17198
792 Ga0500570_079924 3300053724 Bacteria 1479
793 Ga0501084_0013441 3300054114 Bacteria 6774
794 Ga0501082_0002703 3300060353 Bacteria 15476
795 Ga0466962_0015221 3300061719 Bacteria 3709
796 Ga0530510_0001659 3300061734 Bacteria 15060
797 Ga0530510_0008175 3300061734 Bacteria 7296
798 2511250315 2511231003 Bacteria 5606035
799 2511387579 2511231026 Bacteria 5225445
800 2513956583 2513237150 Bacteria 6553639
801 2514044119 2513237165 Bacteria 6771773
802 2521559829 2521172590 Bacteria 5047645
803 2526212642 2526164512 Bacteria 4025691
804 2550693194 2548876994 Bacteria 4904866
805 2553007037 2551306416 Bacteria 6152985
806 2587758017 2585428062 Bacteria 6842168
807 2601672276 2600255292 Bacteria 6300551
808 2643791755 2643221554 Bacteria 6603920
809 2643968460 2643221592 Bacteria 6608788
810 2644027058 2643221603 Bacteria 6147767
811 2644140748 2643221625 Bacteria 6512927
812 2644216766 2643221638 Bacteria 6579467
813 2644245283 2643221644 Bacteria 6865017
814 2644254524 2643221645 Bacteria 7207331
815 2644272732 2643221648 Bacteria 6521465
816 2644360071 2643221664 Bacteria 7272945
817 2738742904 2738541280 Bacteria 6630198
818 2738827055 2738541297 Bacteria 6549566
819 2738845992 2738541300 Bacteria 6675882
820 2739150852 2738541357 Bacteria 6549408
821 2739192771 2738543003 Bacteria 6549560
822 2739276900 2738543018 Bacteria 6718814
823 2739319248 2738543026 Bacteria 6549408
824 2739337489 2738543029 Bacteria 6549249
825 2739345944 2738543030 Bacteria 6719714
826 2765571085 2765235838 Bacteria 5445269
827 2808984993 2808606386 Bacteria 4471946
828 2809130125 2808606415 Bacteria 4576710
829 2809150398 2808606419 Bacteria 4576925
830 2819544568 2818991436 Bacteria 5376622
831 2819594068 2818991445 Bacteria 4955017
832 2819618262 2818991449 Bacteria 5518009
833 2821136475 2821131069 Bacteria 6108407
834 2839096681 2839094727 Bacteria 5534556
835 2842713692 2842711865 Bacteria 7155354
836 2852621378 2852618963 Bacteria 4577824
837 2857549307 2857547612 Bacteria 6179999
838 2857558524 2857553236 Bacteria 6166726
839 2857562339 2857558681 Bacteria 6617694
840 2884815181 2884811622 Bacteria 5552861
841 2884839895 2884836552 Bacteria 5219991
842 2884856294 2884852848 Bacteria 5221161
843 2885081347 2885080285 Bacteria 6355622
844 2896158659 2896154374 Bacteria 5221518
845 2904428567 2904424332 Bacteria 7633521
846 2904444395 2904439833 Bacteria 5931679
847 2904535548 2904530477 Bacteria 5876334
848 2904588120 2904584206 Bacteria 6028872
849 2904595156 2904589729 Bacteria 6113573
850 2904606069 2904601388 Bacteria 5884906
851 2919051305 2919046199 Bacteria 5567169
852 2919084267 2919079590 Bacteria 5946433
853 2919477224 2919476304 Bacteria 5888696
854 2923513596 2923510766 Bacteria 5926163
855 2928135287 2928130867 Bacteria 5467269
856 2932416361 2932410948 Bacteria 6312192
857 2932422246 2932416698 Bacteria 6315112
858 2998347185 2998344455 Bacteria 4222996
859 644749093 644736347 Bacteria 6476522
860 Ga0395905_0044844
861 JGI25155J39150_1000336
862 JGI25155J39150_1000485
863 JGI25156J39149_1000063
864 JGI25156J39149_1000267
865 JGI25154J39366_1000412
866 JGI25154J39366_1000739
867 JGI25154J39366_1000845
868 JGI25154J39366_1001209
869 JGI25154J39366_1002200
870 JGI25158J39367_1003079
871 JGI25157J39369_1000082
872 JGI25157J39369_1000372
873 JGI25157J39369_1000495
874 JGI25152J39213_1000953
875 JGI25150J39212_1000910
876 JGI25150J39212_1003626
877 JGI25159J45721_1002200
878 JGI25151J46595_10001452
879 JGI25153J46596_10018531
880 JGI25160J50197_1003453
881 Ga0055538_1000062
882 Ga0055539_1000093
883 Ga0055539_1000303
884 Ga0055539_1000782
885 Ga0055533_1000043
886 Ga0055533_1000105
887 Ga0055532_1000034
888 Ga0055525_1000018
889 Ga0055525_1000137
890 Ga0055525_1001495
891 Ga0055535_1000859
892 Ga0055529_1000152
893 Ga0055529_1000725
894 Ga0055526_1000079
895 Ga0055526_1000690
896 Ga0055526_1001033
897 Ga0055526_1003493
898 Ga0055537_1000580
899 Ga0055537_1002871
900 Ga0055524_1000237
901 Ga0055524_1000899
902 Ga0055524_1001534
903 Ga0055524_1003281
904 Ga0055524_1008782
905 Ga0055524_1015153
906 Ga0055536_1000249
907 Ga0055534_1000283
908 Ga0055534_1003569
909 Ga0055534_1005272
910 Ga0055528_1000495
911 Ga0055528_1002751
912 Ga0055530_10005914
913 Ga0055530_10006075
914 Ga0055530_10006432
915 Ga0055530_10023984
916 Ga0055531_10020369
917 Ga0055531_10034762
918 Ga0055541_1000063
919 Ga0055543_1001129
920 Ga0055543_1003826
921 Ga0065165_1002857
922 Ga0065165_1003337
923 Ga0065165_1004075
924 Ga0070658_10124620
925 Ga0070676_10128521
926 Ga0070690_100037236
927 Ga0070670_100086718
928 Ga0070680_100167915
929 Ga0070660_100016657
930 Ga0070660_100044451
931 Ga0070687_100031300
932 Ga0070671_100026430
933 Ga0070673_100032700
934 Ga0070688_100052640
935 Ga0070659_100001752
936 Ga0070714_100135023
937 Ga0070705_100041313
938 Ga0070694_100004413
939 Ga0070662_100057197
940 Ga0070681_10014878
941 Ga0070699_100021479
942 Ga0070697_100149328
943 Ga0070695_100020091
944 Ga0070695_100051921
945 Ga0070704_100033986
946 Ga0070704_100129543
947 Ga0068855_100009264
948 Ga0068855_100035272
949 Ga0068855_100062362
950 Ga0068855_100120182
951 Ga0068855_100249658
952 Ga0068855_100317591
953 Ga0070664_100003553
954 Ga0068857_100004849
955 Ga0068857_100367839
956 Ga0068854_100017165
957 Ga0068854_100119599
958 Ga0068856_100002505
959 Ga0068856_100317250
960 Ga0068852_100004430
961 Ga0068864_100032966
962 Ga0068861_100036671
963 Ga0068863_100067354
964 Ga0068862_100019436
965 Ga0081539_10000365
966 Ga0075367_10043698
967 Ga0075366_10019447
968 Ga0075366_10066646
969 Ga0075370_10011458
970 Ga0075428_100301946
971 Ga0075430_100008118
972 Ga0075430_100011586
973 Ga0075430_100179064
974 Ga0075431_100039309
975 Ga0075431_100226597
976 Ga0068865_100001729
977 Ga0075436_100119909
978 Ga0079104_1000012
979 Ga0079104_1005592
980 Ga0099826_10000010
981 Ga0099826_10000024
982 Ga0099794_10016101
983 Ga0105251_10007888
984 Ga0105244_10003441
985 Ga0105244_10035827
986 Ga0105240_10001608
987 Ga0105240_10016336
988 Ga0105240_10158169
989 Ga0105240_10161523
990 Ga0105240_10190542
991 Ga0111539_10335889
992 Ga0114129_10589096
993 Ga0105248_10004608
994 Ga0105237_10010944
995 Ga0105237_10359562
996 Ga0105238_10000763
997 Ga0105239_10010387
998 Ga0105246_10023704
999 Ga0157371_10000018
1000 Ga0157369_10019171
1001 Ga0157378_10007501
1002 Ga0182008_10056599
1003 Ga0182006_1000033
1004 Ga0182006_1000080
1005 Ga0182006_1025436
1006 Ga0182007_10000042
1007 Ga0182007_10005353
1008 Ga0182007_10021481
1009 Ga0182005_1000016
1010 Ga0182005_1000024
1011 Ga0163161_10012023
1012 Ga0163161_10012229
1013 Ga0213872_10047661
1014 Ga0213872_10049654
1015 Ga0209435_100007
1016 Ga0209435_100176
1017 Ga0209436_100769
1018 Ga0209436_104031
1019 Ga0209784_100021
1020 Ga0209566_100119
1021 Ga0209674_100036
1022 Ga0209674_100067
1023 Ga0209147_100017
1024 Ga0209563_100011
1025 Ga0209563_100040
1026 Ga0209563_100068
1027 Ga0207427_101402
1028 Ga0209437_100332
1029 Ga0209258_100129
1030 Ga0209258_101277
1031 Ga0209258_101777
1032 Ga0207425_1000021
1033 Ga0207425_1000050
1034 Ga0207425_1000829
1035 Ga0209646_1000044
1036 Ga0209646_1000107
1037 Ga0209646_1000190
1038 Ga0209646_1000244
1039 Ga0209026_1000004
1040 Ga0209026_1000063
1041 Ga0209677_100023
1042 Ga0209677_100049
1043 Ga0209677_100413
1044 Ga0209759_1000003
1045 Ga0209759_1000048
1046 Ga0209759_1000198
1047 Ga0209759_1003928
1048 Ga0209759_1004764
1049 Ga0209759_1020166
1050 Ga0209129_1000020
1051 Ga0209565_1000055
1052 Ga0209565_1000677
1053 Ga0209565_1009659
1054 Ga0209565_1011047
1055 Ga0209455_1000070
1056 Ga0209455_1000083
1057 Ga0209673_1000040
1058 Ga0209673_1003338
1059 Ga0209673_1004762
1060 Ga0209130_1000169
1061 Ga0209130_1002260
1062 Ga0209130_1006585
1063 Ga0209675_1000052
1064 Ga0209675_1000156
1065 Ga0209675_1000753
1066 Ga0209675_1001299
1067 Ga0209675_1003114
1068 Ga0209676_1000364
1069 Ga0209025_1000417
1070 Ga0209025_1000473
1071 Ga0209025_1000516
1072 Ga0209025_1001876
1073 Ga0209025_1002453
1074 Ga0209564_1000027
1075 Ga0209564_1000047
1076 Ga0209564_1000063
1077 Ga0209564_1000271
1078 Ga0209564_1000658
1079 Ga0209564_1000709
1080 Ga0209564_1001666
1081 Ga0209758_1000288
1082 Ga0209758_1000436
1083 Ga0209050_1000050
1084 Ga0209050_1000335
1085 Ga0209050_1001698
1086 Ga0209256_1000045
1087 Ga0209256_1000054
1088 Ga0209256_1000079
1089 Ga0209256_1000100
1090 Ga0209256_1000754
1091 Ga0209256_1001531
1092 Ga0209256_1003694
1093 Ga0209256_1035264
1094 Ga0207426_1003112
1095 Ga0209051_1006479
1096 Ga0209051_1017263
1097 Ga0209051_1028245
1098 Ga0209257_1001336
1099 Ga0207696_1053792
1100 Ga0207655_1001651
1101 Ga0207713_1064026
1102 Ga0207699_10201555
1103 Ga0207645_10053286
1104 Ga0207695_10008939
1105 Ga0207695_10012318
1106 Ga0207695_10025241
1107 Ga0207695_10070196
1108 Ga0207695_10136114
1109 Ga0207671_10004652
1110 Ga0207671_10092910
1111 Ga0207660_10078923
1112 Ga0207662_10041525
1113 Ga0207662_10109316
1114 Ga0207657_10008924
1115 Ga0207657_10012688
1116 Ga0207649_10024118
1117 Ga0207694_10000343
1118 Ga0207650_10063319
1119 Ga0207690_10000951
1120 Ga0207706_10051130
1121 Ga0207709_10039485
1122 Ga0207704_10018780
1123 Ga0207711_10036832
1124 Ga0207689_10018288
1125 Ga0207689_10050545
1126 Ga0207679_10004406
1127 Ga0207667_10000912
1128 Ga0207667_10007366
1129 Ga0207667_10041134
1130 Ga0207667_10067556
1131 Ga0207667_10098677
1132 Ga0207667_10228908
1133 Ga0207651_10014547
1134 Ga0207640_10041316
1135 Ga0207640_10074203
1136 Ga0207703_10187047
1137 Ga0207702_10001231
1138 Ga0207648_10210122
1139 Ga0207674_10090346
1140 Ga0207698_10284985
1141 Ga0209281_1000039
1142 Ga0209282_1000009
1143 Ga0209282_1000032
1144 Ga0209971_1014001
1145 Ga0209974_10048755
1146 Ga0209974_10051497
1147 Ga0268265_10009579
1148 Ga0268264_10084747
1149 Ga0265336_10000371
1150 Ga0307517_10163511
1151 Ga0307515_10001889
1152 Ga0307515_10062795
1153 Ga0307515_10137784
1154 Ga0307515_10209697
1155 Ga0265324_10004594
1156 Ga0265324_10026135
1157 Ga0316181_1137224
1158 Ga0316182_1156105
1159 Ga0265330_10009515
1160 Ga0265332_10000253
1161 Ga0265325_10006633
1162 Ga0265329_10001506
1163 Ga0265331_10004185
1164 Ga0265327_10015618
1165 Ga0265327_10020732
1166 Ga0265316_10004517
1167 Ga0265316_10114733
1168 Ga0307408_100000432
1169 Ga0307408_100002407
1170 Ga0307408_100010617
1171 Ga0307408_100227442
1172 Ga0307408_100253356
1173 Ga0307408_100275698
1174 Ga0307508_10018336
1175 Ga0265314_10008929
1176 Ga0265314_10017740
1177 Ga0307516_10000048
1178 Ga0307516_10002257
1179 Ga0307516_10030751
1180 Ga0307412_10282814
1181 Ga0307416_100000975
1182 Ga0373926_0010863
1183 Ga0373928_0015985
1184 Ga0373943_0180795
1185 Ga0373955_0080618
1186 Ga0373924_0006584
1187 Ga0373931_0015826
1188 Ga0373933_0039388
1189 Ga0373937_0001073
1190 Ga0395899_0002806
1191 Ga0395899_0003830
1192 Ga0395899_0018674
1193 Ga0395899_0030258
1194 Ga0395899_0179380
1195 Ga0395900_0000904
1196 Ga0395900_0006506
1197 Ga0395900_0031672
1198 Ga0395900_0035466
1199 Ga0395900_0285887
1200 Ga0395900_0334820
1201 Ga0395898_0001196
1202 Ga0395898_0144923
1203 Ga0395905_0000161
1204 Ga0395905_0010442
1205 Ga0395905_0021728
1206 Ga0395905_0027336
1207 Ga0395905_0036632
1208 Ga0395905_0055914
1209 Ga0395905_0068537
1210 Ga0395901_0002710
1211 Ga0395901_0002897
1212 Ga0395901_0005821
1213 Ga0395901_0066242
1214 Ga0395901_0403054
1215 Ga0395901_0410996
1216 Ga0400490_04196
1217 Ga0436361_0013073
1218 Ga0436361_0303014
1219 Ga0436361_0314274
1220 Ga0436361_0319505
1221 Ga0436361_0511425
1222 Ga0436361_0865310
1223 Ga0436361_0930389
1224 Ga0436361_1142583
1225 Ga0436361_1189474
1226 Ga0451789_1013970
1227 Ga0439441_009995
1228 Ga0439451_028011
1229 Ga0450898_004347
1230 Ga0439446_0016659
1231 Ga0439435_0028631
1232 Ga0439460_0011810
1233 Ga0451577_0070287
1234 Ga0451577_0084653
1235 Ga0466969_0002316
1236 Ga0466969_0007117
1237 Ga0466972_0000420
1238 Ga0466972_0003973
1239 Ga0466972_0011040
1240 Ga0466972_0065816
1241 Ga0466965_0002121
1242 Ga0466965_0019993
1243 Ga0466965_0020012
1244 Ga0466965_0029552
1245 Ga0466965_0036795
1246 Ga0466966_0001854
1247 Ga0466966_0029228
1248 Ga0466966_0029262
1249 Ga0466961_0007476
1250 Ga0466961_0027488
1251 Ga0466964_0004187
1252 Ga0466964_0045872
1253 Ga0466971_0008161
1254 Ga0466971_0018165
1255 Ga0466968_0003902
1256 Ga0466970_0002134
1257 Ga0466957_0001920
1258 Ga0466957_0015104
1259 Ga0466957_0076144
1260 Ga0466957_0133066
1261 Ga0466959_0001954
1262 Ga0466959_0025858
1263 Ga0466959_0068023
1264 Ga0466959_0093076
1265 Ga0451576_0001583
1266 Ga0451576_0082220
1267 Ga0451576_0291462
1268 Ga0466958_0070166
1269 Ga0495617_000022
1270 Ga0495617_000075
1271 Ga0495617_001209
1272 Ga0495617_018396
1273 Ga0495627_000011
1274 Ga0495627_000398
1275 Ga0495592_0002825
1276 Ga0495603_0044746
1277 Ga0495603_0046856
1278 Ga0495590_0000057
1279 Ga0495590_0000143
1280 Ga0495590_0005737
1281 Ga0495591_000799
1282 Ga0495629_0020396
1283 Ga0495629_0041378
1284 Ga0495638_0001680
1285 Ga0495651_0002596
1286 Ga0495653_0000044
1287 Ga0495653_0028893
1288 Ga0495653_0062600
1289 Ga0495650_0000082
1290 Ga0495650_0000100
1291 Ga0495650_0001173
1292 Ga0495650_0001749
1293 Ga0495650_0002119
1294 Ga0495650_0008196
1295 Ga0495650_0012103
1296 Ga0495582_0027191
1297 Ga0495582_0038957
1298 Ga0495605_0000098
1299 Ga0495605_0000153
1300 Ga0495605_0002046
1301 Ga0495605_0020353
1302 Ga0495605_0037236
1303 Ga0495584_0000232
1304 Ga0495584_0000729
1305 Ga0495584_0002317
1306 Ga0495584_0009911
1307 Ga0495584_0067745
1308 Ga0495584_0094799
1309 Ga0495584_0147235
1310 Ga0495585_0000023
1311 Ga0495585_0000152
1312 Ga0495585_0000444
1313 Ga0495585_0022247
1314 Ga0495585_0036679
1315 Ga0495585_0063062
1316 Ga0495585_0065031
1317 Ga0495585_0142084
1318 Ga0495594_0068128
1319 Ga0495596_0000032
1320 Ga0495596_0000683
1321 Ga0495596_0001270
1322 Ga0495596_0004904
1323 Ga0495596_0019014
1324 Ga0495596_0039062
1325 Ga0495596_0047804
1326 Ga0495607_0009757
1327 Ga0495607_0013841
1328 Ga0495607_0034462
1329 Ga0495607_0053231
1330 Ga0495607_0060494
1331 Ga0495583_0000106
1332 Ga0495583_0000150
1333 Ga0495583_0000517
1334 Ga0495583_0000597
1335 Ga0495583_0001383
1336 Ga0495583_0001918
1337 Ga0495606_0000080
1338 Ga0495606_0000090
1339 Ga0495606_0000099
1340 Ga0495606_0000524
1341 Ga0495606_0000600
1342 Ga0495606_0001629
1343 Ga0495606_0002603
1344 Ga0495606_0086803
1345 Ga0495608_0026406
1346 Ga0495608_0026533
1347 Ga0495608_0127594
1348 Ga0495610_0000017
1349 Ga0495610_0000668
1350 Ga0495610_0002272
1351 Ga0495610_0013362
1352 Ga0495610_0043732
1353 Ga0495616_0000490
1354 Ga0495616_0002388
1355 Ga0495616_0004647
1356 Ga0495616_0006823
1357 Ga0495616_0016924
1358 Ga0495616_0018885
1359 Ga0495616_0029168
1360 Ga0495616_0034548
1361 Ga0495616_0073217
1362 Ga0495618_0063746
1363 Ga0495628_0000382
1364 Ga0495628_0002078
1365 Ga0495630_0246662
1366 Ga0495631_0001332
1367 Ga0495631_0001436
1368 Ga0495631_0023308
1369 Ga0495631_0065120
1370 Ga0495632_0000052
1371 Ga0495632_0000396
1372 Ga0495632_0001555
1373 Ga0495632_0003734
1374 Ga0495632_0012494
1375 Ga0495632_0013833
1376 Ga0495637_0000018
1377 Ga0495637_0000195
1378 Ga0495643_0000109
1379 Ga0495643_0000250
1380 Ga0495643_0001163
1381 Ga0495643_0003256
1382 Ga0495643_0021689
1383 Ga0495643_0025569
1384 Ga0495643_0039737
1385 Ga0495644_0001124
1386 Ga0495644_0003935
1387 Ga0495648_0001108
1388 Ga0495648_0001296
1389 Ga0495648_0001297
1390 Ga0495648_0001425
1391 Ga0495648_0003753
1392 Ga0495648_0012427
1393 Ga0495648_0012934
1394 Ga0495648_0015868
1395 Ga0495648_0030615
1396 Ga0495666_0006871
1397 Ga0495666_0007557
1398 Ga0495642_0000529
1399 Ga0495642_0002545
1400 Ga0495642_0003891
1401 Ga0495642_0004563
1402 Ga0495642_0011219
1403 Ga0495642_0014230
1404 Ga0495642_0042536
1405 Ga0495642_0068412
1406 Ga0495654_0000030
1407 Ga0495654_0018430
1408 Ga0495654_0021405
1409 Ga0495654_0031775
1410 Ga0495665_0001301
1411 Ga0495665_0024697
1412 Ga0495665_0034596
1413 Ga0495586_0115342
1414 Ga0495587_0051879
1415 Ga0495598_0015527
1416 Ga0495609_0002820
1417 Ga0495609_0005405
1418 Ga0495609_0007869
1419 Ga0495609_0008324
1420 Ga0495621_0013856
1421 Ga0495597_0001115
1422 Ga0495597_0001285
1423 Ga0495597_0001411
1424 Ga0495597_0002378
1425 Ga0495597_0018630
1426 Ga0495597_0022362
1427 Ga0495597_0073848
1428 Ga0495645_0068890
1429 Ga0495622_0000044
1430 Ga0495622_0004973
1431 Ga0495633_0000917
1432 Ga0495633_0003343
1433 Ga0495633_0006937
1434 Ga0495633_0059388
1435 Ga0495668_0000035
1436 Ga0495668_0000211
1437 Ga0495668_0000286
1438 Ga0495668_0000939
1439 Ga0495668_0001545
1440 Ga0495668_0004452
1441 Ga0495668_0004605
1442 Ga0495668_0012596
1443 Ga0495668_0097325
1444 Ga0495611_0001030
1445 Ga0495611_0003988
1446 Ga0495611_0006487
1447 Ga0495611_0012387
1448 Ga0495611_0024927
1449 Ga0495611_0050001
1450 Ga0495625_0000338
1451 Ga0495625_0001765
1452 Ga0495625_0002807
1453 Ga0495625_0016076
1454 Ga0495625_0032153
1455 Ga0495625_0032657
1456 Ga0495659_0000139
1457 Ga0495659_0006513
1458 Ga0495659_0012720
1459 Ga0495659_0021812
1460 Ga0495661_0004739
1461 Ga0495661_0014026
1462 Ga0495661_0028811
1463 Ga0495661_0064889
1464 Ga0495661_0146768
1465 Ga0495588_0056552
1466 Ga0495599_0009879
1467 Ga0495623_0019111
1468 Ga0495647_0004533
1469 Ga0495647_0034374
1470 Ga0495658_0216304
1471 Ga0495669_0000101
1472 Ga0495669_0000495
1473 Ga0495669_0001145
1474 Ga0495613_0026824
1475 Ga0495613_0111034
1476 Ga0495624_0004359
1477 Ga0495624_0020490
1478 Ga0495624_0083235
1479 Ga0495670_0000859
1480 Ga0495670_0045941
1481 Ga0495671_0000087
1482 Ga0495671_0000605
1483 Ga0495671_0003108
1484 Ga0495671_0003330
1485 Ga0495671_0003550
1486 Ga0495671_0038095
1487 Ga0495649_0000194
1488 Ga0495649_0000702
1489 Ga0495649_0016852
1490 Ga0495649_0027581
1491 Ga0495589_0001516
1492 Ga0495589_0018768
1493 Ga0495660_0004751
1494 Ga0495660_0028271
1495 Ga0495581_0001539
1496 Ga0495604_0053804
1497 Ga0495604_0071554
1498 Ga0495636_0003424
1499 Ga0495636_0004254
1500 Ga0495636_0011954
1501 Ga0495636_0120545
1502 Ga0495672_0000013
1503 Ga0495672_0000064
1504 Ga0495672_0000512
1505 Ga0495672_0001189
1506 Ga0495672_0004405
1507 Ga0495672_0033064
1508 Ga0495672_0084898
1509 Ga0495676_0000015
1510 Ga0495680_0058066
1511 Ga0495683_0000036
1512 Ga0495683_0005881
1513 Ga0495683_0006168
1514 Ga0495683_0035949
1515 Ga0495687_000057
1516 Ga0495687_001055
1517 Ga0495687_001122
1518 Ga0495687_007401
1519 Ga0495677_0000948
1520 Ga0495677_0005204
1521 Ga0495677_0005995
1522 Ga0495679_001332
1523 Ga0495679_019405
1524 Ga0495685_000299
1525 Ga0495685_032368
1526 Ga0495673_0000069
1527 Ga0495673_0000203
1528 Ga0495673_0000236
1529 Ga0495681_0001009
1530 Ga0495686_0000620
1531 Ga0495686_0001028
1532 Ga0495686_0006069
1533 Ga0495686_0065437
1534 Ga0495686_0066701
1535 Ga0495615_0004412
1536 Ga0495626_0000998
1537 Ga0495626_0001757
1538 Ga0495626_0002805
1539 Ga0495626_0005031
1540 Ga0495626_0021084
1541 Ga0495626_0023637
1542 Ga0495626_0052127
1543 Ga0495626_0094330
1544 Ga0496101_0088835
1545 Ga0496102_0000068
1546 Ga0496102_0000478
1547 Ga0496102_0003174
1548 Ga0496102_0008640
1549 Ga0496102_0017344
1550 Ga0496102_0060082
1551 Ga0496102_0292601
1552 Ga0496103_0039346
1553 Ga0496104_0072060
1554 Ga0496104_0247654
1555 Ga0496107_0131596
1556 Ga0496108_0232857
1557 Ga0496108_0248307
1558 Ga0496109_0010698
1559 Ga0496110_0000092
1560 Ga0496110_0067148
1561 Ga0496110_0313389
1562 Ga0496111_0085754
1563 Ga0496111_0104260
1564 Ga0496112_0012572
1565 Ga0496113_0009523
1566 Ga0496114_0039685
1567 Ga0496114_0079489
1568 Ga0496116_0010336
1569 Ga0496116_0044055
1570 Ga0496116_0050153
1571 Ga0496121_0018725
1572 Ga0496121_0043951
1573 Ga0496121_0057712
1574 Ga0496121_0057725
1575 Ga0496121_0106030
1576 Ga0496121_0282190
1577 Ga0496122_0003525
1578 Ga0496122_0004616
1579 Ga0496122_0020064
1580 Ga0496122_0114896
1581 Ga0496123_0000084
1582 Ga0496123_0001425
1583 Ga0496123_0003683
1584 Ga0496123_0004216
1585 Ga0496125_0000368
1586 Ga0496125_0002558
1587 Ga0496125_0089020
1588 Ga0496125_0090062
1589 Ga0496126_0114487
1590 Ga0495678_000010
1591 Ga0495678_000034
1592 Ga0495678_000095
1593 Ga0495678_000383
1594 Ga0495678_001376
1595 Ga0495678_009739
1596 Ga0495678_013065
1597 Ga0495678_013343
1598 Ga0495682_0000089
1599 Ga0495682_0000432
1600 Ga0501031_0164943
1601 Ga0501034_0015538
1602 Ga0501036_0005297
1603 Ga0501038_0138702
1604 Ga0501038_0242228
1605 Ga0501040_0004246
1606 Ga0501040_0034002
1607 Ga0501041_0000171
1608 Ga0501041_0015653
1609 Ga0501041_0187064
1610 Ga0501042_0148935
1611 Ga0501042_0243691
1612 Ga0501043_0070467
1613 Ga0501046_0283386
1614 Ga0501048_0002988
1615 Ga0501048_0192145
1616 Ga0501069_0053281
1617 Ga0501070_0002373
1618 Ga0501071_0075261
1619 Ga0501072_0001613
1620 Ga0501072_0002668
1621 Ga0501073_0235668
1622 Ga0501075_0006883
1623 Ga0501076_0000429
1624 Ga0501076_0003325
1625 Ga0501077_0201709
1626 Ga0501227_004729
1627 Ga0501238_001560
1628 Ga0501079_0046536
1629 Ga0501080_0016392
1630 Ga0501081_0000857
1631 Ga0501279_002860
1632 Ga0501035_0006010
1633 Ga0501035_0290214
1634 nmdc:mga0k408_40413_c1
1635 nmdc:mga0k408_49769_c1
1636 nmdc:mga07m45_666_c1
1637 nmdc:mga07m45_68728_c1
1638 nmdc:mga0qj67_10786_c1
1639 nmdc:mga08y16_311260_c1
1640 nmdc:mga08x19_17547_c1
1641 nmdc:mga08x19_49650_c1
1642 Ga0495601_0011317
1643 Ga0495595_0131424
1644 Ga0495619_0037112
1645 Ga0500578_0000067
1646 Ga0500593_004818
1647 Ga0500618_000653
1648 Ga0500574_000047
1649 Ga0500586_000912
1650 Ga0500619_000149
1651 Ga0500570_079924
1652 Ga0501084_0013441
1653 Ga0501082_0002703
1654 Ga0466962_0015221
1655 Ga0530510_0001659
1656 Ga0530510_0008175
1657 2511250315
1658 2511387579
1659 2513956583
1660 2514044119
1661 2521559829
1662 2526212642
1663 2550693194
1664 2553007037
1665 2587758017
1666 2601672276
1667 2643791755
1668 2643968460
1669 2644027058
1670 2644140748
1671 2644216766
1672 2644245283
1673 2644254524
1674 2644272732
1675 2644360071
1676 2738742904
1677 2738827055
1678 2738845992
1679 2739150852
1680 2739192771
1681 2739276900
1682 2739319248
1683 2739337489
1684 2739345944
1685 2765571085
1686 2808984993
1687 2809130125
1688 2809150398
1689 2819544568
1690 2819594068
1691 2819618262
1692 2821136475
1693 2839096681
1694 2842713692
1695 2852621378
1696 2857549307
1697 2857558524
1698 2857562339
1699 2884815181
1700 2884839895
1701 2884856294
1702 2885081347
1703 2896158659
1704 2904428567
1705 2904444395
1706 2904535548
1707 2904588120
1708 2904595156
1709 2904606069
1710 2919051305
1711 2919084267
1712 2919477224
1713 2923513596
1714 2928135287
1715 2932416361
1716 2932422246
1717 2998347185
1718 644749093

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00591

Glycos_transf_3

Glycosyl transferase family, a/b domain

105

357

0.99

PF02885

Glycos_trans_3N

Glycosyl transferase family, helical bundle domain

35

97

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hkm-assembly1.cif.gz_A crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris 0.9835 18 355
4hkm-assembly2.cif.gz_B crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris 0.9825 18 355
4hkm-assembly2.cif.gz_B crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris 0.9708 18 355
4hkm-assembly1.cif.gz_A crystal structure of an anthranilate phosphoribosyltransferase (target id nysgrc-016600) from xanthomonas campestris 0.9682 18 355
1zyk-assembly2.cif.gz_B anthranilate phosphoribosyltransferase in complex with prpp, anthranilate and magnesium 0.965 18 352
ID Description Score Start End Superfamily
4hkmA02 Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 0.9856 88 355 3.40.1030.10
4yi7A01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9757 20 87 1.20.970.10
af_Q57686_71_335_3.40.1030.10 Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 0.9747 94 354 3.40.1030.10
af_K7WHC8_126_393_3.40.1030.10 Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 0.9746 90 353 3.40.1030.10
4gtnA01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9717 20 87 1.20.970.10
ID Description Score Start End GO Terms
AF-B2JHI7-F1-model_v4 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) 0.9955 18 355 GO:0000162
GO:0000287
GO:0004048
GO:0005829
AF-A0A1N6L9L8-F1-model_v4 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) 0.9954 16 355 GO:0000162
GO:0000287
GO:0004048
GO:0005829
AF-Q62DC9-F1-model_v4 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) 0.9953 16 355 GO:0000162
GO:0000287
GO:0004048
GO:0005829
AF-A0A244DQT8-F1-model_v4 deleted 0.9948 18 355
AF-A0A6N6W577-F1-model_v4 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) 0.9948 16 355 GO:0000162
GO:0000287
GO:0004048
GO:0005829

Map