F483792
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 859 | 454 | 808 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300046615|Ga0495656_0045688|Ga0495656_0045688_861_1232 |
| Length | 123 |
| Sequence | MCADGAPQGEFEMSDVQQRIDQLVKSNDVLLFMKGSASFPMCGFSGRAIQILKACGVDPRAVATVNVLEDDEIRQAIKDYSNWPTIPQLYVRGEFIGGSDIMMEMYQSGELQQVLGSTAGTQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 9 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 10 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 11 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 12 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 13 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 14 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 15 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 16 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 17 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 18 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 19 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 20 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 21 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 22 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 23 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 24 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 25 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 26 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 27 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 28 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 29 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 30 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 31 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 32 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 33 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 34 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 35 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 36 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 37 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 38 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 39 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 40 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 41 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 42 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 43 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 44 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 45 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 46 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 47 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 48 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 49 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 50 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 51 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 52 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 53 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 54 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 55 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 56 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 57 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 58 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 59 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 60 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 61 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 62 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 68 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 69 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 71 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 72 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 73 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 75 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 76 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 77 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 78 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 79 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 82 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 84 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 86 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 96 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 101 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 103 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 104 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 109 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 113 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 122 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 125 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 126 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 139 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 140 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 222 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 223 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 224 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 225 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 226 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 227 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 228 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 229 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 231 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 240 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 249 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 255 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 256 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 257 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 258 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 259 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 260 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 261 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 262 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 263 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 268 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 269 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 270 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 271 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 272 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 273 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 274 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 275 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 276 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 277 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 278 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 279 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 280 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 281 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 282 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 283 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 284 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 285 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 286 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 287 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 288 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 289 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 290 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 291 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 292 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 293 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 294 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 295 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 296 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 297 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 298 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 299 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 300 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 301 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 302 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 303 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 304 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 305 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 306 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 307 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 308 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 309 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 310 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 311 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 312 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 313 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 314 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 315 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 316 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 317 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 376 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 377 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 378 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 379 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 380 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 381 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 382 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 383 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 384 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 385 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 386 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 387 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 388 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 389 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 392 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 393 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 402 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 403 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 404 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 405 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 406 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 407 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 410 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 411 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 412 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 415 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 416 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 418 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 419 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 420 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 423 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 424 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 425 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 427 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 428 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 429 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 430 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 431 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 433 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 434 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 435 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 436 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 437 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 438 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 439 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 440 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 442 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 444 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 445 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 446 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 448 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 449 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 450 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 451 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.25 |
| Metatranscriptomes | 0.81 |
| Isolates | 5.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.03 |
| Nodule | 1.05 |
| Rhizoplane | 3.14 |
| Rhizosphere | 61.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC11605_b1 | 2010549000 | Bacteria | 793 |
| 2 | SwRhRL2b_contig_3060296 | 2162886007 | Bacteria | 1195 |
| 3 | JGI24739J22299_10013643 | 3300001989 | Bacteria | 2963 |
| 4 | JGI24739J22299_10138015 | 3300001989 | Bacteria | 723 |
| 5 | JGI25152J39213_1002889 | 3300002773 | Bacteria | 6135 |
| 6 | JGI25152J39213_1016851 | 3300002773 | Bacteria | 1396 |
| 7 | JGI25150J39212_1006078 | 3300002774 | Bacteria | 2524 |
| 8 | JGI25150J39212_1025694 | 3300002774 | Bacteria | 857 |
| 9 | JGI25159J45721_1001816 | 3300002987 | Bacteria | 8556 |
| 10 | JGI25159J45721_1002828 | 3300002987 | Bacteria | 6384 |
| 11 | JGI25159J45721_1033993 | 3300002987 | Bacteria | 793 |
| 12 | JGI25151J46595_10004995 | 3300003187 | Bacteria | 6914 |
| 13 | JGI25151J46595_10017825 | 3300003187 | Bacteria | 3066 |
| 14 | JGI25151J46595_10024337 | 3300003187 | Bacteria | 2479 |
| 15 | JGI25153J46596_10004350 | 3300003215 | Bacteria | 7645 |
| 16 | JGI25153J46596_10005841 | 3300003215 | Bacteria | 6384 |
| 17 | JGI25160J50197_1012388 | 3300003354 | Bacteria | 2962 |
| 18 | JGI25160J50197_1013852 | 3300003354 | Bacteria | 2728 |
| 19 | JGI25161J50226_1004882 | 3300003374 | Bacteria | 2728 |
| 20 | JGI25161J50226_1006067 | 3300003374 | Bacteria | 2237 |
| 21 | Ga0006562J51391_1023601 | 3300003578 | Bacteria | 3080 |
| 22 | Ga0006562J51391_1031095 | 3300003578 | Bacteria | 5610 |
| 23 | Ga0055527_1028814 | 3300003760 | Bacteria | 553 |
| 24 | Ga0055535_1000221 | 3300003761 | Bacteria | 60185 |
| 25 | Ga0055542_1000129 | 3300003762 | Bacteria | 99542 |
| 26 | Ga0055526_1017544 | 3300003771 | Bacteria | 2728 |
| 27 | Ga0055526_1040627 | 3300003771 | Bacteria | 1170 |
| 28 | Ga0055537_1000717 | 3300003773 | Bacteria | 17146 |
| 29 | Ga0055537_1007164 | 3300003773 | Bacteria | 2728 |
| 30 | Ga0055537_1015506 | 3300003773 | Bacteria | 1332 |
| 31 | Ga0055524_1015864 | 3300003775 | Bacteria | 2728 |
| 32 | Ga0055524_1016902 | 3300003775 | Bacteria | 2594 |
| 33 | Ga0055536_1006575 | 3300003781 | Bacteria | 5386 |
| 34 | Ga0055536_1009252 | 3300003781 | Bacteria | 4102 |
| 35 | Ga0055536_1009441 | 3300003781 | Bacteria | 4034 |
| 36 | Ga0055536_1010970 | 3300003781 | Bacteria | 3530 |
| 37 | Ga0055536_1061959 | 3300003781 | Bacteria | 771 |
| 38 | Ga0055534_1000337 | 3300003784 | Bacteria | 30592 |
| 39 | Ga0055534_1000467 | 3300003784 | Bacteria | 22933 |
| 40 | Ga0055534_1002468 | 3300003784 | Bacteria | 6384 |
| 41 | Ga0055534_1012342 | 3300003784 | Bacteria | 1692 |
| 42 | Ga0055528_1001984 | 3300003790 | Bacteria | 11532 |
| 43 | Ga0055528_1015651 | 3300003790 | Bacteria | 2728 |
| 44 | Ga0055528_1032456 | 3300003790 | Bacteria | 1332 |
| 45 | Ga0055528_1052237 | 3300003790 | Bacteria | 818 |
| 46 | Ga0055528_1089800 | 3300003790 | Bacteria | 529 |
| 47 | Ga0055530_10001548 | 3300003791 | Bacteria | 16519 |
| 48 | Ga0055530_10010358 | 3300003791 | Bacteria | 3455 |
| 49 | Ga0055540_1003024 | 3300003792 | Bacteria | 8408 |
| 50 | Ga0055540_1007603 | 3300003792 | Bacteria | 4052 |
| 51 | Ga0055540_1007907 | 3300003792 | Bacteria | 3917 |
| 52 | Ga0055540_1012195 | 3300003792 | Bacteria | 2716 |
| 53 | Ga0055540_1040378 | 3300003792 | Bacteria | 1011 |
| 54 | Ga0055540_1044687 | 3300003792 | Bacteria | 939 |
| 55 | Ga0055531_10000158 | 3300003794 | Bacteria | 77918 |
| 56 | Ga0055531_10002327 | 3300003794 | Bacteria | 12826 |
| 57 | Ga0055531_10008168 | 3300003794 | Bacteria | 5576 |
| 58 | Ga0055531_10027234 | 3300003794 | Bacteria | 2012 |
| 59 | Ga0055531_10043413 | 3300003794 | Bacteria | 1272 |
| 60 | Ga0055543_1002078 | 3300004625 | Bacteria | 6980 |
| 61 | Ga0065165_1005994 | 3300005262 | Bacteria | 6557 |
| 62 | Ga0065165_1006660 | 3300005262 | Bacteria | 5962 |
| 63 | Ga0065714_10068656 | 3300005288 | Bacteria | 4601 |
| 64 | Ga0065714_10084655 | 3300005288 | Bacteria | 2186 |
| 65 | Ga0065704_10433009 | 3300005289 | Bacteria | 721 |
| 66 | Ga0065707_10141451 | 3300005295 | Bacteria | 1767 |
| 67 | Ga0070658_10159049 | 3300005327 | Bacteria | 1895 |
| 68 | Ga0070658_10538782 | 3300005327 | Bacteria | 1010 |
| 69 | Ga0070658_10595729 | 3300005327 | Bacteria | 958 |
| 70 | Ga0070676_10591970 | 3300005328 | Bacteria | 799 |
| 71 | Ga0070690_100369457 | 3300005330 | Bacteria | 1046 |
| 72 | Ga0070677_10470703 | 3300005333 | Bacteria | 676 |
| 73 | Ga0070677_10728494 | 3300005333 | Bacteria | 561 |
| 74 | Ga0068869_101249725 | 3300005334 | Bacteria | 654 |
| 75 | Ga0070666_10276076 | 3300005335 | Bacteria | 1194 |
| 76 | Ga0070666_11104357 | 3300005335 | Bacteria | 590 |
| 77 | Ga0068868_100309726 | 3300005338 | Bacteria | 1343 |
| 78 | Ga0070660_100555832 | 3300005339 | Bacteria | 958 |
| 79 | Ga0070661_100239143 | 3300005344 | Bacteria | 1398 |
| 80 | Ga0070668_100434588 | 3300005347 | Bacteria | 1126 |
| 81 | Ga0070668_101596082 | 3300005347 | Bacteria | 598 |
| 82 | Ga0070669_100023404 | 3300005353 | Bacteria | 4423 |
| 83 | Ga0070669_100122889 | 3300005353 | Bacteria | 1983 |
| 84 | Ga0070674_100300173 | 3300005356 | Bacteria | 1280 |
| 85 | Ga0070674_100535004 | 3300005356 | Bacteria | 981 |
| 86 | Ga0070673_100747071 | 3300005364 | Bacteria | 901 |
| 87 | Ga0070673_100965950 | 3300005364 | Bacteria | 792 |
| 88 | Ga0070667_100062199 | 3300005367 | Bacteria | 3162 |
| 89 | Ga0070667_100319899 | 3300005367 | Bacteria | 1400 |
| 90 | Ga0070678_100025831 | 3300005456 | Bacteria | 3960 |
| 91 | Ga0070678_100508314 | 3300005456 | Bacteria | 1064 |
| 92 | Ga0070678_100766973 | 3300005456 | Bacteria | 873 |
| 93 | Ga0070662_100815638 | 3300005457 | Bacteria | 794 |
| 94 | Ga0070662_101731189 | 3300005457 | Bacteria | 540 |
| 95 | Ga0068867_101178652 | 3300005459 | Bacteria | 703 |
| 96 | Ga0068867_101277968 | 3300005459 | Bacteria | 677 |
| 97 | Ga0070685_10134774 | 3300005466 | Bacteria | 1548 |
| 98 | Ga0068853_100192086 | 3300005539 | Bacteria | 1855 |
| 99 | Ga0070672_100554661 | 3300005543 | Bacteria | 998 |
| 100 | Ga0070665_100066375 | 3300005548 | Bacteria | 3619 |
| 101 | Ga0070665_100363848 | 3300005548 | Bacteria | 1453 |
| 102 | Ga0068855_100447999 | 3300005563 | Bacteria | 1409 |
| 103 | Ga0068855_101390765 | 3300005563 | Bacteria | 723 |
| 104 | Ga0070664_100034087 | 3300005564 | Bacteria | 4270 |
| 105 | Ga0068857_100301577 | 3300005577 | Bacteria | 1477 |
| 106 | Ga0068857_100302096 | 3300005577 | Bacteria | 1476 |
| 107 | Ga0068857_102263502 | 3300005577 | Bacteria | 534 |
| 108 | Ga0068854_100116114 | 3300005578 | Bacteria | 2025 |
| 109 | Ga0068854_100704906 | 3300005578 | Bacteria | 872 |
| 110 | Ga0068856_100513221 | 3300005614 | Bacteria | 1220 |
| 111 | Ga0068852_100105818 | 3300005616 | Bacteria | 2549 |
| 112 | Ga0068852_101071830 | 3300005616 | Bacteria | 826 |
| 113 | Ga0068851_10650954 | 3300005834 | Bacteria | 645 |
| 114 | Ga0068858_100699827 | 3300005842 | Bacteria | 986 |
| 115 | Ga0075365_10163106 | 3300006038 | Bacteria | 1554 |
| 116 | Ga0075365_10524231 | 3300006038 | Bacteria | 838 |
| 117 | Ga0075368_10088109 | 3300006042 | Bacteria | 1268 |
| 118 | Ga0075368_10202258 | 3300006042 | Bacteria | 841 |
| 119 | Ga0075363_100001894 | 3300006048 | Bacteria | 8269 |
| 120 | Ga0075363_100002355 | 3300006048 | Bacteria | 7688 |
| 121 | Ga0075363_100137334 | 3300006048 | Bacteria | 1375 |
| 122 | Ga0075363_100241283 | 3300006048 | Bacteria | 1039 |
| 123 | Ga0075364_10014749 | 3300006051 | Bacteria | 4834 |
| 124 | Ga0075364_10090363 | 3300006051 | Bacteria | 2031 |
| 125 | Ga0075364_10471707 | 3300006051 | Bacteria | 858 |
| 126 | Ga0075364_10601099 | 3300006051 | Bacteria | 752 |
| 127 | Ga0075432_10030991 | 3300006058 | Bacteria | 1851 |
| 128 | Ga0070715_10927387 | 3300006163 | Bacteria | 538 |
| 129 | Ga0075362_10024189 | 3300006177 | Bacteria | 2575 |
| 130 | Ga0075362_10127290 | 3300006177 | Bacteria | 1209 |
| 131 | Ga0075362_10204167 | 3300006177 | Bacteria | 963 |
| 132 | Ga0075362_10458926 | 3300006177 | Bacteria | 648 |
| 133 | Ga0075367_10066066 | 3300006178 | Bacteria | 2167 |
| 134 | Ga0075369_10063213 | 3300006186 | Bacteria | 1619 |
| 135 | Ga0075369_10309748 | 3300006186 | Bacteria | 738 |
| 136 | Ga0075366_10010628 | 3300006195 | Bacteria | 5170 |
| 137 | Ga0075366_10033205 | 3300006195 | Bacteria | 3039 |
| 138 | Ga0075366_10044518 | 3300006195 | Bacteria | 2630 |
| 139 | Ga0075366_10192843 | 3300006195 | Bacteria | 1238 |
| 140 | Ga0097621_100497298 | 3300006237 | Bacteria | 1104 |
| 141 | Ga0097621_100544574 | 3300006237 | Bacteria | 1056 |
| 142 | Ga0097621_101326845 | 3300006237 | Bacteria | 680 |
| 143 | Ga0075370_10000910 | 3300006353 | Bacteria | 12135 |
| 144 | Ga0075370_10002650 | 3300006353 | Bacteria | 8360 |
| 145 | Ga0075370_10035610 | 3300006353 | Bacteria | 2794 |
| 146 | Ga0075370_10090565 | 3300006353 | Bacteria | 1764 |
| 147 | Ga0075370_10337909 | 3300006353 | Bacteria | 898 |
| 148 | Ga0075370_10372816 | 3300006353 | Bacteria | 854 |
| 149 | Ga0075370_10666586 | 3300006353 | Bacteria | 632 |
| 150 | Ga0075370_10787231 | 3300006353 | Bacteria | 580 |
| 151 | Ga0068871_100819762 | 3300006358 | Bacteria | 859 |
| 152 | Ga0075428_101712536 | 3300006844 | Bacteria | 656 |
| 153 | Ga0075430_100152368 | 3300006846 | Bacteria | 1925 |
| 154 | Ga0075429_101508145 | 3300006880 | Bacteria | 585 |
| 155 | Ga0079104_1000055 | 3300006946 | Bacteria | 166522 |
| 156 | Ga0099826_10001050 | 3300006948 | Bacteria | 15606 |
| 157 | Ga0099826_10182867 | 3300006948 | Bacteria | 1164 |
| 158 | Ga0099826_10508711 | 3300006948 | Bacteria | 561 |
| 159 | Ga0105244_10003265 | 3300009036 | Bacteria | 11688 |
| 160 | Ga0105244_10128001 | 3300009036 | Bacteria | 1226 |
| 161 | Ga0105250_10001192 | 3300009092 | Bacteria | 14517 |
| 162 | Ga0105240_10492308 | 3300009093 | Bacteria | 1365 |
| 163 | Ga0105240_10659293 | 3300009093 | Bacteria | 1146 |
| 164 | Ga0105245_10191294 | 3300009098 | Bacteria | 1960 |
| 165 | Ga0105245_11770883 | 3300009098 | Bacteria | 670 |
| 166 | Ga0105245_12027764 | 3300009098 | Bacteria | 629 |
| 167 | Ga0105243_10002036 | 3300009148 | Bacteria | 17143 |
| 168 | Ga0105243_10002550 | 3300009148 | Bacteria | 15218 |
| 169 | Ga0105243_10002600 | 3300009148 | Bacteria | 15051 |
| 170 | Ga0105243_10034165 | 3300009148 | Bacteria | 3935 |
| 171 | Ga0105243_11037711 | 3300009148 | Bacteria | 825 |
| 172 | Ga0105243_12718157 | 3300009148 | Bacteria | 535 |
| 173 | Ga0105241_11363289 | 3300009174 | Bacteria | 678 |
| 174 | Ga0105242_10006501 | 3300009176 | Bacteria | 9001 |
| 175 | Ga0105237_10307105 | 3300009545 | Bacteria | 1589 |
| 176 | Ga0105238_10159439 | 3300009551 | Bacteria | 2231 |
| 177 | Ga0105238_10395476 | 3300009551 | Bacteria | 1375 |
| 178 | Ga0105238_12073272 | 3300009551 | Bacteria | 603 |
| 179 | Ga0105249_12219139 | 3300009553 | Bacteria | 622 |
| 180 | Ga0105239_10283024 | 3300010375 | Bacteria | 1867 |
| 181 | Ga0105239_10947390 | 3300010375 | Bacteria | 989 |
| 182 | Ga0105246_10062869 | 3300011119 | Bacteria | 2587 |
| 183 | Ga0105246_10168653 | 3300011119 | Bacteria | 1674 |
| 184 | Ga0105246_11667610 | 3300011119 | Bacteria | 605 |
| 185 | Ga0157319_1008614 | 3300012497 | Bacteria | 784 |
| 186 | Ga0157347_1001331 | 3300012502 | Bacteria | 1917 |
| 187 | Ga0157339_1008668 | 3300012505 | Bacteria | 882 |
| 188 | Ga0157373_10106608 | 3300013100 | Bacteria | 1970 |
| 189 | Ga0157371_10048625 | 3300013102 | Bacteria | 3015 |
| 190 | Ga0157370_10012858 | 3300013104 | Bacteria | 8653 |
| 191 | Ga0157370_10190926 | 3300013104 | Bacteria | 1901 |
| 192 | Ga0157369_10008671 | 3300013105 | Bacteria | 11657 |
| 193 | Ga0157369_10416856 | 3300013105 | Bacteria | 1392 |
| 194 | Ga0163162_10112117 | 3300013306 | Bacteria | 2826 |
| 195 | Ga0163162_10603155 | 3300013306 | Bacteria | 1224 |
| 196 | Ga0163162_11655664 | 3300013306 | Bacteria | 730 |
| 197 | Ga0163162_12844920 | 3300013306 | Bacteria | 557 |
| 198 | Ga0157375_10059275 | 3300013308 | Bacteria | 3792 |
| 199 | Ga0157375_10626110 | 3300013308 | Bacteria | 1234 |
| 200 | Ga0182008_10015193 | 3300014497 | Bacteria | 4021 |
| 201 | Ga0182008_10085809 | 3300014497 | Bacteria | 1550 |
| 202 | Ga0182008_10186350 | 3300014497 | Bacteria | 1052 |
| 203 | Ga0157379_11588319 | 3300014968 | Bacteria | 638 |
| 204 | Ga0182006_1043742 | 3300015261 | Bacteria | 1750 |
| 205 | Ga0182006_1134424 | 3300015261 | Bacteria | 849 |
| 206 | Ga0182007_10000642 | 3300015262 | Bacteria | 20182 |
| 207 | Ga0182007_10000951 | 3300015262 | Bacteria | 15906 |
| 208 | Ga0182007_10045568 | 3300015262 | Bacteria | 1453 |
| 209 | Ga0182005_1093030 | 3300015265 | Bacteria | 840 |
| 210 | Ga0182005_1124589 | 3300015265 | Bacteria | 736 |
| 211 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 212 | Ga0163161_10001265 | 3300017792 | Bacteria | 18886 |
| 213 | Ga0163161_10016923 | 3300017792 | Bacteria | 5097 |
| 214 | Ga0163161_10026103 | 3300017792 | Bacteria | 4138 |
| 215 | Ga0163161_10066713 | 3300017792 | Bacteria | 2628 |
| 216 | Ga0163161_10074264 | 3300017792 | Bacteria | 2493 |
| 217 | Ga0163161_10760085 | 3300017792 | Bacteria | 812 |
| 218 | Ga0163161_11324157 | 3300017792 | Bacteria | 627 |
| 219 | Ga0209436_105358 | 3300025208 | Bacteria | 2968 |
| 220 | Ga0209436_110704 | 3300025208 | Bacteria | 1657 |
| 221 | Ga0209672_102876 | 3300025228 | Bacteria | 3868 |
| 222 | Ga0209258_100240 | 3300025242 | Bacteria | 100990 |
| 223 | Ga0207425_1001344 | 3300025245 | Bacteria | 10540 |
| 224 | Ga0207425_1003603 | 3300025245 | Bacteria | 4899 |
| 225 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 226 | Ga0209129_1000054 | 3300025258 | Bacteria | 261997 |
| 227 | Ga0209129_1003094 | 3300025258 | Bacteria | 7491 |
| 228 | Ga0209129_1006468 | 3300025258 | Bacteria | 3775 |
| 229 | Ga0209565_1000067 | 3300025263 | Bacteria | 171247 |
| 230 | Ga0209565_1000648 | 3300025263 | Bacteria | 22443 |
| 231 | Ga0209565_1002007 | 3300025263 | Bacteria | 7887 |
| 232 | Ga0209673_1000097 | 3300025273 | Bacteria | 193482 |
| 233 | Ga0209673_1000172 | 3300025273 | Bacteria | 133472 |
| 234 | Ga0209673_1001430 | 3300025273 | Bacteria | 22800 |
| 235 | Ga0209673_1021934 | 3300025273 | Bacteria | 2219 |
| 236 | Ga0209673_1035424 | 3300025273 | Bacteria | 1494 |
| 237 | Ga0209673_1054438 | 3300025273 | Bacteria | 1036 |
| 238 | Ga0209130_1000954 | 3300025284 | Bacteria | 22871 |
| 239 | Ga0209130_1001108 | 3300025284 | Bacteria | 19845 |
| 240 | Ga0209130_1001362 | 3300025284 | Bacteria | 16486 |
| 241 | Ga0209675_1000038 | 3300025291 | Bacteria | 250481 |
| 242 | Ga0209675_1000527 | 3300025291 | Bacteria | 28098 |
| 243 | Ga0209675_1000690 | 3300025291 | Bacteria | 23483 |
| 244 | Ga0209675_1001272 | 3300025291 | Bacteria | 15081 |
| 245 | Ga0209675_1007572 | 3300025291 | Bacteria | 4136 |
| 246 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 247 | Ga0209676_1000739 | 3300025292 | Bacteria | 44487 |
| 248 | Ga0209676_1000836 | 3300025292 | Bacteria | 39908 |
| 249 | Ga0209676_1004722 | 3300025292 | Bacteria | 7462 |
| 250 | Ga0209676_1013256 | 3300025292 | Bacteria | 3181 |
| 251 | Ga0209676_1026113 | 3300025292 | Bacteria | 1861 |
| 252 | Ga0209676_1049862 | 3300025292 | Bacteria | 1108 |
| 253 | Ga0209676_1058224 | 3300025292 | Bacteria | 976 |
| 254 | Ga0209025_1000174 | 3300025294 | Bacteria | 158915 |
| 255 | Ga0209025_1002139 | 3300025294 | Bacteria | 22147 |
| 256 | Ga0209025_1006091 | 3300025294 | Bacteria | 9530 |
| 257 | Ga0209025_1009762 | 3300025294 | Bacteria | 6626 |
| 258 | Ga0209025_1039557 | 3300025294 | Bacteria | 2055 |
| 259 | Ga0209564_1000241 | 3300025295 | Bacteria | 118237 |
| 260 | Ga0209564_1001515 | 3300025295 | Bacteria | 23174 |
| 261 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 262 | Ga0209758_1008758 | 3300025297 | Bacteria | 6457 |
| 263 | Ga0209758_1074214 | 3300025297 | Bacteria | 1056 |
| 264 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 265 | Ga0209050_1000294 | 3300025298 | Bacteria | 105705 |
| 266 | Ga0209050_1002666 | 3300025298 | Bacteria | 14582 |
| 267 | Ga0209050_1007315 | 3300025298 | Bacteria | 6229 |
| 268 | Ga0209256_1000103 | 3300025299 | Bacteria | 193900 |
| 269 | Ga0209256_1000165 | 3300025299 | Bacteria | 135104 |
| 270 | Ga0209256_1075865 | 3300025299 | Bacteria | 745 |
| 271 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 272 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 273 | Ga0207426_1140656 | 3300025302 | Bacteria | 574 |
| 274 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 275 | Ga0209051_1000315 | 3300025303 | Bacteria | 73579 |
| 276 | Ga0209051_1001398 | 3300025303 | Bacteria | 20776 |
| 277 | Ga0209051_1001450 | 3300025303 | Bacteria | 20110 |
| 278 | Ga0209051_1001560 | 3300025303 | Bacteria | 18951 |
| 279 | Ga0209051_1002634 | 3300025303 | Bacteria | 12590 |
| 280 | Ga0209051_1015020 | 3300025303 | Bacteria | 3584 |
| 281 | Ga0209051_1024147 | 3300025303 | Bacteria | 2508 |
| 282 | Ga0209051_1114300 | 3300025303 | Bacteria | 697 |
| 283 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 284 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 285 | Ga0209257_1000309 | 3300025304 | Bacteria | 104166 |
| 286 | Ga0209257_1007111 | 3300025304 | Bacteria | 6900 |
| 287 | Ga0209257_1009377 | 3300025304 | Bacteria | 5264 |
| 288 | Ga0209257_1068617 | 3300025304 | Bacteria | 941 |
| 289 | Ga0207696_1001691 | 3300025711 | Bacteria | 11466 |
| 290 | Ga0207655_1000639 | 3300025728 | Bacteria | 41880 |
| 291 | Ga0207682_10051721 | 3300025893 | Bacteria | 1702 |
| 292 | Ga0207682_10490311 | 3300025893 | Bacteria | 582 |
| 293 | Ga0207688_10506405 | 3300025901 | Bacteria | 756 |
| 294 | Ga0207680_10182202 | 3300025903 | Bacteria | 1421 |
| 295 | Ga0207645_10077097 | 3300025907 | Bacteria | 2136 |
| 296 | Ga0207645_10605106 | 3300025907 | Bacteria | 744 |
| 297 | Ga0207705_10522442 | 3300025909 | Bacteria | 922 |
| 298 | Ga0207705_10604173 | 3300025909 | Bacteria | 853 |
| 299 | Ga0207695_10353626 | 3300025913 | Bacteria | 1356 |
| 300 | Ga0207671_10495882 | 3300025914 | Bacteria | 974 |
| 301 | Ga0207657_10766528 | 3300025919 | Bacteria | 747 |
| 302 | Ga0207681_10167718 | 3300025923 | Bacteria | 1661 |
| 303 | Ga0207681_10321139 | 3300025923 | Bacteria | 1231 |
| 304 | Ga0207694_10106627 | 3300025924 | Bacteria | 2225 |
| 305 | Ga0207690_10458229 | 3300025932 | Bacteria | 1026 |
| 306 | Ga0207690_10567080 | 3300025932 | Bacteria | 924 |
| 307 | Ga0207706_10127382 | 3300025933 | Bacteria | 2239 |
| 308 | Ga0207686_10002565 | 3300025934 | Bacteria | 9879 |
| 309 | Ga0207709_10000111 | 3300025935 | Bacteria | 127580 |
| 310 | Ga0207709_10000874 | 3300025935 | Bacteria | 22951 |
| 311 | Ga0207709_10025717 | 3300025935 | Bacteria | 3372 |
| 312 | Ga0207669_10143110 | 3300025937 | Bacteria | 1663 |
| 313 | Ga0207669_10285882 | 3300025937 | Bacteria | 1246 |
| 314 | Ga0207669_10490133 | 3300025937 | Bacteria | 981 |
| 315 | Ga0207669_11358229 | 3300025937 | Bacteria | 604 |
| 316 | Ga0207704_11455649 | 3300025938 | Bacteria | 587 |
| 317 | Ga0207691_10500935 | 3300025940 | Bacteria | 1031 |
| 318 | Ga0207689_10300263 | 3300025942 | Bacteria | 1331 |
| 319 | Ga0207679_10053805 | 3300025945 | Bacteria | 2960 |
| 320 | Ga0207667_10371498 | 3300025949 | Bacteria | 1457 |
| 321 | Ga0207651_11329473 | 3300025960 | Bacteria | 646 |
| 322 | Ga0207668_10601637 | 3300025972 | Bacteria | 958 |
| 323 | Ga0207640_10098316 | 3300025981 | Bacteria | 2046 |
| 324 | Ga0207658_10161411 | 3300025986 | Bacteria | 1837 |
| 325 | Ga0207658_10320184 | 3300025986 | Bacteria | 1342 |
| 326 | Ga0207677_10125692 | 3300026023 | Bacteria | 1938 |
| 327 | Ga0207703_10793673 | 3300026035 | Bacteria | 904 |
| 328 | Ga0207639_10007668 | 3300026041 | Bacteria | 7368 |
| 329 | Ga0207639_10109792 | 3300026041 | Bacteria | 2245 |
| 330 | Ga0207639_11516496 | 3300026041 | Bacteria | 629 |
| 331 | Ga0207678_10541618 | 3300026067 | Bacteria | 1017 |
| 332 | Ga0207678_11636254 | 3300026067 | Bacteria | 566 |
| 333 | Ga0207702_10460583 | 3300026078 | Bacteria | 1235 |
| 334 | Ga0207648_10203104 | 3300026089 | Bacteria | 1758 |
| 335 | Ga0207648_11313797 | 3300026089 | Bacteria | 680 |
| 336 | Ga0207648_11632720 | 3300026089 | Bacteria | 606 |
| 337 | Ga0207674_10383653 | 3300026116 | Bacteria | 1358 |
| 338 | Ga0207674_10664000 | 3300026116 | Bacteria | 1007 |
| 339 | Ga0207683_10054704 | 3300026121 | Bacteria | 3499 |
| 340 | Ga0207683_10516967 | 3300026121 | Bacteria | 1103 |
| 341 | Ga0207683_11864906 | 3300026121 | Bacteria | 550 |
| 342 | Ga0207698_10034645 | 3300026142 | Bacteria | 3683 |
| 343 | Ga0207698_10807050 | 3300026142 | Bacteria | 941 |
| 344 | Ga0207698_12422896 | 3300026142 | Bacteria | 536 |
| 345 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 346 | Ga0209973_1016250 | 3300027252 | Bacteria | 947 |
| 347 | Ga0209969_1020290 | 3300027360 | Bacteria | 989 |
| 348 | Ga0209995_1089223 | 3300027471 | Bacteria | 530 |
| 349 | Ga0209970_1000429 | 3300027614 | Bacteria | 7139 |
| 350 | Ga0209983_1020676 | 3300027665 | Bacteria | 1372 |
| 351 | Ga0209983_1020895 | 3300027665 | Bacteria | 1367 |
| 352 | Ga0209282_1000250 | 3300027666 | Bacteria | 26928 |
| 353 | Ga0209282_1288768 | 3300027666 | Bacteria | 703 |
| 354 | Ga0209971_1002246 | 3300027682 | Bacteria | 4677 |
| 355 | Ga0209974_10013726 | 3300027876 | Bacteria | 2699 |
| 356 | Ga0209974_10027694 | 3300027876 | Bacteria | 1875 |
| 357 | Ga0207428_10247795 | 3300027907 | Bacteria | 1329 |
| 358 | Ga0268266_10021518 | 3300028379 | Bacteria | 5494 |
| 359 | Ga0268266_10877237 | 3300028379 | Bacteria | 867 |
| 360 | Ga0307517_10260146 | 3300028786 | Bacteria | 1009 |
| 361 | Ga0307515_10000472 | 3300028794 | Bacteria | 96172 |
| 362 | Ga0307515_10046485 | 3300028794 | Bacteria | 6633 |
| 363 | Ga0307515_10693766 | 3300028794 | Bacteria | 633 |
| 364 | Ga0316177_1034408 | 3300030731 | Bacteria | 3651 |
| 365 | Ga0316177_1080169 | 3300030731 | Bacteria | 684 |
| 366 | Ga0314311_1027844 | 3300030733 | Bacteria | 4749 |
| 367 | Ga0316179_1049987 | 3300030734 | Bacteria | 1003 |
| 368 | Ga0316178_1145977 | 3300030735 | Bacteria | 2566 |
| 369 | Ga0316183_1069619 | 3300030742 | Bacteria | 1978 |
| 370 | Ga0316183_1109757 | 3300030742 | Bacteria | 4328 |
| 371 | Ga0316181_1020350 | 3300030744 | Bacteria | 2824 |
| 372 | Ga0316182_1118407 | 3300030745 | Bacteria | 2524 |
| 373 | Ga0265330_10000046 | 3300031235 | Bacteria | 108853 |
| 374 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 375 | Ga0265332_10030174 | 3300031238 | Bacteria | 2368 |
| 376 | Ga0265325_10002346 | 3300031241 | Bacteria | 12816 |
| 377 | Ga0265329_10086791 | 3300031242 | Bacteria | 992 |
| 378 | Ga0265331_10200757 | 3300031250 | Bacteria | 898 |
| 379 | Ga0265327_10001288 | 3300031251 | Bacteria | 32919 |
| 380 | Ga0307513_10167176 | 3300031456 | Bacteria | 2082 |
| 381 | Ga0307513_10324239 | 3300031456 | Bacteria | 1297 |
| 382 | Ga0307408_100000456 | 3300031548 | Bacteria | 35728 |
| 383 | Ga0307408_100068273 | 3300031548 | Bacteria | 2617 |
| 384 | Ga0307408_100128683 | 3300031548 | Bacteria | 1972 |
| 385 | Ga0307408_100177894 | 3300031548 | Bacteria | 1703 |
| 386 | Ga0307408_100356005 | 3300031548 | Bacteria | 1243 |
| 387 | Ga0307408_100418682 | 3300031548 | Bacteria | 1154 |
| 388 | Ga0307408_101693924 | 3300031548 | Bacteria | 602 |
| 389 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 390 | Ga0265314_10020486 | 3300031711 | Bacteria | 5105 |
| 391 | Ga0265342_10203259 | 3300031712 | Bacteria | 1075 |
| 392 | Ga0307405_10035253 | 3300031731 | Bacteria | 2986 |
| 393 | Ga0307405_10110899 | 3300031731 | Bacteria | 1858 |
| 394 | Ga0307405_10138426 | 3300031731 | Bacteria | 1693 |
| 395 | Ga0307405_10226574 | 3300031731 | Bacteria | 1375 |
| 396 | Ga0307413_10032421 | 3300031824 | Bacteria | 2961 |
| 397 | Ga0307413_10046453 | 3300031824 | Bacteria | 2582 |
| 398 | Ga0307413_10120537 | 3300031824 | Bacteria | 1776 |
| 399 | Ga0307410_10365805 | 3300031852 | Bacteria | 1156 |
| 400 | Ga0307410_10525078 | 3300031852 | Bacteria | 977 |
| 401 | Ga0307406_10000225 | 3300031901 | Bacteria | 34443 |
| 402 | Ga0307406_10003957 | 3300031901 | Bacteria | 8050 |
| 403 | Ga0307406_10704579 | 3300031901 | Bacteria | 843 |
| 404 | Ga0307406_11197726 | 3300031901 | Bacteria | 659 |
| 405 | Ga0307406_11265560 | 3300031901 | Bacteria | 643 |
| 406 | Ga0307406_11558465 | 3300031901 | Bacteria | 583 |
| 407 | Ga0307407_10111725 | 3300031903 | Bacteria | 1716 |
| 408 | Ga0307407_10343576 | 3300031903 | Bacteria | 1055 |
| 409 | Ga0307407_10892760 | 3300031903 | Bacteria | 681 |
| 410 | Ga0307412_10047673 | 3300031911 | Bacteria | 2815 |
| 411 | Ga0307412_10060086 | 3300031911 | Bacteria | 2550 |
| 412 | Ga0307412_10066350 | 3300031911 | Bacteria | 2446 |
| 413 | Ga0307412_10316613 | 3300031911 | Bacteria | 1239 |
| 414 | Ga0307412_10360466 | 3300031911 | Bacteria | 1170 |
| 415 | Ga0307412_10738684 | 3300031911 | Bacteria | 848 |
| 416 | Ga0307412_11014099 | 3300031911 | Bacteria | 734 |
| 417 | Ga0307409_101928884 | 3300031995 | Bacteria | 620 |
| 418 | Ga0307416_100030507 | 3300032002 | Bacteria | 4046 |
| 419 | Ga0307416_100201880 | 3300032002 | Bacteria | 1887 |
| 420 | Ga0307416_100259942 | 3300032002 | Bacteria | 1696 |
| 421 | Ga0307416_101838027 | 3300032002 | Bacteria | 709 |
| 422 | Ga0307414_10026501 | 3300032004 | Bacteria | 3731 |
| 423 | Ga0307414_10765311 | 3300032004 | Bacteria | 878 |
| 424 | Ga0307414_11421413 | 3300032004 | Bacteria | 645 |
| 425 | Ga0307411_10169978 | 3300032005 | Bacteria | 1642 |
| 426 | Ga0307411_10570046 | 3300032005 | Bacteria | 969 |
| 427 | Ga0307411_11037101 | 3300032005 | Bacteria | 736 |
| 428 | Ga0307411_11627789 | 3300032005 | Bacteria | 596 |
| 429 | Ga0307411_11819561 | 3300032005 | Bacteria | 566 |
| 430 | Ga0307411_11956100 | 3300032005 | Bacteria | 547 |
| 431 | Ga0307411_11967929 | 3300032005 | Bacteria | 545 |
| 432 | Ga0307415_102135942 | 3300032126 | Bacteria | 547 |
| 433 | Ga0395899_0003383 | 3300037312 | Bacteria | 12655 |
| 434 | Ga0395899_0006534 | 3300037312 | Bacteria | 9035 |
| 435 | Ga0395899_0036718 | 3300037312 | Bacteria | 3675 |
| 436 | Ga0395899_0232426 | 3300037312 | Bacteria | 1272 |
| 437 | Ga0395899_0294665 | 3300037312 | Bacteria | 1100 |
| 438 | Ga0395900_0008463 | 3300037418 | Bacteria | 10579 |
| 439 | Ga0395900_0014177 | 3300037418 | Bacteria | 8139 |
| 440 | Ga0395900_0086732 | 3300037418 | Bacteria | 3217 |
| 441 | Ga0395900_0094241 | 3300037418 | Bacteria | 3075 |
| 442 | Ga0395900_0217707 | 3300037418 | Bacteria | 1926 |
| 443 | Ga0395900_0414353 | 3300037418 | Bacteria | 1309 |
| 444 | Ga0395900_1761372 | 3300037418 | Bacteria | 530 |
| 445 | Ga0395898_0010814 | 3300037466 | Bacteria | 9535 |
| 446 | Ga0395898_0020733 | 3300037466 | Bacteria | 6673 |
| 447 | Ga0395898_0023184 | 3300037466 | Bacteria | 6274 |
| 448 | Ga0395905_0000088 | 3300037471 | Bacteria | 152506 |
| 449 | Ga0395905_0001245 | 3300037471 | Bacteria | 31535 |
| 450 | Ga0395905_0126059 | 3300037471 | Bacteria | 2407 |
| 451 | Ga0395905_0156874 | 3300037471 | Bacteria | 2140 |
| 452 | Ga0395905_0171382 | 3300037471 | Bacteria | 2039 |
| 453 | Ga0395905_0221292 | 3300037471 | Bacteria | 1771 |
| 454 | Ga0395905_0261549 | 3300037471 | Bacteria | 1615 |
| 455 | Ga0395905_0484311 | 3300037471 | Bacteria | 1137 |
| 456 | Ga0395905_0519340 | 3300037471 | Bacteria | 1091 |
| 457 | Ga0395905_0577514 | 3300037471 | Bacteria | 1025 |
| 458 | Ga0395905_0758292 | 3300037471 | Bacteria | 873 |
| 459 | Ga0395905_0784777 | 3300037471 | Bacteria | 855 |
| 460 | Ga0395901_0039778 | 3300038443 | Bacteria | 4867 |
| 461 | Ga0395901_0117489 | 3300038443 | Bacteria | 2794 |
| 462 | Ga0395901_0121401 | 3300038443 | Bacteria | 2746 |
| 463 | Ga0395901_0123823 | 3300038443 | Bacteria | 2716 |
| 464 | Ga0395901_0138444 | 3300038443 | Bacteria | 2558 |
| 465 | Ga0395901_0452615 | 3300038443 | Bacteria | 1313 |
| 466 | Ga0395901_0682993 | 3300038443 | Bacteria | 1026 |
| 467 | Ga0436361_0101461 | 3300039447 | Bacteria | 19447 |
| 468 | Ga0439436_0000328 | 3300041404 | Bacteria | 11648 |
| 469 | Ga0439436_0004062 | 3300041404 | Bacteria | 4487 |
| 470 | Ga0439438_024290 | 3300041405 | Bacteria | 1660 |
| 471 | Ga0439439_0008740 | 3300041406 | Bacteria | 2397 |
| 472 | Ga0439439_0174931 | 3300041406 | Bacteria | 616 |
| 473 | Ga0439447_011668 | 3300041407 | Bacteria | 2553 |
| 474 | Ga0439447_027912 | 3300041407 | Bacteria | 1438 |
| 475 | Ga0439453_0009846 | 3300041408 | Bacteria | 1565 |
| 476 | Ga0439461_0083485 | 3300041410 | Bacteria | 757 |
| 477 | Ga0439461_0112290 | 3300041410 | Bacteria | 674 |
| 478 | Ga0439461_0152825 | 3300041410 | Bacteria | 597 |
| 479 | Ga0439466_0003860 | 3300041411 | Bacteria | 5780 |
| 480 | Ga0439466_0004758 | 3300041411 | Bacteria | 5217 |
| 481 | Ga0439465_0000335 | 3300041413 | Bacteria | 13395 |
| 482 | Ga0439465_0021529 | 3300041413 | Bacteria | 2022 |
| 483 | Ga0451787_422576 | 3300041441 | Bacteria | 664 |
| 484 | Ga0451791_0144114 | 3300041451 | Bacteria | 729 |
| 485 | Ga0451797_0753891 | 3300041453 | Bacteria | 518 |
| 486 | Ga0451807_0354829 | 3300041486 | Bacteria | 760 |
| 487 | Ga0451837_0713402 | 3300041494 | Bacteria | 944 |
| 488 | Ga0451847_1003343 | 3300041503 | Bacteria | 627 |
| 489 | Ga0451851_1277293 | 3300041507 | Bacteria | 550 |
| 490 | Ga0451843_1126288 | 3300041509 | Bacteria | 588 |
| 491 | Ga0451855_0013712 | 3300041511 | Bacteria | 705 |
| 492 | Ga0451853_1371493 | 3300041512 | Bacteria | 797 |
| 493 | Ga0439431_0002745 | 3300041997 | Bacteria | 3868 |
| 494 | Ga0439433_0001040 | 3300041999 | Bacteria | 5623 |
| 495 | Ga0439442_003077 | 3300042002 | Bacteria | 3301 |
| 496 | Ga0439442_003207 | 3300042002 | Bacteria | 3237 |
| 497 | Ga0439442_013480 | 3300042002 | Bacteria | 1677 |
| 498 | Ga0439445_0002157 | 3300042004 | Bacteria | 4359 |
| 499 | Ga0439445_0020234 | 3300042004 | Bacteria | 1664 |
| 500 | Ga0439445_0052016 | 3300042004 | Bacteria | 1107 |
| 501 | Ga0439432_001277 | 3300042006 | Bacteria | 9513 |
| 502 | Ga0439432_007245 | 3300042006 | Bacteria | 3940 |
| 503 | Ga0439449_0001202 | 3300042007 | Bacteria | 10165 |
| 504 | Ga0439449_0003003 | 3300042007 | Bacteria | 6582 |
| 505 | Ga0439449_0007077 | 3300042007 | Bacteria | 4272 |
| 506 | Ga0439449_0041944 | 3300042007 | Bacteria | 1701 |
| 507 | Ga0439452_003207 | 3300042010 | Bacteria | 5781 |
| 508 | Ga0439452_023010 | 3300042010 | Bacteria | 1608 |
| 509 | Ga0439454_030628 | 3300042011 | Bacteria | 842 |
| 510 | Ga0439457_001739 | 3300042014 | Bacteria | 6451 |
| 511 | Ga0439457_024364 | 3300042014 | Bacteria | 1339 |
| 512 | Ga0439462_0001618 | 3300042015 | Bacteria | 5062 |
| 513 | Ga0439462_0003446 | 3300042015 | Bacteria | 3796 |
| 514 | Ga0439462_0014579 | 3300042015 | Bacteria | 2021 |
| 515 | Ga0439462_0068215 | 3300042015 | Bacteria | 965 |
| 516 | Ga0439463_031283 | 3300042016 | Bacteria | 1343 |
| 517 | Ga0450911_001790 | 3300042115 | Bacteria | 4615 |
| 518 | Ga0450912_006428 | 3300042116 | Bacteria | 931 |
| 519 | Ga0450920_053079 | 3300042122 | Bacteria | 814 |
| 520 | Ga0450921_007502 | 3300042123 | Bacteria | 868 |
| 521 | Ga0450921_029709 | 3300042123 | Bacteria | 553 |
| 522 | Ga0450923_003016 | 3300042125 | Bacteria | 2491 |
| 523 | Ga0450897_016804 | 3300042128 | Bacteria | 757 |
| 524 | Ga0450894_013319 | 3300042131 | Bacteria | 1079 |
| 525 | Ga0450896_014494 | 3300042133 | Bacteria | 1125 |
| 526 | Ga0450896_039304 | 3300042133 | Bacteria | 733 |
| 527 | Ga0450898_002224 | 3300042134 | Bacteria | 2698 |
| 528 | Ga0450898_027176 | 3300042134 | Bacteria | 1034 |
| 529 | Ga0450906_003495 | 3300042145 | Bacteria | 3375 |
| 530 | Ga0450907_008273 | 3300042146 | Bacteria | 1731 |
| 531 | Ga0450910_006248 | 3300042147 | Bacteria | 1639 |
| 532 | Ga0439446_0001983 | 3300042156 | Bacteria | 4836 |
| 533 | Ga0439446_0032073 | 3300042156 | Bacteria | 1522 |
| 534 | Ga0450908_013209 | 3300042184 | Bacteria | 1490 |
| 535 | Ga0450908_053513 | 3300042184 | Bacteria | 704 |
| 536 | Ga0450909_009490 | 3300042185 | Bacteria | 1421 |
| 537 | Ga0450909_013238 | 3300042185 | Bacteria | 1212 |
| 538 | Ga0439434_0016246 | 3300042435 | Bacteria | 2223 |
| 539 | Ga0439434_0023986 | 3300042435 | Bacteria | 1838 |
| 540 | Ga0439434_0032026 | 3300042435 | Bacteria | 1600 |
| 541 | Ga0439434_0036215 | 3300042435 | Bacteria | 1509 |
| 542 | Ga0439464_0059805 | 3300042439 | Bacteria | 1114 |
| 543 | Ga0450916_071003 | 3300042530 | Bacteria | 581 |
| 544 | Ga0450918_000837 | 3300042531 | Bacteria | 6485 |
| 545 | Ga0451577_0000276 | 3300042876 | Bacteria | 99531 |
| 546 | Ga0451577_0003205 | 3300042876 | Bacteria | 18390 |
| 547 | Ga0451577_0017089 | 3300042876 | Bacteria | 6708 |
| 548 | Ga0451577_1479152 | 3300042876 | Bacteria | 601 |
| 549 | Ga0466969_0025202 | 3300044656 | Bacteria | 3059 |
| 550 | Ga0466969_0147217 | 3300044656 | Bacteria | 1086 |
| 551 | Ga0466969_0169310 | 3300044656 | Bacteria | 1002 |
| 552 | Ga0466972_0209843 | 3300044658 | Bacteria | 911 |
| 553 | Ga0453683_0012232 | 3300044673 | Bacteria | 5630 |
| 554 | Ga0453683_0141395 | 3300044673 | Bacteria | 1519 |
| 555 | Ga0453683_0802047 | 3300044673 | Bacteria | 620 |
| 556 | Ga0466965_0039866 | 3300044683 | Bacteria | 2310 |
| 557 | Ga0466965_0043939 | 3300044683 | Bacteria | 2207 |
| 558 | Ga0466965_0075588 | 3300044683 | Bacteria | 1699 |
| 559 | Ga0466966_0009243 | 3300044684 | Bacteria | 6526 |
| 560 | Ga0466966_0235141 | 3300044684 | Bacteria | 1105 |
| 561 | Ga0466961_0036383 | 3300044693 | Bacteria | 3160 |
| 562 | Ga0466961_0056640 | 3300044693 | Bacteria | 2498 |
| 563 | Ga0466961_0168159 | 3300044693 | Bacteria | 1364 |
| 564 | Ga0453684_0000891 | 3300044712 | Bacteria | 99637 |
| 565 | Ga0453684_0029360 | 3300044712 | Bacteria | 7809 |
| 566 | Ga0453684_0328610 | 3300044712 | Bacteria | 1730 |
| 567 | Ga0453684_0517621 | 3300044712 | Bacteria | 1319 |
| 568 | Ga0453684_2041060 | 3300044712 | Bacteria | 576 |
| 569 | Ga0466968_0043217 | 3300044735 | Bacteria | 1907 |
| 570 | Ga0466968_0584257 | 3300044735 | Bacteria | 563 |
| 571 | Ga0466957_0085418 | 3300044842 | Bacteria | 1971 |
| 572 | Ga0466960_0014488 | 3300044901 | Bacteria | 3376 |
| 573 | Ga0466960_0176268 | 3300044901 | Bacteria | 1157 |
| 574 | Ga0466960_0307708 | 3300044901 | Bacteria | 894 |
| 575 | Ga0466960_1024777 | 3300044901 | Bacteria | 508 |
| 576 | Ga0466959_0071642 | 3300045049 | Bacteria | 2509 |
| 577 | Ga0466959_0224187 | 3300045049 | Bacteria | 1303 |
| 578 | Ga0451576_0002262 | 3300045051 | Bacteria | 29416 |
| 579 | Ga0451576_0004706 | 3300045051 | Bacteria | 17540 |
| 580 | Ga0451576_0596329 | 3300045051 | Bacteria | 1161 |
| 581 | Ga0451576_0605340 | 3300045051 | Bacteria | 1152 |
| 582 | Ga0466958_0419431 | 3300045836 | Bacteria | 865 |
| 583 | Ga0495627_010560 | 3300046453 | Bacteria | 3350 |
| 584 | Ga0495592_0428935 | 3300046454 | Bacteria | 832 |
| 585 | Ga0495629_0185708 | 3300046459 | Bacteria | 1440 |
| 586 | Ga0495629_0402427 | 3300046459 | Bacteria | 930 |
| 587 | Ga0495651_0149023 | 3300046462 | Bacteria | 1689 |
| 588 | Ga0495653_0205963 | 3300046463 | Bacteria | 1332 |
| 589 | Ga0495653_0744655 | 3300046463 | Bacteria | 592 |
| 590 | Ga0495639_0012096 | 3300046475 | Bacteria | 3720 |
| 591 | Ga0495664_0157147 | 3300046477 | Unclassified | 1379 |
| 592 | Ga0495610_0024146 | 3300046512 | Bacteria | 3286 |
| 593 | Ga0495610_0195897 | 3300046512 | Bacteria | 831 |
| 594 | Ga0495616_0006871 | 3300046513 | Bacteria | 6853 |
| 595 | Ga0495618_0180871 | 3300046514 | Bacteria | 1340 |
| 596 | Ga0495620_0064465 | 3300046515 | Bacteria | 1515 |
| 597 | Ga0495620_0140238 | 3300046515 | Bacteria | 945 |
| 598 | Ga0495628_0278829 | 3300046516 | Bacteria | 1242 |
| 599 | Ga0495630_1344912 | 3300046517 | Bacteria | 538 |
| 600 | Ga0495631_0004279 | 3300046518 | Bacteria | 7622 |
| 601 | Ga0495637_0006661 | 3300046520 | Bacteria | 5783 |
| 602 | Ga0495663_0024751 | 3300046525 | Bacteria | 1747 |
| 603 | Ga0495663_0090132 | 3300046525 | Bacteria | 999 |
| 604 | Ga0495642_0035383 | 3300046528 | Bacteria | 2015 |
| 605 | Ga0495642_0118454 | 3300046528 | Bacteria | 1135 |
| 606 | Ga0495652_0294786 | 3300046529 | Bacteria | 1182 |
| 607 | Ga0495652_0841240 | 3300046529 | Bacteria | 609 |
| 608 | Ga0495654_0043341 | 3300046530 | Bacteria | 2230 |
| 609 | Ga0495586_0332902 | 3300046535 | Bacteria | 871 |
| 610 | Ga0495587_0447736 | 3300046536 | Bacteria | 716 |
| 611 | Ga0495609_0088811 | 3300046538 | Bacteria | 1345 |
| 612 | Ga0495621_0060176 | 3300046539 | Bacteria | 1377 |
| 613 | Ga0495621_0157890 | 3300046539 | Bacteria | 895 |
| 614 | Ga0495645_0431969 | 3300046543 | Bacteria | 834 |
| 615 | Ga0495622_0289819 | 3300046557 | Bacteria | 714 |
| 616 | Ga0495633_0042415 | 3300046558 | Bacteria | 2161 |
| 617 | Ga0495633_0288542 | 3300046558 | Bacteria | 746 |
| 618 | Ga0495656_0000090 | 3300046615 | Bacteria | 39387 |
| 619 | Ga0495656_0045688 | 3300046615 | Bacteria | 1850 |
| 620 | Ga0495656_0064024 | 3300046615 | Bacteria | 1613 |
| 621 | Ga0495656_0163209 | 3300046615 | Bacteria | 1084 |
| 622 | Ga0495625_0001055 | 3300046660 | Bacteria | 36138 |
| 623 | Ga0495625_0035184 | 3300046660 | Bacteria | 3693 |
| 624 | Ga0495625_0058131 | 3300046660 | Bacteria | 2748 |
| 625 | Ga0495635_0568777 | 3300046663 | Bacteria | 742 |
| 626 | Ga0495661_0149149 | 3300046665 | Bacteria | 1265 |
| 627 | Ga0495661_0338856 | 3300046665 | Bacteria | 743 |
| 628 | Ga0495588_0065501 | 3300046674 | Bacteria | 1885 |
| 629 | Ga0495588_0134042 | 3300046674 | Bacteria | 1307 |
| 630 | Ga0495657_0357776 | 3300046675 | Bacteria | 863 |
| 631 | Ga0495669_0092764 | 3300046684 | Bacteria | 1396 |
| 632 | Ga0495669_0451213 | 3300046684 | Bacteria | 624 |
| 633 | Ga0495613_0516400 | 3300046689 | Bacteria | 803 |
| 634 | Ga0495624_0125401 | 3300046690 | Unclassified | 1576 |
| 635 | Ga0495624_0459963 | 3300046690 | Bacteria | 762 |
| 636 | Ga0495670_0156653 | 3300046691 | Bacteria | 1195 |
| 637 | Ga0495670_0370342 | 3300046691 | Bacteria | 772 |
| 638 | Ga0495671_0033400 | 3300046692 | Bacteria | 2621 |
| 639 | Ga0495600_0673660 | 3300046809 | Bacteria | 624 |
| 640 | Ga0495636_0035291 | 3300047318 | Bacteria | 2060 |
| 641 | Ga0495674_0149356 | 3300047319 | Bacteria | 1960 |
| 642 | Ga0495676_0077660 | 3300047321 | Bacteria | 2531 |
| 643 | Ga0495676_0339912 | 3300047321 | Bacteria | 1005 |
| 644 | Ga0495676_0661797 | 3300047321 | Bacteria | 677 |
| 645 | Ga0495676_0754657 | 3300047321 | Bacteria | 628 |
| 646 | Ga0495680_0649593 | 3300047322 | Bacteria | 701 |
| 647 | Ga0495677_0185109 | 3300047445 | Bacteria | 808 |
| 648 | Ga0495685_020122 | 3300047447 | Bacteria | 2293 |
| 649 | Ga0495684_0211415 | 3300047471 | Bacteria | 1426 |
| 650 | Ga0495686_0252038 | 3300047472 | Bacteria | 992 |
| 651 | Ga0495686_0289959 | 3300047472 | Bacteria | 907 |
| 652 | Ga0495602_0268765 | 3300048088 | Bacteria | 1261 |
| 653 | Ga0495602_0391660 | 3300048088 | Bacteria | 993 |
| 654 | Ga0495614_0029162 | 3300048089 | Bacteria | 2375 |
| 655 | Ga0495614_0031400 | 3300048089 | Bacteria | 2286 |
| 656 | Ga0495615_0036591 | 3300048090 | Bacteria | 1205 |
| 657 | Ga0495615_0164403 | 3300048090 | Bacteria | 668 |
| 658 | Ga0496100_0523034 | 3300048903 | Bacteria | 916 |
| 659 | Ga0496100_0758544 | 3300048903 | Bacteria | 759 |
| 660 | Ga0496100_0824716 | 3300048903 | Bacteria | 727 |
| 661 | Ga0496100_1092987 | 3300048903 | Bacteria | 628 |
| 662 | Ga0496101_0051772 | 3300048904 | Bacteria | 2959 |
| 663 | Ga0496102_0004957 | 3300048905 | Bacteria | 11277 |
| 664 | Ga0496102_0160011 | 3300048905 | Bacteria | 2118 |
| 665 | Ga0496102_0168147 | 3300048905 | Bacteria | 2064 |
| 666 | Ga0496103_0103764 | 3300048906 | Bacteria | 1801 |
| 667 | Ga0496104_0008675 | 3300048907 | Bacteria | 9040 |
| 668 | Ga0496105_0010700 | 3300048908 | Bacteria | 7220 |
| 669 | Ga0496106_0008933 | 3300048909 | Bacteria | 7407 |
| 670 | Ga0496108_0090817 | 3300048911 | Bacteria | 2596 |
| 671 | Ga0496109_0250036 | 3300048912 | Bacteria | 1669 |
| 672 | Ga0496110_0334323 | 3300048913 | Bacteria | 1380 |
| 673 | Ga0496110_0450067 | 3300048913 | Bacteria | 1173 |
| 674 | Ga0496110_0681768 | 3300048913 | Bacteria | 928 |
| 675 | Ga0496111_0623212 | 3300048914 | Bacteria | 788 |
| 676 | Ga0496112_0247614 | 3300048915 | Bacteria | 1734 |
| 677 | Ga0496113_0209231 | 3300048916 | Bacteria | 1552 |
| 678 | Ga0496116_0026461 | 3300048919 | Bacteria | 4242 |
| 679 | Ga0496117_0048605 | 3300048920 | Bacteria | 3027 |
| 680 | Ga0496117_0099448 | 3300048920 | Bacteria | 1845 |
| 681 | Ga0496118_0038816 | 3300048921 | Bacteria | 3810 |
| 682 | Ga0496118_0100657 | 3300048921 | Bacteria | 1954 |
| 683 | Ga0496119_0179091 | 3300048922 | Bacteria | 1113 |
| 684 | Ga0496119_0205620 | 3300048922 | Bacteria | 1016 |
| 685 | Ga0496121_0010814 | 3300048924 | Bacteria | 10220 |
| 686 | Ga0496121_0057522 | 3300048924 | Bacteria | 3222 |
| 687 | Ga0496121_0325745 | 3300048924 | Bacteria | 1032 |
| 688 | Ga0496122_0003683 | 3300048925 | Bacteria | 19870 |
| 689 | Ga0496122_0026344 | 3300048925 | Bacteria | 5015 |
| 690 | Ga0496122_0062562 | 3300048925 | Bacteria | 2724 |
| 691 | Ga0496122_0096773 | 3300048925 | Bacteria | 1989 |
| 692 | Ga0496123_0000274 | 3300048926 | Bacteria | 101783 |
| 693 | Ga0496123_0045998 | 3300048926 | Bacteria | 2965 |
| 694 | Ga0496123_0064937 | 3300048926 | Bacteria | 2323 |
| 695 | Ga0496123_0066798 | 3300048926 | Bacteria | 2276 |
| 696 | Ga0496123_0319517 | 3300048926 | Bacteria | 733 |
| 697 | Ga0496124_0037636 | 3300048927 | Bacteria | 4206 |
| 698 | Ga0496124_0073316 | 3300048927 | Bacteria | 2833 |
| 699 | Ga0496124_0122698 | 3300048927 | Bacteria | 2074 |
| 700 | Ga0496124_0165467 | 3300048927 | Bacteria | 1719 |
| 701 | Ga0496124_0181661 | 3300048927 | Bacteria | 1618 |
| 702 | Ga0496124_0363754 | 3300048927 | Bacteria | 1018 |
| 703 | Ga0496124_0602261 | 3300048927 | Bacteria | 714 |
| 704 | Ga0496125_0006965 | 3300048928 | Bacteria | 12106 |
| 705 | Ga0496125_0026721 | 3300048928 | Bacteria | 5247 |
| 706 | Ga0496125_0030178 | 3300048928 | Bacteria | 4854 |
| 707 | Ga0496125_0090108 | 3300048928 | Bacteria | 2303 |
| 708 | Ga0496125_0090995 | 3300048928 | Bacteria | 2287 |
| 709 | Ga0496125_0154906 | 3300048928 | Bacteria | 1567 |
| 710 | Ga0496125_0334759 | 3300048928 | Bacteria | 911 |
| 711 | Ga0496126_0076988 | 3300048929 | Bacteria | 2958 |
| 712 | Ga0496126_0372416 | 3300048929 | Bacteria | 1164 |
| 713 | Ga0496126_0469191 | 3300048929 | Bacteria | 1010 |
| 714 | Ga0496126_0571419 | 3300048929 | Bacteria | 894 |
| 715 | Ga0496126_0753893 | 3300048929 | Bacteria | 751 |
| 716 | Ga0501306_050789 | 3300049127 | Bacteria | 664 |
| 717 | Ga0501310_039787 | 3300049130 | Bacteria | 651 |
| 718 | Ga0501292_134997 | 3300049515 | Bacteria | 512 |
| 719 | Ga0501303_026821 | 3300049526 | Bacteria | 649 |
| 720 | Ga0501034_0098321 | 3300049571 | Bacteria | 2922 |
| 721 | Ga0501036_0070727 | 3300049572 | Bacteria | 2951 |
| 722 | Ga0501036_0484402 | 3300049572 | Bacteria | 1030 |
| 723 | Ga0501038_0153558 | 3300049574 | Bacteria | 1876 |
| 724 | Ga0501039_0117354 | 3300049575 | Bacteria | 2084 |
| 725 | Ga0501043_0032689 | 3300049579 | Bacteria | 4091 |
| 726 | Ga0501043_0183849 | 3300049579 | Bacteria | 1628 |
| 727 | Ga0501046_0603846 | 3300049580 | Bacteria | 778 |
| 728 | Ga0501047_0043447 | 3300049581 | Bacteria | 4342 |
| 729 | Ga0501047_0076351 | 3300049581 | Bacteria | 3224 |
| 730 | Ga0501047_0166057 | 3300049581 | Bacteria | 2078 |
| 731 | Ga0501073_0200747 | 3300049589 | Bacteria | 1379 |
| 732 | Ga0501073_0920579 | 3300049589 | Bacteria | 602 |
| 733 | Ga0501206_037287 | 3300049653 | Bacteria | 740 |
| 734 | Ga0501249_093532 | 3300049679 | Bacteria | 715 |
| 735 | Ga0501252_045450 | 3300049682 | Bacteria | 649 |
| 736 | Ga0501221_080328 | 3300049704 | Bacteria | 784 |
| 737 | Ga0501225_0077783 | 3300049705 | Bacteria | 950 |
| 738 | Ga0501234_084814 | 3300049707 | Bacteria | 562 |
| 739 | Ga0501080_0052740 | 3300049742 | Bacteria | 3785 |
| 740 | Ga0501083_0963603 | 3300049744 | Bacteria | 555 |
| 741 | Ga0501241_020331 | 3300049758 | Bacteria | 1221 |
| 742 | Ga0501241_111436 | 3300049758 | Bacteria | 599 |
| 743 | Ga0501262_001111 | 3300049759 | Bacteria | 3056 |
| 744 | Ga0501263_046701 | 3300049760 | Bacteria | 649 |
| 745 | Ga0501263_080653 | 3300049760 | Bacteria | 537 |
| 746 | Ga0501035_0598727 | 3300049822 | Bacteria | 898 |
| 747 | Ga0501044_0073507 | 3300049823 | Bacteria | 3475 |
| 748 | Ga0501044_0455396 | 3300049823 | Bacteria | 1185 |
| 749 | nmdc:mga03683_10715_c1 | 3300050489 | Bacteria | 3294 |
| 750 | nmdc:mga03683_28534_c1 | 3300050489 | Bacteria | 2220 |
| 751 | nmdc:mga03683_47346_c1 | 3300050489 | Bacteria | 1784 |
| 752 | nmdc:mga03683_50064_c1 | 3300050489 | Bacteria | 1741 |
| 753 | nmdc:mga03n38_119223_c1 | 3300050490 | Bacteria | 1295 |
| 754 | nmdc:mga03n38_1785_c1 | 3300050490 | Bacteria | 6376 |
| 755 | nmdc:mga03n38_9395_c1 | 3300050490 | Bacteria | 3557 |
| 756 | nmdc:mga00v17_128409_c1 | 3300050491 | Bacteria | 1619 |
| 757 | nmdc:mga00v17_50354_c1 | 3300050491 | Bacteria | 2530 |
| 758 | nmdc:mga0yw44_27946_c1 | 3300050492 | Bacteria | 3239 |
| 759 | nmdc:mga0yw44_392178_c1 | 3300050492 | Bacteria | 938 |
| 760 | nmdc:mga0k408_11950_c1 | 3300050493 | Bacteria | 4737 |
| 761 | nmdc:mga0k408_313196_c1 | 3300050493 | Bacteria | 937 |
| 762 | nmdc:mga0k408_61906_c1 | 3300050493 | Bacteria | 2175 |
| 763 | nmdc:mga0k408_6410_c1 | 3300050493 | Bacteria | 6277 |
| 764 | nmdc:mga06z11_123205_c1 | 3300050494 | Bacteria | 1448 |
| 765 | nmdc:mga06z11_391076_c1 | 3300050494 | Bacteria | 836 |
| 766 | nmdc:mga07m45_135590_c1 | 3300050496 | Bacteria | 1425 |
| 767 | nmdc:mga07m45_22136_c1 | 3300050496 | Bacteria | 3469 |
| 768 | nmdc:mga07m45_320007_c1 | 3300050496 | Unclassified | 902 |
| 769 | nmdc:mga07m45_32397_c1 | 3300050496 | Bacteria | 2899 |
| 770 | nmdc:mga07m45_3705_c1 | 3300050496 | Bacteria | 7393 |
| 771 | nmdc:mga07m45_51559_c1 | 3300050496 | Bacteria | 2321 |
| 772 | nmdc:mga07m45_67562_c1 | 3300050496 | Bacteria | 2031 |
| 773 | nmdc:mga06r32_853514_c1 | 3300050510 | Bacteria | 869 |
| 774 | nmdc:mga0sz30_64676_c1 | 3300050516 | Bacteria | 1567 |
| 775 | Ga0500610_0000435 | 3300053079 | Bacteria | 12885 |
| 776 | Ga0500643_006042 | 3300053087 | Bacteria | 5118 |
| 777 | Ga0500644_0107994 | 3300053088 | Bacteria | 1068 |
| 778 | Ga0500651_0000400 | 3300053093 | Bacteria | 23590 |
| 779 | Ga0500566_0527390 | 3300053094 | Bacteria | 504 |
| 780 | Ga0500560_011563 | 3300053107 | Bacteria | 2257 |
| 781 | Ga0500562_014764 | 3300053108 | Bacteria | 2001 |
| 782 | Ga0500569_095370 | 3300053109 | Bacteria | 969 |
| 783 | Ga0500571_000129 | 3300053110 | Bacteria | 25327 |
| 784 | Ga0500592_004711 | 3300053116 | Bacteria | 2169 |
| 785 | Ga0500593_002479 | 3300053117 | Bacteria | 6777 |
| 786 | Ga0500594_0024273 | 3300053118 | Bacteria | 1543 |
| 787 | Ga0500597_069253 | 3300053120 | Bacteria | 1524 |
| 788 | Ga0500607_011657 | 3300053121 | Bacteria | 5191 |
| 789 | Ga0500608_019812 | 3300053122 | Bacteria | 3089 |
| 790 | Ga0500608_088279 | 3300053122 | Bacteria | 1453 |
| 791 | Ga0500626_031523 | 3300053128 | Bacteria | 2395 |
| 792 | Ga0500655_000665 | 3300053133 | Bacteria | 6824 |
| 793 | Ga0500658_0002393 | 3300053134 | Bacteria | 7265 |
| 794 | Ga0500658_0003299 | 3300053134 | Bacteria | 6124 |
| 795 | Ga0500559_0026484 | 3300053136 | Bacteria | 2470 |
| 796 | Ga0500564_014576 | 3300053138 | Bacteria | 3537 |
| 797 | Ga0500568_0000554 | 3300053139 | Bacteria | 27551 |
| 798 | Ga0500616_0023705 | 3300053153 | Bacteria | 3417 |
| 799 | Ga0500616_0099064 | 3300053153 | Bacteria | 1428 |
| 800 | Ga0500624_024925 | 3300053157 | Bacteria | 991 |
| 801 | Ga0500627_0060057 | 3300053158 | Bacteria | 1671 |
| 802 | Ga0500633_0122162 | 3300053160 | Bacteria | 969 |
| 803 | Ga0500634_0203894 | 3300053161 | Bacteria | 865 |
| 804 | Ga0500638_028219 | 3300053162 | Bacteria | 2696 |
| 805 | Ga0500565_001007 | 3300053734 | Bacteria | 1758 |
| 806 | Ga0587083_0126568 | 3300059505 | Bacteria | 666 |
| 807 | Ga0587079_092884 | 3300059647 | Bacteria | 709 |
| 808 | Ga0587111_0125472 | 3300060346 | Bacteria | 666 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046663 | Ga0495635_0568777 | Ga0495635_0568777_436_726 | 94 |
| 2 | 3300050496 | nmdc:mga07m45_320007_c1 | nmdc:mga07m45_320007_c1_185_499 | 102 |
| 3 | iso_pu_bacteria | 2842747753 | 2842748870 | 102 |
| 4 | iso_pu_bacteria | 2904479285 | 2904481651 | 102 |
| 5 | iso_pu_bacteria | 8056667051 | 8056670980 | 102 |
| 6 | 3300027360 | Ga0209969_1020290 | Ga0209969_10202902 | 103 |
| 7 | 3300037312 | Ga0395899_0036718 | Ga0395899_0036718_3124_3435 | 103 |
| 8 | iso_pu_bacteria | 2643221570 | 2643867769 | 103 |
| 9 | iso_pu_bacteria | 2643221596 | 2643991632 | 103 |
| 10 | iso_pu_bacteria | 2643221652 | 2644293378 | 103 |
| 11 | iso_pu_bacteria | 2721755523 | 2722881986 | 103 |
| 12 | iso_pu_bacteria | 2839138175 | 2839141879 | 103 |
| 13 | iso_pu_bacteria | 2842718218 | 2842718722 | 103 |
| 14 | iso_pu_bacteria | 2928115317 | 2928120658 | 103 |
| 15 | iso_pu_bacteria | 2974320154 | 2974320397 | 103 |
| 16 | iso_pu_bacteria | 2990710928 | 2990713921 | 103 |
| 17 | 3300037418 | Ga0395900_0086732 | Ga0395900_0086732_1816_2133 | 104 |
| 18 | 3300042876 | Ga0451577_0003205 | Ga0451577_0003205_1166_1480 | 104 |
| 19 | 3300046462 | Ga0495651_0149023 | Ga0495651_0149023_1294_1617 | 104 |
| 20 | 3300046463 | Ga0495653_0205963 | Ga0495653_0205963_368_691 | 104 |
| 21 | 3300046477 | Ga0495664_0157147 | Ga0495664_0157147_413_736 | 104 |
| 22 | 3300046516 | Ga0495628_0278829 | Ga0495628_0278829_189_512 | 104 |
| 23 | 3300046529 | Ga0495652_0841240 | Ga0495652_0841240_86_409 | 104 |
| 24 | 3300046690 | Ga0495624_0125401 | Ga0495624_0125401_247_570 | 104 |
| 25 | 3300047319 | Ga0495674_0149356 | Ga0495674_0149356_505_828 | 104 |
| 26 | 3300047321 | Ga0495676_0339912 | Ga0495676_0339912_15_338 | 104 |
| 27 | 3300047471 | Ga0495684_0211415 | Ga0495684_0211415_1007_1330 | 104 |
| 28 | 3300048088 | Ga0495602_0391660 | Ga0495602_0391660_624_947 | 104 |
| 29 | 3300049575 | Ga0501039_0117354 | Ga0501039_0117354_1479_1823 | 104 |
| 30 | iso_pu_bacteria | 2513020051 | 2513229178 | 104 |
| 31 | iso_pu_bacteria | 2599185214 | 2599623399 | 104 |
| 32 | iso_pu_bacteria | 2599185226 | 2599675383 | 104 |
| 33 | iso_pu_bacteria | 2599185227 | 2599681004 | 104 |
| 34 | iso_pu_bacteria | 2599185229 | 2599693019 | 104 |
| 35 | iso_pu_bacteria | 2643221628 | 2644161843 | 104 |
| 36 | iso_pu_bacteria | 2643221658 | 2644325560 | 104 |
| 37 | iso_pu_bacteria | 2643221672 | 2644399279 | 104 |
| 38 | iso_pu_bacteria | 2643221683 | 2644467031 | 104 |
| 39 | iso_pu_bacteria | 2738541277 | 2738718195 | 104 |
| 40 | iso_pu_bacteria | 2738541307 | 2738880419 | 104 |
| 41 | iso_pu_bacteria | 2738543013 | 2739248278 | 104 |
| 42 | iso_pu_bacteria | 2738543019 | 2739281382 | 104 |
| 43 | iso_pu_bacteria | 2818991446 | 2819600575 | 104 |
| 44 | iso_pu_bacteria | 2831265667 | 2831267699 | 104 |
| 45 | iso_pu_bacteria | 2838054893 | 2838061095 | 104 |
| 46 | iso_pu_bacteria | 2842677519 | 2842679824 | 104 |
| 47 | iso_pu_bacteria | 2881101125 | 2881103134 | 104 |
| 48 | iso_pu_bacteria | 2885192300 | 2885196935 | 104 |
| 49 | iso_pu_bacteria | 2885198086 | 2885198831 | 104 |
| 50 | iso_pu_bacteria | 2885211737 | 2885211789 | 104 |
| 51 | iso_pu_bacteria | 2894023352 | 2894024335 | 104 |
| 52 | iso_pu_bacteria | 2899924645 | 2899928278 | 104 |
| 53 | iso_pu_bacteria | 2904449895 | 2904452446 | 104 |
| 54 | iso_pu_bacteria | 2904456579 | 2904460955 | 104 |
| 55 | iso_pu_bacteria | 2919462493 | 2919463922 | 104 |
| 56 | iso_pu_bacteria | 2928037797 | 2928041230 | 104 |
| 57 | iso_pu_bacteria | 2928044640 | 2928048072 | 104 |
| 58 | iso_pu_bacteria | 2928051484 | 2928055913 | 104 |
| 59 | iso_pu_bacteria | 2928064002 | 2928066606 | 104 |
| 60 | iso_pu_bacteria | 2928070936 | 2928077240 | 104 |
| 61 | iso_pu_bacteria | 2928084124 | 2928087541 | 104 |
| 62 | iso_pu_bacteria | 2929520902 | 2929522938 | 104 |
| 63 | iso_pu_bacteria | 2939631187 | 2939636212 | 104 |
| 64 | iso_pu_bacteria | 2945909444 | 2945910085 | 104 |
| 65 | iso_pu_bacteria | 2945945610 | 2945946058 | 104 |
| 66 | iso_pu_bacteria | 2945972063 | 2945975657 | 104 |
| 67 | iso_pu_bacteria | 2945984333 | 2945987899 | 104 |
| 68 | iso_pu_bacteria | 2954767861 | 2954768900 | 104 |
| 69 | 3300005327 | Ga0070658_10595729 | Ga0070658_105957292 | 105 |
| 70 | 3300006353 | Ga0075370_10000910 | Ga0075370_100009108 | 105 |
| 71 | 3300009098 | Ga0105245_11770883 | Ga0105245_117708831 | 105 |
| 72 | 3300026142 | Ga0207698_10807050 | Ga0207698_108070502 | 105 |
| 73 | 3300031235 | Ga0265330_10000046 | Ga0265330_100000468 | 105 |
| 74 | 3300031238 | Ga0265332_10000028 | Ga0265332_10000028104 | 105 |
| 75 | 3300031241 | Ga0265325_10002346 | Ga0265325_100023467 | 105 |
| 76 | 3300031711 | Ga0265314_10000054 | Ga0265314_10000054104 | 105 |
| 77 | 3300041494 | Ga0451837_0713402 | Ga0451837_0713402_228_545 | 105 |
| 78 | 3300044712 | Ga0453684_0517621 | Ga0453684_0517621_565_882 | 105 |
| 79 | 3300050496 | nmdc:mga07m45_3705_c1 | nmdc:mga07m45_3705_c1_858_1175 | 105 |
| 80 | 3300005353 | Ga0070669_100023404 | Ga0070669_1000234045 | 106 |
| 81 | 3300006038 | Ga0075365_10524231 | Ga0075365_105242312 | 106 |
| 82 | 3300013104 | Ga0157370_10190926 | Ga0157370_101909263 | 106 |
| 83 | 3300017792 | Ga0163161_10760085 | Ga0163161_107600851 | 106 |
| 84 | 3300025923 | Ga0207681_10167718 | Ga0207681_101677181 | 106 |
| 85 | 3300032005 | Ga0307411_11627789 | Ga0307411_116277892 | 106 |
| 86 | 3300032126 | Ga0307415_102135942 | Ga0307415_1021359421 | 106 |
| 87 | 3300042015 | Ga0439462_0003446 | Ga0439462_0003446_1542_1862 | 106 |
| 88 | 3300045051 | Ga0451576_0596329 | Ga0451576_0596329_515_835 | 106 |
| 89 | 3300046665 | Ga0495661_0338856 | Ga0495661_0338856_169_489 | 106 |
| 90 | 3300048925 | Ga0496122_0003683 | Ga0496122_0003683_10166_10489 | 106 |
| 91 | 3300048926 | Ga0496123_0000274 | Ga0496123_0000274_5210_5533 | 106 |
| 92 | 3300048927 | Ga0496124_0165467 | Ga0496124_0165467_1186_1509 | 106 |
| 93 | 3300048927 | Ga0496124_0363754 | Ga0496124_0363754_639_962 | 106 |
| 94 | 3300048929 | Ga0496126_0469191 | Ga0496126_0469191_149_472 | 106 |
| 95 | 3300048929 | Ga0496126_0753893 | Ga0496126_0753893_284_607 | 106 |
| 96 | 3300049758 | Ga0501241_020331 | Ga0501241_020331_36_359 | 106 |
| 97 | 2162886007 | SwRhRL2b_contig_3060296 | SwRhRL2b_0634.00000280 | 107 |
| 98 | 3300005327 | Ga0070658_10538782 | Ga0070658_105387822 | 107 |
| 99 | 3300005330 | Ga0070690_100369457 | Ga0070690_1003694572 | 107 |
| 100 | 3300005333 | Ga0070677_10728494 | Ga0070677_107284941 | 107 |
| 101 | 3300005539 | Ga0068853_100192086 | Ga0068853_1001920862 | 107 |
| 102 | 3300005563 | Ga0068855_100447999 | Ga0068855_1004479992 | 107 |
| 103 | 3300006051 | Ga0075364_10014749 | Ga0075364_100147495 | 107 |
| 104 | 3300006353 | Ga0075370_10787231 | Ga0075370_107872312 | 107 |
| 105 | 3300006946 | Ga0079104_1000055 | Ga0079104_100005542 | 107 |
| 106 | 3300009092 | Ga0105250_10001192 | Ga0105250_100011924 | 107 |
| 107 | 3300009098 | Ga0105245_10191294 | Ga0105245_101912943 | 107 |
| 108 | 3300009098 | Ga0105245_12027764 | Ga0105245_120277642 | 107 |
| 109 | 3300009148 | Ga0105243_10002600 | Ga0105243_1000260012 | 107 |
| 110 | 3300009176 | Ga0105242_10006501 | Ga0105242_100065011 | 107 |
| 111 | 3300015262 | Ga0182007_10045568 | Ga0182007_100455682 | 107 |
| 112 | 3300025711 | Ga0207696_1001691 | Ga0207696_100169110 | 107 |
| 113 | 3300025893 | Ga0207682_10490311 | Ga0207682_104903111 | 107 |
| 114 | 3300025909 | Ga0207705_10522442 | Ga0207705_105224422 | 107 |
| 115 | 3300025934 | Ga0207686_10002565 | Ga0207686_100025657 | 107 |
| 116 | 3300025935 | Ga0207709_10000111 | Ga0207709_1000011191 | 107 |
| 117 | 3300026041 | Ga0207639_10109792 | Ga0207639_101097923 | 107 |
| 118 | 3300026041 | Ga0207639_11516496 | Ga0207639_115164961 | 107 |
| 119 | 3300026142 | Ga0207698_12422896 | Ga0207698_124228962 | 107 |
| 120 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007787 | 107 |
| 121 | 3300027252 | Ga0209973_1016250 | Ga0209973_10162502 | 107 |
| 122 | 3300027614 | Ga0209970_1000429 | Ga0209970_10004292 | 107 |
| 123 | 3300027665 | Ga0209983_1020676 | Ga0209983_10206762 | 107 |
| 124 | 3300027665 | Ga0209983_1020895 | Ga0209983_10208952 | 107 |
| 125 | 3300027682 | Ga0209971_1002246 | Ga0209971_10022464 | 107 |
| 126 | 3300027876 | Ga0209974_10013726 | Ga0209974_100137263 | 107 |
| 127 | 3300027876 | Ga0209974_10027694 | Ga0209974_100276942 | 107 |
| 128 | 3300028794 | Ga0307515_10046485 | Ga0307515_100464853 | 107 |
| 129 | 3300031238 | Ga0265332_10030174 | Ga0265332_100301743 | 107 |
| 130 | 3300031242 | Ga0265329_10086791 | Ga0265329_100867912 | 107 |
| 131 | 3300031250 | Ga0265331_10200757 | Ga0265331_102007572 | 107 |
| 132 | 3300031456 | Ga0307513_10167176 | Ga0307513_101671762 | 107 |
| 133 | 3300031548 | Ga0307408_100000456 | Ga0307408_10000045635 | 107 |
| 134 | 3300031711 | Ga0265314_10020486 | Ga0265314_100204863 | 107 |
| 135 | 3300031712 | Ga0265342_10203259 | Ga0265342_102032592 | 107 |
| 136 | 3300031901 | Ga0307406_10000225 | Ga0307406_1000022534 | 107 |
| 137 | 3300032004 | Ga0307414_11421413 | Ga0307414_114214132 | 107 |
| 138 | 3300037312 | Ga0395899_0006534 | Ga0395899_0006534_2077_2436 | 107 |
| 139 | 3300037312 | Ga0395899_0232426 | Ga0395899_0232426_132_455 | 107 |
| 140 | 3300037418 | Ga0395900_0008463 | Ga0395900_0008463_1418_1741 | 107 |
| 141 | 3300037418 | Ga0395900_0094241 | Ga0395900_0094241_1746_2105 | 107 |
| 142 | 3300037418 | Ga0395900_0414353 | Ga0395900_0414353_58_381 | 107 |
| 143 | 3300037418 | Ga0395900_1761372 | Ga0395900_1761372_177_500 | 107 |
| 144 | 3300037466 | Ga0395898_0020733 | Ga0395898_0020733_165_488 | 107 |
| 145 | 3300037466 | Ga0395898_0023184 | Ga0395898_0023184_4171_4530 | 107 |
| 146 | 3300037471 | Ga0395905_0000088 | Ga0395905_0000088_32893_33216 | 107 |
| 147 | 3300037471 | Ga0395905_0001245 | Ga0395905_0001245_17214_17537 | 107 |
| 148 | 3300037471 | Ga0395905_0156874 | Ga0395905_0156874_269_592 | 107 |
| 149 | 3300037471 | Ga0395905_0171382 | Ga0395905_0171382_94_417 | 107 |
| 150 | 3300037471 | Ga0395905_0261549 | Ga0395905_0261549_1144_1503 | 107 |
| 151 | 3300037471 | Ga0395905_0519340 | Ga0395905_0519340_411_734 | 107 |
| 152 | 3300037471 | Ga0395905_0577514 | Ga0395905_0577514_372_695 | 107 |
| 153 | 3300037471 | Ga0395905_0784777 | Ga0395905_0784777_517_840 | 107 |
| 154 | 3300038443 | Ga0395901_0121401 | Ga0395901_0121401_820_1143 | 107 |
| 155 | 3300038443 | Ga0395901_0123823 | Ga0395901_0123823_612_971 | 107 |
| 156 | 3300038443 | Ga0395901_0138444 | Ga0395901_0138444_1262_1585 | 107 |
| 157 | 3300038443 | Ga0395901_0682993 | Ga0395901_0682993_266_589 | 107 |
| 158 | 3300041507 | Ga0451851_1277293 | Ga0451851_1277293_33_356 | 107 |
| 159 | 3300041509 | Ga0451843_1126288 | Ga0451843_1126288_126_449 | 107 |
| 160 | 3300041511 | Ga0451855_0013712 | Ga0451855_0013712_235_558 | 107 |
| 161 | 3300042876 | Ga0451577_0017089 | Ga0451577_0017089_1043_1366 | 107 |
| 162 | 3300044656 | Ga0466969_0025202 | Ga0466969_0025202_1350_1673 | 107 |
| 163 | 3300044656 | Ga0466969_0147217 | Ga0466969_0147217_60_383 | 107 |
| 164 | 3300044656 | Ga0466969_0169310 | Ga0466969_0169310_73_396 | 107 |
| 165 | 3300044658 | Ga0466972_0209843 | Ga0466972_0209843_36_359 | 107 |
| 166 | 3300044673 | Ga0453683_0141395 | Ga0453683_0141395_1154_1477 | 107 |
| 167 | 3300044673 | Ga0453683_0802047 | Ga0453683_0802047_199_522 | 107 |
| 168 | 3300044683 | Ga0466965_0039866 | Ga0466965_0039866_705_1028 | 107 |
| 169 | 3300044684 | Ga0466966_0009243 | Ga0466966_0009243_1620_1943 | 107 |
| 170 | 3300044684 | Ga0466966_0235141 | Ga0466966_0235141_18_341 | 107 |
| 171 | 3300044693 | Ga0466961_0036383 | Ga0466961_0036383_1130_1453 | 107 |
| 172 | 3300044693 | Ga0466961_0056640 | Ga0466961_0056640_1134_1457 | 107 |
| 173 | 3300044712 | Ga0453684_0029360 | Ga0453684_0029360_6035_6358 | 107 |
| 174 | 3300044712 | Ga0453684_0328610 | Ga0453684_0328610_429_752 | 107 |
| 175 | 3300044712 | Ga0453684_2041060 | Ga0453684_2041060_203_526 | 107 |
| 176 | 3300044735 | Ga0466968_0043217 | Ga0466968_0043217_1201_1524 | 107 |
| 177 | 3300044735 | Ga0466968_0584257 | Ga0466968_0584257_155_478 | 107 |
| 178 | 3300044842 | Ga0466957_0085418 | Ga0466957_0085418_856_1179 | 107 |
| 179 | 3300044901 | Ga0466960_0307708 | Ga0466960_0307708_158_481 | 107 |
| 180 | 3300045049 | Ga0466959_0071642 | Ga0466959_0071642_909_1232 | 107 |
| 181 | 3300045049 | Ga0466959_0224187 | Ga0466959_0224187_777_1100 | 107 |
| 182 | 3300045051 | Ga0451576_0002262 | Ga0451576_0002262_4464_4787 | 107 |
| 183 | 3300045836 | Ga0466958_0419431 | Ga0466958_0419431_473_796 | 107 |
| 184 | 3300048905 | Ga0496102_0168147 | Ga0496102_0168147_749_1072 | 107 |
| 185 | 3300048913 | Ga0496110_0334323 | Ga0496110_0334323_283_606 | 107 |
| 186 | 3300048922 | Ga0496119_0179091 | Ga0496119_0179091_155_478 | 107 |
| 187 | 3300048925 | Ga0496122_0026344 | Ga0496122_0026344_2307_2663 | 107 |
| 188 | 3300048926 | Ga0496123_0064937 | Ga0496123_0064937_1185_1541 | 107 |
| 189 | 3300048926 | Ga0496123_0066798 | Ga0496123_0066798_1379_1702 | 107 |
| 190 | 3300048927 | Ga0496124_0122698 | Ga0496124_0122698_1061_1417 | 107 |
| 191 | 3300048928 | Ga0496125_0006965 | Ga0496125_0006965_2159_2515 | 107 |
| 192 | 3300048929 | Ga0496126_0076988 | Ga0496126_0076988_1367_1723 | 107 |
| 193 | 3300049571 | Ga0501034_0098321 | Ga0501034_0098321_2003_2326 | 107 |
| 194 | 3300049572 | Ga0501036_0070727 | Ga0501036_0070727_2227_2550 | 107 |
| 195 | 3300049574 | Ga0501038_0153558 | Ga0501038_0153558_353_676 | 107 |
| 196 | 3300049579 | Ga0501043_0032689 | Ga0501043_0032689_140_463 | 107 |
| 197 | 3300049579 | Ga0501043_0183849 | Ga0501043_0183849_245_568 | 107 |
| 198 | 3300049580 | Ga0501046_0603846 | Ga0501046_0603846_444_767 | 107 |
| 199 | 3300049581 | Ga0501047_0076351 | Ga0501047_0076351_1880_2203 | 107 |
| 200 | 3300049581 | Ga0501047_0166057 | Ga0501047_0166057_998_1321 | 107 |
| 201 | 3300049589 | Ga0501073_0200747 | Ga0501073_0200747_1041_1364 | 107 |
| 202 | 3300049589 | Ga0501073_0920579 | Ga0501073_0920579_73_396 | 107 |
| 203 | 3300049742 | Ga0501080_0052740 | Ga0501080_0052740_400_723 | 107 |
| 204 | 3300049744 | Ga0501083_0963603 | Ga0501083_0963603_70_393 | 107 |
| 205 | 3300049822 | Ga0501035_0598727 | Ga0501035_0598727_273_596 | 107 |
| 206 | 3300049823 | Ga0501044_0073507 | Ga0501044_0073507_1342_1665 | 107 |
| 207 | 3300049823 | Ga0501044_0455396 | Ga0501044_0455396_784_1107 | 107 |
| 208 | 3300050491 | nmdc:mga00v17_50354_c1 | nmdc:mga00v17_50354_c1_1622_1945 | 107 |
| 209 | 3300050493 | nmdc:mga0k408_61906_c1 | nmdc:mga0k408_61906_c1_1121_1444 | 107 |
| 210 | 3300053108 | Ga0500562_014764 | Ga0500562_014764_1218_1541 | 107 |
| 211 | 3300053153 | Ga0500616_0023705 | Ga0500616_0023705_1889_2212 | 107 |
| 212 | 3300059505 | Ga0587083_0126568 | Ga0587083_0126568_213_536 | 107 |
| 213 | 3300059647 | Ga0587079_092884 | Ga0587079_092884_100_423 | 107 |
| 214 | 2010549000 | RicEn_FSXC11605_b1 | RicEn_242400 | 108 |
| 215 | 3300001989 | JGI24739J22299_10013643 | JGI24739J22299_100136432 | 108 |
| 216 | 3300001989 | JGI24739J22299_10138015 | JGI24739J22299_101380152 | 108 |
| 217 | 3300002773 | JGI25152J39213_1002889 | JGI25152J39213_10028893 | 108 |
| 218 | 3300002773 | JGI25152J39213_1016851 | JGI25152J39213_10168513 | 108 |
| 219 | 3300002774 | JGI25150J39212_1006078 | JGI25150J39212_10060782 | 108 |
| 220 | 3300002774 | JGI25150J39212_1025694 | JGI25150J39212_10256942 | 108 |
| 221 | 3300002987 | JGI25159J45721_1001816 | JGI25159J45721_10018165 | 108 |
| 222 | 3300002987 | JGI25159J45721_1002828 | JGI25159J45721_10028284 | 108 |
| 223 | 3300002987 | JGI25159J45721_1033993 | JGI25159J45721_10339931 | 108 |
| 224 | 3300003187 | JGI25151J46595_10004995 | JGI25151J46595_100049953 | 108 |
| 225 | 3300003187 | JGI25151J46595_10017825 | JGI25151J46595_100178254 | 108 |
| 226 | 3300003187 | JGI25151J46595_10024337 | JGI25151J46595_100243373 | 108 |
| 227 | 3300003215 | JGI25153J46596_10004350 | JGI25153J46596_100043505 | 108 |
| 228 | 3300003215 | JGI25153J46596_10005841 | JGI25153J46596_100058415 | 108 |
| 229 | 3300003354 | JGI25160J50197_1012388 | JGI25160J50197_10123884 | 108 |
| 230 | 3300003354 | JGI25160J50197_1013852 | JGI25160J50197_10138524 | 108 |
| 231 | 3300003374 | JGI25161J50226_1004882 | JGI25161J50226_10048824 | 108 |
| 232 | 3300003374 | JGI25161J50226_1006067 | JGI25161J50226_10060672 | 108 |
| 233 | 3300003578 | Ga0006562J51391_1023601 | Ga0006562J51391_10236012 | 108 |
| 234 | 3300003578 | Ga0006562J51391_1031095 | Ga0006562J51391_10310957 | 108 |
| 235 | 3300003760 | Ga0055527_1028814 | Ga0055527_10288142 | 108 |
| 236 | 3300003761 | Ga0055535_1000221 | Ga0055535_100022155 | 108 |
| 237 | 3300003762 | Ga0055542_1000129 | Ga0055542_10001293 | 108 |
| 238 | 3300003771 | Ga0055526_1017544 | Ga0055526_10175444 | 108 |
| 239 | 3300003771 | Ga0055526_1040627 | Ga0055526_10406272 | 108 |
| 240 | 3300003773 | Ga0055537_1000717 | Ga0055537_10007175 | 108 |
| 241 | 3300003773 | Ga0055537_1007164 | Ga0055537_10071644 | 108 |
| 242 | 3300003773 | Ga0055537_1015506 | Ga0055537_10155062 | 108 |
| 243 | 3300003775 | Ga0055524_1015864 | Ga0055524_10158644 | 108 |
| 244 | 3300003775 | Ga0055524_1016902 | Ga0055524_10169023 | 108 |
| 245 | 3300003781 | Ga0055536_1006575 | Ga0055536_10065754 | 108 |
| 246 | 3300003781 | Ga0055536_1009252 | Ga0055536_10092525 | 108 |
| 247 | 3300003781 | Ga0055536_1009441 | Ga0055536_10094413 | 108 |
| 248 | 3300003781 | Ga0055536_1010970 | Ga0055536_10109705 | 108 |
| 249 | 3300003781 | Ga0055536_1061959 | Ga0055536_10619592 | 108 |
| 250 | 3300003784 | Ga0055534_1000337 | Ga0055534_100033724 | 108 |
| 251 | 3300003784 | Ga0055534_1000467 | Ga0055534_100046711 | 108 |
| 252 | 3300003784 | Ga0055534_1002468 | Ga0055534_10024684 | 108 |
| 253 | 3300003784 | Ga0055534_1012342 | Ga0055534_10123422 | 108 |
| 254 | 3300003790 | Ga0055528_1001984 | Ga0055528_10019842 | 108 |
| 255 | 3300003790 | Ga0055528_1015651 | Ga0055528_10156514 | 108 |
| 256 | 3300003790 | Ga0055528_1032456 | Ga0055528_10324562 | 108 |
| 257 | 3300003790 | Ga0055528_1052237 | Ga0055528_10522371 | 108 |
| 258 | 3300003790 | Ga0055528_1089800 | Ga0055528_10898001 | 108 |
| 259 | 3300003791 | Ga0055530_10001548 | Ga0055530_100015485 | 108 |
| 260 | 3300003791 | Ga0055530_10010358 | Ga0055530_100103581 | 108 |
| 261 | 3300003792 | Ga0055540_1003024 | Ga0055540_10030245 | 108 |
| 262 | 3300003792 | Ga0055540_1007603 | Ga0055540_10076034 | 108 |
| 263 | 3300003792 | Ga0055540_1007907 | Ga0055540_10079075 | 108 |
| 264 | 3300003792 | Ga0055540_1012195 | Ga0055540_10121953 | 108 |
| 265 | 3300003792 | Ga0055540_1040378 | Ga0055540_10403782 | 108 |
| 266 | 3300003792 | Ga0055540_1044687 | Ga0055540_10446872 | 108 |
| 267 | 3300003794 | Ga0055531_10000158 | Ga0055531_1000015877 | 108 |
| 268 | 3300003794 | Ga0055531_10002327 | Ga0055531_1000232710 | 108 |
| 269 | 3300003794 | Ga0055531_10008168 | Ga0055531_100081687 | 108 |
| 270 | 3300003794 | Ga0055531_10027234 | Ga0055531_100272343 | 108 |
| 271 | 3300003794 | Ga0055531_10043413 | Ga0055531_100434132 | 108 |
| 272 | 3300004625 | Ga0055543_1002078 | Ga0055543_10020784 | 108 |
| 273 | 3300005262 | Ga0065165_1005994 | Ga0065165_10059945 | 108 |
| 274 | 3300005262 | Ga0065165_1006660 | Ga0065165_10066605 | 108 |
| 275 | 3300005288 | Ga0065714_10068656 | Ga0065714_100686563 | 108 |
| 276 | 3300005288 | Ga0065714_10084655 | Ga0065714_100846553 | 108 |
| 277 | 3300005289 | Ga0065704_10433009 | Ga0065704_104330092 | 108 |
| 278 | 3300005295 | Ga0065707_10141451 | Ga0065707_101414512 | 108 |
| 279 | 3300005327 | Ga0070658_10159049 | Ga0070658_101590492 | 108 |
| 280 | 3300005328 | Ga0070676_10591970 | Ga0070676_105919701 | 108 |
| 281 | 3300005333 | Ga0070677_10470703 | Ga0070677_104707032 | 108 |
| 282 | 3300005334 | Ga0068869_101249725 | Ga0068869_1012497252 | 108 |
| 283 | 3300005335 | Ga0070666_10276076 | Ga0070666_102760762 | 108 |
| 284 | 3300005335 | Ga0070666_11104357 | Ga0070666_111043571 | 108 |
| 285 | 3300005338 | Ga0068868_100309726 | Ga0068868_1003097262 | 108 |
| 286 | 3300005339 | Ga0070660_100555832 | Ga0070660_1005558322 | 108 |
| 287 | 3300005344 | Ga0070661_100239143 | Ga0070661_1002391432 | 108 |
| 288 | 3300005347 | Ga0070668_100434588 | Ga0070668_1004345882 | 108 |
| 289 | 3300005347 | Ga0070668_101596082 | Ga0070668_1015960821 | 108 |
| 290 | 3300005353 | Ga0070669_100122889 | Ga0070669_1001228893 | 108 |
| 291 | 3300005356 | Ga0070674_100300173 | Ga0070674_1003001732 | 108 |
| 292 | 3300005356 | Ga0070674_100535004 | Ga0070674_1005350041 | 108 |
| 293 | 3300005364 | Ga0070673_100747071 | Ga0070673_1007470712 | 108 |
| 294 | 3300005364 | Ga0070673_100965950 | Ga0070673_1009659501 | 108 |
| 295 | 3300005367 | Ga0070667_100062199 | Ga0070667_1000621992 | 108 |
| 296 | 3300005367 | Ga0070667_100319899 | Ga0070667_1003198992 | 108 |
| 297 | 3300005456 | Ga0070678_100025831 | Ga0070678_1000258316 | 108 |
| 298 | 3300005456 | Ga0070678_100508314 | Ga0070678_1005083142 | 108 |
| 299 | 3300005456 | Ga0070678_100766973 | Ga0070678_1007669732 | 108 |
| 300 | 3300005457 | Ga0070662_100815638 | Ga0070662_1008156381 | 108 |
| 301 | 3300005457 | Ga0070662_101731189 | Ga0070662_1017311891 | 108 |
| 302 | 3300005459 | Ga0068867_101178652 | Ga0068867_1011786522 | 108 |
| 303 | 3300005459 | Ga0068867_101277968 | Ga0068867_1012779681 | 108 |
| 304 | 3300005466 | Ga0070685_10134774 | Ga0070685_101347743 | 108 |
| 305 | 3300005543 | Ga0070672_100554661 | Ga0070672_1005546612 | 108 |
| 306 | 3300005548 | Ga0070665_100066375 | Ga0070665_1000663752 | 108 |
| 307 | 3300005548 | Ga0070665_100363848 | Ga0070665_1003638481 | 108 |
| 308 | 3300005563 | Ga0068855_101390765 | Ga0068855_1013907652 | 108 |
| 309 | 3300005564 | Ga0070664_100034087 | Ga0070664_1000340873 | 108 |
| 310 | 3300005577 | Ga0068857_100301577 | Ga0068857_1003015772 | 108 |
| 311 | 3300005577 | Ga0068857_100302096 | Ga0068857_1003020962 | 108 |
| 312 | 3300005577 | Ga0068857_102263502 | Ga0068857_1022635022 | 108 |
| 313 | 3300005578 | Ga0068854_100116114 | Ga0068854_1001161142 | 108 |
| 314 | 3300005578 | Ga0068854_100704906 | Ga0068854_1007049062 | 108 |
| 315 | 3300005614 | Ga0068856_100513221 | Ga0068856_1005132212 | 108 |
| 316 | 3300005616 | Ga0068852_100105818 | Ga0068852_1001058183 | 108 |
| 317 | 3300005616 | Ga0068852_101071830 | Ga0068852_1010718301 | 108 |
| 318 | 3300005834 | Ga0068851_10650954 | Ga0068851_106509542 | 108 |
| 319 | 3300005842 | Ga0068858_100699827 | Ga0068858_1006998272 | 108 |
| 320 | 3300006038 | Ga0075365_10163106 | Ga0075365_101631062 | 108 |
| 321 | 3300006042 | Ga0075368_10088109 | Ga0075368_100881092 | 108 |
| 322 | 3300006042 | Ga0075368_10202258 | Ga0075368_102022582 | 108 |
| 323 | 3300006048 | Ga0075363_100001894 | Ga0075363_1000018946 | 108 |
| 324 | 3300006048 | Ga0075363_100002355 | Ga0075363_1000023557 | 108 |
| 325 | 3300006048 | Ga0075363_100137334 | Ga0075363_1001373342 | 108 |
| 326 | 3300006048 | Ga0075363_100241283 | Ga0075363_1002412832 | 108 |
| 327 | 3300006051 | Ga0075364_10090363 | Ga0075364_100903633 | 108 |
| 328 | 3300006051 | Ga0075364_10471707 | Ga0075364_104717072 | 108 |
| 329 | 3300006051 | Ga0075364_10601099 | Ga0075364_106010992 | 108 |
| 330 | 3300006058 | Ga0075432_10030991 | Ga0075432_100309912 | 108 |
| 331 | 3300006163 | Ga0070715_10927387 | Ga0070715_109273871 | 108 |
| 332 | 3300006177 | Ga0075362_10024189 | Ga0075362_100241893 | 108 |
| 333 | 3300006177 | Ga0075362_10127290 | Ga0075362_101272902 | 108 |
| 334 | 3300006177 | Ga0075362_10204167 | Ga0075362_102041672 | 108 |
| 335 | 3300006177 | Ga0075362_10458926 | Ga0075362_104589261 | 108 |
| 336 | 3300006178 | Ga0075367_10066066 | Ga0075367_100660663 | 108 |
| 337 | 3300006186 | Ga0075369_10063213 | Ga0075369_100632132 | 108 |
| 338 | 3300006186 | Ga0075369_10309748 | Ga0075369_103097482 | 108 |
| 339 | 3300006195 | Ga0075366_10010628 | Ga0075366_100106285 | 108 |
| 340 | 3300006195 | Ga0075366_10033205 | Ga0075366_100332054 | 108 |
| 341 | 3300006195 | Ga0075366_10044518 | Ga0075366_100445182 | 108 |
| 342 | 3300006195 | Ga0075366_10192843 | Ga0075366_101928432 | 108 |
| 343 | 3300006237 | Ga0097621_100497298 | Ga0097621_1004972982 | 108 |
| 344 | 3300006237 | Ga0097621_100544574 | Ga0097621_1005445742 | 108 |
| 345 | 3300006237 | Ga0097621_101326845 | Ga0097621_1013268452 | 108 |
| 346 | 3300006353 | Ga0075370_10002650 | Ga0075370_100026508 | 108 |
| 347 | 3300006353 | Ga0075370_10035610 | Ga0075370_100356102 | 108 |
| 348 | 3300006353 | Ga0075370_10090565 | Ga0075370_100905652 | 108 |
| 349 | 3300006353 | Ga0075370_10337909 | Ga0075370_103379092 | 108 |
| 350 | 3300006353 | Ga0075370_10372816 | Ga0075370_103728162 | 108 |
| 351 | 3300006353 | Ga0075370_10666586 | Ga0075370_106665861 | 108 |
| 352 | 3300006358 | Ga0068871_100819762 | Ga0068871_1008197622 | 108 |
| 353 | 3300006844 | Ga0075428_101712536 | Ga0075428_1017125362 | 108 |
| 354 | 3300006846 | Ga0075430_100152368 | Ga0075430_1001523682 | 108 |
| 355 | 3300006880 | Ga0075429_101508145 | Ga0075429_1015081451 | 108 |
| 356 | 3300006948 | Ga0099826_10001050 | Ga0099826_100010506 | 108 |
| 357 | 3300006948 | Ga0099826_10182867 | Ga0099826_101828672 | 108 |
| 358 | 3300006948 | Ga0099826_10508711 | Ga0099826_105087112 | 108 |
| 359 | 3300009036 | Ga0105244_10003265 | Ga0105244_100032655 | 108 |
| 360 | 3300009036 | Ga0105244_10128001 | Ga0105244_101280012 | 108 |
| 361 | 3300009093 | Ga0105240_10492308 | Ga0105240_104923082 | 108 |
| 362 | 3300009093 | Ga0105240_10659293 | Ga0105240_106592932 | 108 |
| 363 | 3300009148 | Ga0105243_10002036 | Ga0105243_1000203616 | 108 |
| 364 | 3300009148 | Ga0105243_10002550 | Ga0105243_1000255011 | 108 |
| 365 | 3300009148 | Ga0105243_10034165 | Ga0105243_100341654 | 108 |
| 366 | 3300009148 | Ga0105243_11037711 | Ga0105243_110377112 | 108 |
| 367 | 3300009148 | Ga0105243_12718157 | Ga0105243_127181572 | 108 |
| 368 | 3300009174 | Ga0105241_11363289 | Ga0105241_113632891 | 108 |
| 369 | 3300009545 | Ga0105237_10307105 | Ga0105237_103071051 | 108 |
| 370 | 3300009551 | Ga0105238_10159439 | Ga0105238_101594392 | 108 |
| 371 | 3300009551 | Ga0105238_10395476 | Ga0105238_103954763 | 108 |
| 372 | 3300009551 | Ga0105238_12073272 | Ga0105238_120732722 | 108 |
| 373 | 3300009553 | Ga0105249_12219139 | Ga0105249_122191392 | 108 |
| 374 | 3300010375 | Ga0105239_10283024 | Ga0105239_102830243 | 108 |
| 375 | 3300010375 | Ga0105239_10947390 | Ga0105239_109473902 | 108 |
| 376 | 3300011119 | Ga0105246_10062869 | Ga0105246_100628694 | 108 |
| 377 | 3300011119 | Ga0105246_10168653 | Ga0105246_101686532 | 108 |
| 378 | 3300011119 | Ga0105246_11667610 | Ga0105246_116676102 | 108 |
| 379 | 3300012497 | Ga0157319_1008614 | Ga0157319_10086142 | 108 |
| 380 | 3300012502 | Ga0157347_1001331 | Ga0157347_10013313 | 108 |
| 381 | 3300012505 | Ga0157339_1008668 | Ga0157339_10086682 | 108 |
| 382 | 3300013100 | Ga0157373_10106608 | Ga0157373_101066082 | 108 |
| 383 | 3300013102 | Ga0157371_10048625 | Ga0157371_100486253 | 108 |
| 384 | 3300013104 | Ga0157370_10012858 | Ga0157370_100128585 | 108 |
| 385 | 3300013105 | Ga0157369_10008671 | Ga0157369_100086714 | 108 |
| 386 | 3300013105 | Ga0157369_10416856 | Ga0157369_104168561 | 108 |
| 387 | 3300013306 | Ga0163162_10112117 | Ga0163162_101121172 | 108 |
| 388 | 3300013306 | Ga0163162_10603155 | Ga0163162_106031552 | 108 |
| 389 | 3300013306 | Ga0163162_11655664 | Ga0163162_116556642 | 108 |
| 390 | 3300013306 | Ga0163162_12844920 | Ga0163162_128449202 | 108 |
| 391 | 3300013308 | Ga0157375_10059275 | Ga0157375_100592752 | 108 |
| 392 | 3300013308 | Ga0157375_10626110 | Ga0157375_106261102 | 108 |
| 393 | 3300014497 | Ga0182008_10015193 | Ga0182008_100151932 | 108 |
| 394 | 3300014497 | Ga0182008_10085809 | Ga0182008_100858092 | 108 |
| 395 | 3300014497 | Ga0182008_10186350 | Ga0182008_101863502 | 108 |
| 396 | 3300014968 | Ga0157379_11588319 | Ga0157379_115883192 | 108 |
| 397 | 3300015261 | Ga0182006_1043742 | Ga0182006_10437422 | 108 |
| 398 | 3300015261 | Ga0182006_1134424 | Ga0182006_11344241 | 108 |
| 399 | 3300015262 | Ga0182007_10000642 | Ga0182007_1000064217 | 108 |
| 400 | 3300015262 | Ga0182007_10000951 | Ga0182007_1000095110 | 108 |
| 401 | 3300015265 | Ga0182005_1093030 | Ga0182005_10930302 | 108 |
| 402 | 3300015265 | Ga0182005_1124589 | Ga0182005_11245892 | 108 |
| 403 | 3300015683 | Ga0183362_10003 | Ga0183362_10003580 | 108 |
| 404 | 3300017792 | Ga0163161_10001265 | Ga0163161_100012655 | 108 |
| 405 | 3300017792 | Ga0163161_10016923 | Ga0163161_100169233 | 108 |
| 406 | 3300017792 | Ga0163161_10026103 | Ga0163161_100261033 | 108 |
| 407 | 3300017792 | Ga0163161_10066713 | Ga0163161_100667133 | 108 |
| 408 | 3300017792 | Ga0163161_10074264 | Ga0163161_100742643 | 108 |
| 409 | 3300017792 | Ga0163161_11324157 | Ga0163161_113241571 | 108 |
| 410 | 3300025208 | Ga0209436_105358 | Ga0209436_1053582 | 108 |
| 411 | 3300025208 | Ga0209436_110704 | Ga0209436_1107043 | 108 |
| 412 | 3300025228 | Ga0209672_102876 | Ga0209672_1028763 | 108 |
| 413 | 3300025242 | Ga0209258_100240 | Ga0209258_1002404 | 108 |
| 414 | 3300025245 | Ga0207425_1001344 | Ga0207425_10013448 | 108 |
| 415 | 3300025245 | Ga0207425_1003603 | Ga0207425_10036032 | 108 |
| 416 | 3300025254 | Ga0209148_1000033 | Ga0209148_10000334 | 108 |
| 417 | 3300025258 | Ga0209129_1000054 | Ga0209129_100005437 | 108 |
| 418 | 3300025258 | Ga0209129_1003094 | Ga0209129_10030945 | 108 |
| 419 | 3300025258 | Ga0209129_1006468 | Ga0209129_10064685 | 108 |
| 420 | 3300025263 | Ga0209565_1000067 | Ga0209565_1000067175 | 108 |
| 421 | 3300025263 | Ga0209565_1000648 | Ga0209565_100064818 | 108 |
| 422 | 3300025263 | Ga0209565_1002007 | Ga0209565_10020073 | 108 |
| 423 | 3300025273 | Ga0209673_1000097 | Ga0209673_100009769 | 108 |
| 424 | 3300025273 | Ga0209673_1000172 | Ga0209673_100017243 | 108 |
| 425 | 3300025273 | Ga0209673_1001430 | Ga0209673_10014305 | 108 |
| 426 | 3300025273 | Ga0209673_1021934 | Ga0209673_10219343 | 108 |
| 427 | 3300025273 | Ga0209673_1035424 | Ga0209673_10354243 | 108 |
| 428 | 3300025273 | Ga0209673_1054438 | Ga0209673_10544382 | 108 |
| 429 | 3300025284 | Ga0209130_1000954 | Ga0209130_100095418 | 108 |
| 430 | 3300025284 | Ga0209130_1001108 | Ga0209130_100110816 | 108 |
| 431 | 3300025284 | Ga0209130_1001362 | Ga0209130_100136218 | 108 |
| 432 | 3300025291 | Ga0209675_1000038 | Ga0209675_100003869 | 108 |
| 433 | 3300025291 | Ga0209675_1000527 | Ga0209675_100052723 | 108 |
| 434 | 3300025291 | Ga0209675_1000690 | Ga0209675_100069018 | 108 |
| 435 | 3300025291 | Ga0209675_1001272 | Ga0209675_10012729 | 108 |
| 436 | 3300025291 | Ga0209675_1007572 | Ga0209675_10075723 | 108 |
| 437 | 3300025292 | Ga0209676_1000048 | Ga0209676_1000048369 | 108 |
| 438 | 3300025292 | Ga0209676_1000739 | Ga0209676_100073934 | 108 |
| 439 | 3300025292 | Ga0209676_1000836 | Ga0209676_100083613 | 108 |
| 440 | 3300025292 | Ga0209676_1004722 | Ga0209676_10047224 | 108 |
| 441 | 3300025292 | Ga0209676_1013256 | Ga0209676_10132563 | 108 |
| 442 | 3300025292 | Ga0209676_1026113 | Ga0209676_10261132 | 108 |
| 443 | 3300025292 | Ga0209676_1049862 | Ga0209676_10498622 | 108 |
| 444 | 3300025292 | Ga0209676_1058224 | Ga0209676_10582242 | 108 |
| 445 | 3300025294 | Ga0209025_1000174 | Ga0209025_1000174125 | 108 |
| 446 | 3300025294 | Ga0209025_1002139 | Ga0209025_10021395 | 108 |
| 447 | 3300025294 | Ga0209025_1006091 | Ga0209025_10060915 | 108 |
| 448 | 3300025294 | Ga0209025_1009762 | Ga0209025_10097624 | 108 |
| 449 | 3300025294 | Ga0209025_1039557 | Ga0209025_10395572 | 108 |
| 450 | 3300025295 | Ga0209564_1000241 | Ga0209564_100024199 | 108 |
| 451 | 3300025295 | Ga0209564_1001515 | Ga0209564_100151518 | 108 |
| 452 | 3300025297 | Ga0209758_1000034 | Ga0209758_1000034401 | 108 |
| 453 | 3300025297 | Ga0209758_1008758 | Ga0209758_10087587 | 108 |
| 454 | 3300025297 | Ga0209758_1074214 | Ga0209758_10742142 | 108 |
| 455 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012369 | 108 |
| 456 | 3300025298 | Ga0209050_1000294 | Ga0209050_1000294103 | 108 |
| 457 | 3300025298 | Ga0209050_1002666 | Ga0209050_10026665 | 108 |
| 458 | 3300025298 | Ga0209050_1007315 | Ga0209050_10073153 | 108 |
| 459 | 3300025299 | Ga0209256_1000103 | Ga0209256_100010339 | 108 |
| 460 | 3300025299 | Ga0209256_1000165 | Ga0209256_1000165116 | 108 |
| 461 | 3300025299 | Ga0209256_1075865 | Ga0209256_10758652 | 108 |
| 462 | 3300025302 | Ga0207426_1000058 | Ga0207426_1000058167 | 108 |
| 463 | 3300025302 | Ga0207426_1000067 | Ga0207426_1000067290 | 108 |
| 464 | 3300025302 | Ga0207426_1140656 | Ga0207426_11406562 | 108 |
| 465 | 3300025303 | Ga0209051_1000019 | Ga0209051_1000019288 | 108 |
| 466 | 3300025303 | Ga0209051_1000315 | Ga0209051_100031517 | 108 |
| 467 | 3300025303 | Ga0209051_1001398 | Ga0209051_10013985 | 108 |
| 468 | 3300025303 | Ga0209051_1001450 | Ga0209051_100145020 | 108 |
| 469 | 3300025303 | Ga0209051_1001560 | Ga0209051_100156016 | 108 |
| 470 | 3300025303 | Ga0209051_1002634 | Ga0209051_100263411 | 108 |
| 471 | 3300025303 | Ga0209051_1015020 | Ga0209051_10150204 | 108 |
| 472 | 3300025303 | Ga0209051_1024147 | Ga0209051_10241473 | 108 |
| 473 | 3300025303 | Ga0209051_1114300 | Ga0209051_11143002 | 108 |
| 474 | 3300025304 | Ga0209257_1000024 | Ga0209257_1000024315 | 108 |
| 475 | 3300025304 | Ga0209257_1000057 | Ga0209257_1000057232 | 108 |
| 476 | 3300025304 | Ga0209257_1000309 | Ga0209257_100030929 | 108 |
| 477 | 3300025304 | Ga0209257_1007111 | Ga0209257_10071115 | 108 |
| 478 | 3300025304 | Ga0209257_1009377 | Ga0209257_10093772 | 108 |
| 479 | 3300025304 | Ga0209257_1068617 | Ga0209257_10686172 | 108 |
| 480 | 3300025728 | Ga0207655_1000639 | Ga0207655_100063928 | 108 |
| 481 | 3300025893 | Ga0207682_10051721 | Ga0207682_100517211 | 108 |
| 482 | 3300025901 | Ga0207688_10506405 | Ga0207688_105064051 | 108 |
| 483 | 3300025903 | Ga0207680_10182202 | Ga0207680_101822022 | 108 |
| 484 | 3300025907 | Ga0207645_10077097 | Ga0207645_100770972 | 108 |
| 485 | 3300025907 | Ga0207645_10605106 | Ga0207645_106051062 | 108 |
| 486 | 3300025909 | Ga0207705_10604173 | Ga0207705_106041732 | 108 |
| 487 | 3300025913 | Ga0207695_10353626 | Ga0207695_103536262 | 108 |
| 488 | 3300025914 | Ga0207671_10495882 | Ga0207671_104958822 | 108 |
| 489 | 3300025919 | Ga0207657_10766528 | Ga0207657_107665281 | 108 |
| 490 | 3300025923 | Ga0207681_10321139 | Ga0207681_103211392 | 108 |
| 491 | 3300025924 | Ga0207694_10106627 | Ga0207694_101066273 | 108 |
| 492 | 3300025932 | Ga0207690_10458229 | Ga0207690_104582291 | 108 |
| 493 | 3300025932 | Ga0207690_10567080 | Ga0207690_105670802 | 108 |
| 494 | 3300025933 | Ga0207706_10127382 | Ga0207706_101273823 | 108 |
| 495 | 3300025935 | Ga0207709_10000874 | Ga0207709_100008748 | 108 |
| 496 | 3300025935 | Ga0207709_10025717 | Ga0207709_100257172 | 108 |
| 497 | 3300025937 | Ga0207669_10143110 | Ga0207669_101431102 | 108 |
| 498 | 3300025937 | Ga0207669_10285882 | Ga0207669_102858822 | 108 |
| 499 | 3300025937 | Ga0207669_10490133 | Ga0207669_104901331 | 108 |
| 500 | 3300025937 | Ga0207669_11358229 | Ga0207669_113582291 | 108 |
| 501 | 3300025938 | Ga0207704_11455649 | Ga0207704_114556492 | 108 |
| 502 | 3300025940 | Ga0207691_10500935 | Ga0207691_105009352 | 108 |
| 503 | 3300025942 | Ga0207689_10300263 | Ga0207689_103002632 | 108 |
| 504 | 3300025945 | Ga0207679_10053805 | Ga0207679_100538053 | 108 |
| 505 | 3300025949 | Ga0207667_10371498 | Ga0207667_103714982 | 108 |
| 506 | 3300025960 | Ga0207651_11329473 | Ga0207651_113294732 | 108 |
| 507 | 3300025972 | Ga0207668_10601637 | Ga0207668_106016372 | 108 |
| 508 | 3300025981 | Ga0207640_10098316 | Ga0207640_100983163 | 108 |
| 509 | 3300025986 | Ga0207658_10161411 | Ga0207658_101614113 | 108 |
| 510 | 3300025986 | Ga0207658_10320184 | Ga0207658_103201842 | 108 |
| 511 | 3300026023 | Ga0207677_10125692 | Ga0207677_101256922 | 108 |
| 512 | 3300026035 | Ga0207703_10793673 | Ga0207703_107936732 | 108 |
| 513 | 3300026041 | Ga0207639_10007668 | Ga0207639_100076687 | 108 |
| 514 | 3300026067 | Ga0207678_10541618 | Ga0207678_105416182 | 108 |
| 515 | 3300026067 | Ga0207678_11636254 | Ga0207678_116362542 | 108 |
| 516 | 3300026078 | Ga0207702_10460583 | Ga0207702_104605832 | 108 |
| 517 | 3300026089 | Ga0207648_10203104 | Ga0207648_102031042 | 108 |
| 518 | 3300026089 | Ga0207648_11313797 | Ga0207648_113137972 | 108 |
| 519 | 3300026089 | Ga0207648_11632720 | Ga0207648_116327201 | 108 |
| 520 | 3300026116 | Ga0207674_10383653 | Ga0207674_103836532 | 108 |
| 521 | 3300026116 | Ga0207674_10664000 | Ga0207674_106640002 | 108 |
| 522 | 3300026121 | Ga0207683_10054704 | Ga0207683_100547042 | 108 |
| 523 | 3300026121 | Ga0207683_10516967 | Ga0207683_105169672 | 108 |
| 524 | 3300026121 | Ga0207683_11864906 | Ga0207683_118649062 | 108 |
| 525 | 3300026142 | Ga0207698_10034645 | Ga0207698_100346453 | 108 |
| 526 | 3300027471 | Ga0209995_1089223 | Ga0209995_10892231 | 108 |
| 527 | 3300027666 | Ga0209282_1000250 | Ga0209282_10002506 | 108 |
| 528 | 3300027666 | Ga0209282_1288768 | Ga0209282_12887682 | 108 |
| 529 | 3300027907 | Ga0207428_10247795 | Ga0207428_102477952 | 108 |
| 530 | 3300028379 | Ga0268266_10021518 | Ga0268266_100215185 | 108 |
| 531 | 3300028379 | Ga0268266_10877237 | Ga0268266_108772372 | 108 |
| 532 | 3300028786 | Ga0307517_10260146 | Ga0307517_102601461 | 108 |
| 533 | 3300028794 | Ga0307515_10000472 | Ga0307515_1000047291 | 108 |
| 534 | 3300028794 | Ga0307515_10693766 | Ga0307515_106937661 | 108 |
| 535 | 3300030731 | Ga0316177_1034408 | Ga0316177_10344084 | 108 |
| 536 | 3300030731 | Ga0316177_1080169 | Ga0316177_10801691 | 108 |
| 537 | 3300030733 | Ga0314311_1027844 | Ga0314311_10278443 | 108 |
| 538 | 3300030734 | Ga0316179_1049987 | Ga0316179_10499872 | 108 |
| 539 | 3300030735 | Ga0316178_1145977 | Ga0316178_11459773 | 108 |
| 540 | 3300030742 | Ga0316183_1069619 | Ga0316183_10696193 | 108 |
| 541 | 3300030742 | Ga0316183_1109757 | Ga0316183_11097573 | 108 |
| 542 | 3300030744 | Ga0316181_1020350 | Ga0316181_10203503 | 108 |
| 543 | 3300030745 | Ga0316182_1118407 | Ga0316182_11184072 | 108 |
| 544 | 3300031251 | Ga0265327_10001288 | Ga0265327_1000128831 | 108 |
| 545 | 3300031456 | Ga0307513_10324239 | Ga0307513_103242391 | 108 |
| 546 | 3300031548 | Ga0307408_100068273 | Ga0307408_1000682734 | 108 |
| 547 | 3300031548 | Ga0307408_100128683 | Ga0307408_1001286833 | 108 |
| 548 | 3300031548 | Ga0307408_100177894 | Ga0307408_1001778942 | 108 |
| 549 | 3300031548 | Ga0307408_100356005 | Ga0307408_1003560051 | 108 |
| 550 | 3300031548 | Ga0307408_100418682 | Ga0307408_1004186822 | 108 |
| 551 | 3300031548 | Ga0307408_101693924 | Ga0307408_1016939241 | 108 |
| 552 | 3300031731 | Ga0307405_10035253 | Ga0307405_100352534 | 108 |
| 553 | 3300031731 | Ga0307405_10110899 | Ga0307405_101108992 | 108 |
| 554 | 3300031731 | Ga0307405_10138426 | Ga0307405_101384262 | 108 |
| 555 | 3300031731 | Ga0307405_10226574 | Ga0307405_102265742 | 108 |
| 556 | 3300031824 | Ga0307413_10032421 | Ga0307413_100324213 | 108 |
| 557 | 3300031824 | Ga0307413_10046453 | Ga0307413_100464531 | 108 |
| 558 | 3300031824 | Ga0307413_10120537 | Ga0307413_101205372 | 108 |
| 559 | 3300031852 | Ga0307410_10365805 | Ga0307410_103658052 | 108 |
| 560 | 3300031852 | Ga0307410_10525078 | Ga0307410_105250781 | 108 |
| 561 | 3300031901 | Ga0307406_10003957 | Ga0307406_100039574 | 108 |
| 562 | 3300031901 | Ga0307406_10704579 | Ga0307406_107045791 | 108 |
| 563 | 3300031901 | Ga0307406_11197726 | Ga0307406_111977262 | 108 |
| 564 | 3300031901 | Ga0307406_11265560 | Ga0307406_112655601 | 108 |
| 565 | 3300031901 | Ga0307406_11558465 | Ga0307406_115584652 | 108 |
| 566 | 3300031903 | Ga0307407_10111725 | Ga0307407_101117252 | 108 |
| 567 | 3300031903 | Ga0307407_10343576 | Ga0307407_103435762 | 108 |
| 568 | 3300031903 | Ga0307407_10892760 | Ga0307407_108927602 | 108 |
| 569 | 3300031911 | Ga0307412_10047673 | Ga0307412_100476733 | 108 |
| 570 | 3300031911 | Ga0307412_10060086 | Ga0307412_100600863 | 108 |
| 571 | 3300031911 | Ga0307412_10066350 | Ga0307412_100663504 | 108 |
| 572 | 3300031911 | Ga0307412_10316613 | Ga0307412_103166132 | 108 |
| 573 | 3300031911 | Ga0307412_10360466 | Ga0307412_103604662 | 108 |
| 574 | 3300031911 | Ga0307412_10738684 | Ga0307412_107386842 | 108 |
| 575 | 3300031911 | Ga0307412_11014099 | Ga0307412_110140991 | 108 |
| 576 | 3300031995 | Ga0307409_101928884 | Ga0307409_1019288842 | 108 |
| 577 | 3300032002 | Ga0307416_100030507 | Ga0307416_1000305075 | 108 |
| 578 | 3300032002 | Ga0307416_100201880 | Ga0307416_1002018802 | 108 |
| 579 | 3300032002 | Ga0307416_100259942 | Ga0307416_1002599423 | 108 |
| 580 | 3300032002 | Ga0307416_101838027 | Ga0307416_1018380272 | 108 |
| 581 | 3300032004 | Ga0307414_10026501 | Ga0307414_100265013 | 108 |
| 582 | 3300032004 | Ga0307414_10765311 | Ga0307414_107653112 | 108 |
| 583 | 3300032005 | Ga0307411_10169978 | Ga0307411_101699781 | 108 |
| 584 | 3300032005 | Ga0307411_10570046 | Ga0307411_105700461 | 108 |
| 585 | 3300032005 | Ga0307411_11037101 | Ga0307411_110371012 | 108 |
| 586 | 3300032005 | Ga0307411_11819561 | Ga0307411_118195611 | 108 |
| 587 | 3300032005 | Ga0307411_11956100 | Ga0307411_119561001 | 108 |
| 588 | 3300032005 | Ga0307411_11967929 | Ga0307411_119679292 | 108 |
| 589 | 3300037312 | Ga0395899_0003383 | Ga0395899_0003383_2091_2420 | 108 |
| 590 | 3300037312 | Ga0395899_0294665 | Ga0395899_0294665_216_545 | 108 |
| 591 | 3300037418 | Ga0395900_0014177 | Ga0395900_0014177_3509_3838 | 108 |
| 592 | 3300037418 | Ga0395900_0217707 | Ga0395900_0217707_681_1010 | 108 |
| 593 | 3300037466 | Ga0395898_0010814 | Ga0395898_0010814_9191_9520 | 108 |
| 594 | 3300037471 | Ga0395905_0126059 | Ga0395905_0126059_1229_1558 | 108 |
| 595 | 3300037471 | Ga0395905_0221292 | Ga0395905_0221292_307_636 | 108 |
| 596 | 3300037471 | Ga0395905_0484311 | Ga0395905_0484311_120_449 | 108 |
| 597 | 3300037471 | Ga0395905_0758292 | Ga0395905_0758292_437_763 | 108 |
| 598 | 3300038443 | Ga0395901_0039778 | Ga0395901_0039778_12_347 | 108 |
| 599 | 3300038443 | Ga0395901_0117489 | Ga0395901_0117489_16_345 | 108 |
| 600 | 3300038443 | Ga0395901_0452615 | Ga0395901_0452615_715_1044 | 108 |
| 601 | 3300039447 | Ga0436361_0101461 | Ga0436361_0101461_14852_15178 | 108 |
| 602 | 3300041404 | Ga0439436_0000328 | Ga0439436_0000328_2635_2961 | 108 |
| 603 | 3300041404 | Ga0439436_0004062 | Ga0439436_0004062_3102_3428 | 108 |
| 604 | 3300041405 | Ga0439438_024290 | Ga0439438_024290_934_1260 | 108 |
| 605 | 3300041406 | Ga0439439_0008740 | Ga0439439_0008740_966_1292 | 108 |
| 606 | 3300041406 | Ga0439439_0174931 | Ga0439439_0174931_102_428 | 108 |
| 607 | 3300041407 | Ga0439447_011668 | Ga0439447_011668_2108_2434 | 108 |
| 608 | 3300041407 | Ga0439447_027912 | Ga0439447_027912_821_1147 | 108 |
| 609 | 3300041408 | Ga0439453_0009846 | Ga0439453_0009846_893_1222 | 108 |
| 610 | 3300041410 | Ga0439461_0083485 | Ga0439461_0083485_329_655 | 108 |
| 611 | 3300041410 | Ga0439461_0112290 | Ga0439461_0112290_104_430 | 108 |
| 612 | 3300041410 | Ga0439461_0152825 | Ga0439461_0152825_59_388 | 108 |
| 613 | 3300041411 | Ga0439466_0003860 | Ga0439466_0003860_4126_4452 | 108 |
| 614 | 3300041411 | Ga0439466_0004758 | Ga0439466_0004758_4351_4677 | 108 |
| 615 | 3300041413 | Ga0439465_0000335 | Ga0439465_0000335_5272_5598 | 108 |
| 616 | 3300041413 | Ga0439465_0021529 | Ga0439465_0021529_698_1027 | 108 |
| 617 | 3300041441 | Ga0451787_422576 | Ga0451787_422576_65_394 | 108 |
| 618 | 3300041451 | Ga0451791_0144114 | Ga0451791_0144114_230_556 | 108 |
| 619 | 3300041453 | Ga0451797_0753891 | Ga0451797_0753891_142_468 | 108 |
| 620 | 3300041486 | Ga0451807_0354829 | Ga0451807_0354829_93_431 | 108 |
| 621 | 3300041503 | Ga0451847_1003343 | Ga0451847_1003343_180_506 | 108 |
| 622 | 3300041512 | Ga0451853_1371493 | Ga0451853_1371493_240_566 | 108 |
| 623 | 3300041997 | Ga0439431_0002745 | Ga0439431_0002745_802_1128 | 108 |
| 624 | 3300041999 | Ga0439433_0001040 | Ga0439433_0001040_4185_4511 | 108 |
| 625 | 3300042002 | Ga0439442_003077 | Ga0439442_003077_1208_1537 | 108 |
| 626 | 3300042002 | Ga0439442_003207 | Ga0439442_003207_1059_1385 | 108 |
| 627 | 3300042002 | Ga0439442_013480 | Ga0439442_013480_1024_1350 | 108 |
| 628 | 3300042004 | Ga0439445_0002157 | Ga0439445_0002157_2810_3136 | 108 |
| 629 | 3300042004 | Ga0439445_0020234 | Ga0439445_0020234_67_396 | 108 |
| 630 | 3300042004 | Ga0439445_0052016 | Ga0439445_0052016_497_823 | 108 |
| 631 | 3300042006 | Ga0439432_001277 | Ga0439432_001277_1676_2002 | 108 |
| 632 | 3300042006 | Ga0439432_007245 | Ga0439432_007245_3111_3437 | 108 |
| 633 | 3300042007 | Ga0439449_0001202 | Ga0439449_0001202_1045_1371 | 108 |
| 634 | 3300042007 | Ga0439449_0003003 | Ga0439449_0003003_5194_5520 | 108 |
| 635 | 3300042007 | Ga0439449_0007077 | Ga0439449_0007077_1518_1847 | 108 |
| 636 | 3300042007 | Ga0439449_0041944 | Ga0439449_0041944_202_528 | 108 |
| 637 | 3300042010 | Ga0439452_003207 | Ga0439452_003207_3876_4202 | 108 |
| 638 | 3300042010 | Ga0439452_023010 | Ga0439452_023010_1181_1507 | 108 |
| 639 | 3300042011 | Ga0439454_030628 | Ga0439454_030628_119_448 | 108 |
| 640 | 3300042014 | Ga0439457_001739 | Ga0439457_001739_3344_3670 | 108 |
| 641 | 3300042014 | Ga0439457_024364 | Ga0439457_024364_931_1257 | 108 |
| 642 | 3300042015 | Ga0439462_0001618 | Ga0439462_0001618_3086_3412 | 108 |
| 643 | 3300042015 | Ga0439462_0014579 | Ga0439462_0014579_895_1221 | 108 |
| 644 | 3300042015 | Ga0439462_0068215 | Ga0439462_0068215_550_879 | 108 |
| 645 | 3300042016 | Ga0439463_031283 | Ga0439463_031283_34_360 | 108 |
| 646 | 3300042115 | Ga0450911_001790 | Ga0450911_001790_3267_3593 | 108 |
| 647 | 3300042116 | Ga0450912_006428 | Ga0450912_006428_499_825 | 108 |
| 648 | 3300042122 | Ga0450920_053079 | Ga0450920_053079_117_446 | 108 |
| 649 | 3300042123 | Ga0450921_007502 | Ga0450921_007502_350_679 | 108 |
| 650 | 3300042123 | Ga0450921_029709 | Ga0450921_029709_113_439 | 108 |
| 651 | 3300042125 | Ga0450923_003016 | Ga0450923_003016_1081_1410 | 108 |
| 652 | 3300042128 | Ga0450897_016804 | Ga0450897_016804_267_593 | 108 |
| 653 | 3300042131 | Ga0450894_013319 | Ga0450894_013319_66_392 | 108 |
| 654 | 3300042133 | Ga0450896_014494 | Ga0450896_014494_558_884 | 108 |
| 655 | 3300042133 | Ga0450896_039304 | Ga0450896_039304_145_474 | 108 |
| 656 | 3300042134 | Ga0450898_002224 | Ga0450898_002224_1824_2153 | 108 |
| 657 | 3300042134 | Ga0450898_027176 | Ga0450898_027176_171_497 | 108 |
| 658 | 3300042145 | Ga0450906_003495 | Ga0450906_003495_2640_2969 | 108 |
| 659 | 3300042146 | Ga0450907_008273 | Ga0450907_008273_513_842 | 108 |
| 660 | 3300042147 | Ga0450910_006248 | Ga0450910_006248_1095_1424 | 108 |
| 661 | 3300042156 | Ga0439446_0001983 | Ga0439446_0001983_4181_4507 | 108 |
| 662 | 3300042156 | Ga0439446_0032073 | Ga0439446_0032073_367_696 | 108 |
| 663 | 3300042184 | Ga0450908_013209 | Ga0450908_013209_724_1053 | 108 |
| 664 | 3300042184 | Ga0450908_053513 | Ga0450908_053513_132_458 | 108 |
| 665 | 3300042185 | Ga0450909_009490 | Ga0450909_009490_35_361 | 108 |
| 666 | 3300042185 | Ga0450909_013238 | Ga0450909_013238_311_637 | 108 |
| 667 | 3300042435 | Ga0439434_0016246 | Ga0439434_0016246_1270_1596 | 108 |
| 668 | 3300042435 | Ga0439434_0023986 | Ga0439434_0023986_310_639 | 108 |
| 669 | 3300042435 | Ga0439434_0032026 | Ga0439434_0032026_408_737 | 108 |
| 670 | 3300042435 | Ga0439434_0036215 | Ga0439434_0036215_408_734 | 108 |
| 671 | 3300042439 | Ga0439464_0059805 | Ga0439464_0059805_384_713 | 108 |
| 672 | 3300042530 | Ga0450916_071003 | Ga0450916_071003_11_337 | 108 |
| 673 | 3300042531 | Ga0450918_000837 | Ga0450918_000837_4862_5191 | 108 |
| 674 | 3300042876 | Ga0451577_0000276 | Ga0451577_0000276_78908_79270 | 108 |
| 675 | 3300042876 | Ga0451577_1479152 | Ga0451577_1479152_144_470 | 108 |
| 676 | 3300044673 | Ga0453683_0012232 | Ga0453683_0012232_1092_1418 | 108 |
| 677 | 3300044683 | Ga0466965_0043939 | Ga0466965_0043939_1024_1350 | 108 |
| 678 | 3300044683 | Ga0466965_0075588 | Ga0466965_0075588_922_1248 | 108 |
| 679 | 3300044693 | Ga0466961_0168159 | Ga0466961_0168159_153_479 | 108 |
| 680 | 3300044712 | Ga0453684_0000891 | Ga0453684_0000891_20229_20591 | 108 |
| 681 | 3300044901 | Ga0466960_0014488 | Ga0466960_0014488_451_777 | 108 |
| 682 | 3300044901 | Ga0466960_0176268 | Ga0466960_0176268_500_835 | 108 |
| 683 | 3300044901 | Ga0466960_1024777 | Ga0466960_1024777_93_422 | 108 |
| 684 | 3300045051 | Ga0451576_0004706 | Ga0451576_0004706_11433_11759 | 108 |
| 685 | 3300045051 | Ga0451576_0605340 | Ga0451576_0605340_323_652 | 108 |
| 686 | 3300046453 | Ga0495627_010560 | Ga0495627_010560_1865_2191 | 108 |
| 687 | 3300046454 | Ga0495592_0428935 | Ga0495592_0428935_174_500 | 108 |
| 688 | 3300046459 | Ga0495629_0185708 | Ga0495629_0185708_582_908 | 108 |
| 689 | 3300046459 | Ga0495629_0402427 | Ga0495629_0402427_97_423 | 108 |
| 690 | 3300046463 | Ga0495653_0744655 | Ga0495653_0744655_122_448 | 108 |
| 691 | 3300046475 | Ga0495639_0012096 | Ga0495639_0012096_2902_3228 | 108 |
| 692 | 3300046512 | Ga0495610_0024146 | Ga0495610_0024146_2329_2655 | 108 |
| 693 | 3300046512 | Ga0495610_0195897 | Ga0495610_0195897_488_814 | 108 |
| 694 | 3300046513 | Ga0495616_0006871 | Ga0495616_0006871_6415_6741 | 108 |
| 695 | 3300046514 | Ga0495618_0180871 | Ga0495618_0180871_173_499 | 108 |
| 696 | 3300046515 | Ga0495620_0064465 | Ga0495620_0064465_302_628 | 108 |
| 697 | 3300046515 | Ga0495620_0140238 | Ga0495620_0140238_80_406 | 108 |
| 698 | 3300046517 | Ga0495630_1344912 | Ga0495630_1344912_142_468 | 108 |
| 699 | 3300046518 | Ga0495631_0004279 | Ga0495631_0004279_4140_4466 | 108 |
| 700 | 3300046520 | Ga0495637_0006661 | Ga0495637_0006661_1062_1388 | 108 |
| 701 | 3300046525 | Ga0495663_0024751 | Ga0495663_0024751_1364_1699 | 108 |
| 702 | 3300046525 | Ga0495663_0090132 | Ga0495663_0090132_146_472 | 108 |
| 703 | 3300046528 | Ga0495642_0035383 | Ga0495642_0035383_554_880 | 108 |
| 704 | 3300046528 | Ga0495642_0118454 | Ga0495642_0118454_405_740 | 108 |
| 705 | 3300046529 | Ga0495652_0294786 | Ga0495652_0294786_250_576 | 108 |
| 706 | 3300046530 | Ga0495654_0043341 | Ga0495654_0043341_762_1088 | 108 |
| 707 | 3300046535 | Ga0495586_0332902 | Ga0495586_0332902_392_718 | 108 |
| 708 | 3300046536 | Ga0495587_0447736 | Ga0495587_0447736_260_586 | 108 |
| 709 | 3300046538 | Ga0495609_0088811 | Ga0495609_0088811_720_1046 | 108 |
| 710 | 3300046539 | Ga0495621_0060176 | Ga0495621_0060176_723_1049 | 108 |
| 711 | 3300046539 | Ga0495621_0157890 | Ga0495621_0157890_456_782 | 108 |
| 712 | 3300046543 | Ga0495645_0431969 | Ga0495645_0431969_315_641 | 108 |
| 713 | 3300046557 | Ga0495622_0289819 | Ga0495622_0289819_41_367 | 108 |
| 714 | 3300046558 | Ga0495633_0042415 | Ga0495633_0042415_1317_1652 | 108 |
| 715 | 3300046558 | Ga0495633_0288542 | Ga0495633_0288542_94_420 | 108 |
| 716 | 3300046615 | Ga0495656_0000090 | Ga0495656_0000090_26792_27118 | 108 |
| 717 | 3300046615 | Ga0495656_0045688 | Ga0495656_0045688_861_1232 | 108 |
| 718 | 3300046615 | Ga0495656_0064024 | Ga0495656_0064024_32_367 | 108 |
| 719 | 3300046615 | Ga0495656_0163209 | Ga0495656_0163209_192_518 | 108 |
| 720 | 3300046660 | Ga0495625_0001055 | Ga0495625_0001055_31095_31424 | 108 |
| 721 | 3300046660 | Ga0495625_0035184 | Ga0495625_0035184_2750_3076 | 108 |
| 722 | 3300046660 | Ga0495625_0058131 | Ga0495625_0058131_1657_1983 | 108 |
| 723 | 3300046665 | Ga0495661_0149149 | Ga0495661_0149149_446_772 | 108 |
| 724 | 3300046674 | Ga0495588_0065501 | Ga0495588_0065501_1158_1493 | 108 |
| 725 | 3300046674 | Ga0495588_0134042 | Ga0495588_0134042_572_898 | 108 |
| 726 | 3300046675 | Ga0495657_0357776 | Ga0495657_0357776_278_604 | 108 |
| 727 | 3300046684 | Ga0495669_0092764 | Ga0495669_0092764_153_488 | 108 |
| 728 | 3300046684 | Ga0495669_0451213 | Ga0495669_0451213_38_364 | 108 |
| 729 | 3300046689 | Ga0495613_0516400 | Ga0495613_0516400_287_613 | 108 |
| 730 | 3300046690 | Ga0495624_0459963 | Ga0495624_0459963_185_511 | 108 |
| 731 | 3300046691 | Ga0495670_0156653 | Ga0495670_0156653_837_1163 | 108 |
| 732 | 3300046691 | Ga0495670_0370342 | Ga0495670_0370342_250_576 | 108 |
| 733 | 3300046692 | Ga0495671_0033400 | Ga0495671_0033400_2183_2509 | 108 |
| 734 | 3300046809 | Ga0495600_0673660 | Ga0495600_0673660_210_536 | 108 |
| 735 | 3300047318 | Ga0495636_0035291 | Ga0495636_0035291_972_1307 | 108 |
| 736 | 3300047321 | Ga0495676_0077660 | Ga0495676_0077660_787_1113 | 108 |
| 737 | 3300047321 | Ga0495676_0661797 | Ga0495676_0661797_194_520 | 108 |
| 738 | 3300047321 | Ga0495676_0754657 | Ga0495676_0754657_212_538 | 108 |
| 739 | 3300047322 | Ga0495680_0649593 | Ga0495680_0649593_23_349 | 108 |
| 740 | 3300047445 | Ga0495677_0185109 | Ga0495677_0185109_131_466 | 108 |
| 741 | 3300047447 | Ga0495685_020122 | Ga0495685_020122_23_358 | 108 |
| 742 | 3300047472 | Ga0495686_0252038 | Ga0495686_0252038_491_817 | 108 |
| 743 | 3300047472 | Ga0495686_0289959 | Ga0495686_0289959_288_614 | 108 |
| 744 | 3300048088 | Ga0495602_0268765 | Ga0495602_0268765_605_931 | 108 |
| 745 | 3300048089 | Ga0495614_0029162 | Ga0495614_0029162_754_1080 | 108 |
| 746 | 3300048089 | Ga0495614_0031400 | Ga0495614_0031400_488_814 | 108 |
| 747 | 3300048090 | Ga0495615_0036591 | Ga0495615_0036591_325_651 | 108 |
| 748 | 3300048090 | Ga0495615_0164403 | Ga0495615_0164403_61_387 | 108 |
| 749 | 3300048903 | Ga0496100_0523034 | Ga0496100_0523034_540_869 | 108 |
| 750 | 3300048903 | Ga0496100_0758544 | Ga0496100_0758544_394_720 | 108 |
| 751 | 3300048903 | Ga0496100_0824716 | Ga0496100_0824716_93_419 | 108 |
| 752 | 3300048903 | Ga0496100_1092987 | Ga0496100_1092987_128_454 | 108 |
| 753 | 3300048904 | Ga0496101_0051772 | Ga0496101_0051772_2117_2446 | 108 |
| 754 | 3300048905 | Ga0496102_0004957 | Ga0496102_0004957_7577_7903 | 108 |
| 755 | 3300048905 | Ga0496102_0160011 | Ga0496102_0160011_686_1012 | 108 |
| 756 | 3300048906 | Ga0496103_0103764 | Ga0496103_0103764_1270_1596 | 108 |
| 757 | 3300048907 | Ga0496104_0008675 | Ga0496104_0008675_5546_5872 | 108 |
| 758 | 3300048908 | Ga0496105_0010700 | Ga0496105_0010700_5502_5828 | 108 |
| 759 | 3300048909 | Ga0496106_0008933 | Ga0496106_0008933_171_497 | 108 |
| 760 | 3300048911 | Ga0496108_0090817 | Ga0496108_0090817_1079_1405 | 108 |
| 761 | 3300048912 | Ga0496109_0250036 | Ga0496109_0250036_1013_1339 | 108 |
| 762 | 3300048913 | Ga0496110_0450067 | Ga0496110_0450067_824_1150 | 108 |
| 763 | 3300048913 | Ga0496110_0681768 | Ga0496110_0681768_579_905 | 108 |
| 764 | 3300048914 | Ga0496111_0623212 | Ga0496111_0623212_20_346 | 108 |
| 765 | 3300048915 | Ga0496112_0247614 | Ga0496112_0247614_554_880 | 108 |
| 766 | 3300048916 | Ga0496113_0209231 | Ga0496113_0209231_980_1306 | 108 |
| 767 | 3300048919 | Ga0496116_0026461 | Ga0496116_0026461_3025_3354 | 108 |
| 768 | 3300048920 | Ga0496117_0048605 | Ga0496117_0048605_1350_1676 | 108 |
| 769 | 3300048920 | Ga0496117_0099448 | Ga0496117_0099448_801_1130 | 108 |
| 770 | 3300048921 | Ga0496118_0038816 | Ga0496118_0038816_1166_1492 | 108 |
| 771 | 3300048921 | Ga0496118_0100657 | Ga0496118_0100657_189_518 | 108 |
| 772 | 3300048922 | Ga0496119_0205620 | Ga0496119_0205620_240_566 | 108 |
| 773 | 3300048924 | Ga0496121_0010814 | Ga0496121_0010814_8017_8343 | 108 |
| 774 | 3300048924 | Ga0496121_0057522 | Ga0496121_0057522_2613_2942 | 108 |
| 775 | 3300048924 | Ga0496121_0325745 | Ga0496121_0325745_40_366 | 108 |
| 776 | 3300048925 | Ga0496122_0062562 | Ga0496122_0062562_423_749 | 108 |
| 777 | 3300048925 | Ga0496122_0096773 | Ga0496122_0096773_471_800 | 108 |
| 778 | 3300048926 | Ga0496123_0045998 | Ga0496123_0045998_1676_2002 | 108 |
| 779 | 3300048926 | Ga0496123_0319517 | Ga0496123_0319517_263_592 | 108 |
| 780 | 3300048927 | Ga0496124_0037636 | Ga0496124_0037636_1004_1330 | 108 |
| 781 | 3300048927 | Ga0496124_0073316 | Ga0496124_0073316_1310_1639 | 108 |
| 782 | 3300048927 | Ga0496124_0181661 | Ga0496124_0181661_1157_1483 | 108 |
| 783 | 3300048927 | Ga0496124_0602261 | Ga0496124_0602261_187_516 | 108 |
| 784 | 3300048928 | Ga0496125_0026721 | Ga0496125_0026721_4307_4633 | 108 |
| 785 | 3300048928 | Ga0496125_0030178 | Ga0496125_0030178_1115_1441 | 108 |
| 786 | 3300048928 | Ga0496125_0090108 | Ga0496125_0090108_746_1072 | 108 |
| 787 | 3300048928 | Ga0496125_0090995 | Ga0496125_0090995_1039_1368 | 108 |
| 788 | 3300048928 | Ga0496125_0154906 | Ga0496125_0154906_1166_1492 | 108 |
| 789 | 3300048928 | Ga0496125_0334759 | Ga0496125_0334759_490_819 | 108 |
| 790 | 3300048929 | Ga0496126_0372416 | Ga0496126_0372416_574_900 | 108 |
| 791 | 3300048929 | Ga0496126_0571419 | Ga0496126_0571419_521_847 | 108 |
| 792 | 3300049127 | Ga0501306_050789 | Ga0501306_050789_10_339 | 108 |
| 793 | 3300049130 | Ga0501310_039787 | Ga0501310_039787_184_513 | 108 |
| 794 | 3300049515 | Ga0501292_134997 | Ga0501292_134997_151_480 | 108 |
| 795 | 3300049526 | Ga0501303_026821 | Ga0501303_026821_104_433 | 108 |
| 796 | 3300049572 | Ga0501036_0484402 | Ga0501036_0484402_151_495 | 108 |
| 797 | 3300049581 | Ga0501047_0043447 | Ga0501047_0043447_2297_2626 | 108 |
| 798 | 3300049653 | Ga0501206_037287 | Ga0501206_037287_248_577 | 108 |
| 799 | 3300049679 | Ga0501249_093532 | Ga0501249_093532_38_367 | 108 |
| 800 | 3300049682 | Ga0501252_045450 | Ga0501252_045450_86_415 | 108 |
| 801 | 3300049704 | Ga0501221_080328 | Ga0501221_080328_333_662 | 108 |
| 802 | 3300049705 | Ga0501225_0077783 | Ga0501225_0077783_574_903 | 108 |
| 803 | 3300049707 | Ga0501234_084814 | Ga0501234_084814_52_381 | 108 |
| 804 | 3300049758 | Ga0501241_111436 | Ga0501241_111436_98_427 | 108 |
| 805 | 3300049759 | Ga0501262_001111 | Ga0501262_001111_2513_2842 | 108 |
| 806 | 3300049760 | Ga0501263_046701 | Ga0501263_046701_103_435 | 108 |
| 807 | 3300049760 | Ga0501263_080653 | Ga0501263_080653_110_439 | 108 |
| 808 | 3300050489 | nmdc:mga03683_10715_c1 | nmdc:mga03683_10715_c1_2504_2836 | 108 |
| 809 | 3300050489 | nmdc:mga03683_28534_c1 | nmdc:mga03683_28534_c1_903_1232 | 108 |
| 810 | 3300050489 | nmdc:mga03683_47346_c1 | nmdc:mga03683_47346_c1_459_788 | 108 |
| 811 | 3300050489 | nmdc:mga03683_50064_c1 | nmdc:mga03683_50064_c1_1397_1723 | 108 |
| 812 | 3300050490 | nmdc:mga03n38_119223_c1 | nmdc:mga03n38_119223_c1_655_984 | 108 |
| 813 | 3300050490 | nmdc:mga03n38_1785_c1 | nmdc:mga03n38_1785_c1_4803_5129 | 108 |
| 814 | 3300050490 | nmdc:mga03n38_9395_c1 | nmdc:mga03n38_9395_c1_1936_2265 | 108 |
| 815 | 3300050491 | nmdc:mga00v17_128409_c1 | nmdc:mga00v17_128409_c1_1045_1374 | 108 |
| 816 | 3300050492 | nmdc:mga0yw44_27946_c1 | nmdc:mga0yw44_27946_c1_2786_3115 | 108 |
| 817 | 3300050492 | nmdc:mga0yw44_392178_c1 | nmdc:mga0yw44_392178_c1_571_900 | 108 |
| 818 | 3300050493 | nmdc:mga0k408_11950_c1 | nmdc:mga0k408_11950_c1_2812_3141 | 108 |
| 819 | 3300050493 | nmdc:mga0k408_313196_c1 | nmdc:mga0k408_313196_c1_212_538 | 108 |
| 820 | 3300050493 | nmdc:mga0k408_6410_c1 | nmdc:mga0k408_6410_c1_1812_2138 | 108 |
| 821 | 3300050494 | nmdc:mga06z11_123205_c1 | nmdc:mga06z11_123205_c1_340_669 | 108 |
| 822 | 3300050494 | nmdc:mga06z11_391076_c1 | nmdc:mga06z11_391076_c1_167_496 | 108 |
| 823 | 3300050496 | nmdc:mga07m45_135590_c1 | nmdc:mga07m45_135590_c1_946_1281 | 108 |
| 824 | 3300050496 | nmdc:mga07m45_22136_c1 | nmdc:mga07m45_22136_c1_1871_2197 | 108 |
| 825 | 3300050496 | nmdc:mga07m45_32397_c1 | nmdc:mga07m45_32397_c1_394_720 | 108 |
| 826 | 3300050496 | nmdc:mga07m45_51559_c1 | nmdc:mga07m45_51559_c1_952_1281 | 108 |
| 827 | 3300050496 | nmdc:mga07m45_67562_c1 | nmdc:mga07m45_67562_c1_1055_1384 | 108 |
| 828 | 3300050510 | nmdc:mga06r32_853514_c1 | nmdc:mga06r32_853514_c1_386_721 | 108 |
| 829 | 3300050516 | nmdc:mga0sz30_64676_c1 | nmdc:mga0sz30_64676_c1_580_906 | 108 |
| 830 | 3300053079 | Ga0500610_0000435 | Ga0500610_0000435_11951_12277 | 108 |
| 831 | 3300053087 | Ga0500643_006042 | Ga0500643_006042_3529_3855 | 108 |
| 832 | 3300053088 | Ga0500644_0107994 | Ga0500644_0107994_335_661 | 108 |
| 833 | 3300053093 | Ga0500651_0000400 | Ga0500651_0000400_1210_1536 | 108 |
| 834 | 3300053094 | Ga0500566_0527390 | Ga0500566_0527390_156_482 | 108 |
| 835 | 3300053107 | Ga0500560_011563 | Ga0500560_011563_1003_1329 | 108 |
| 836 | 3300053109 | Ga0500569_095370 | Ga0500569_095370_173_499 | 108 |
| 837 | 3300053110 | Ga0500571_000129 | Ga0500571_000129_23906_24232 | 108 |
| 838 | 3300053116 | Ga0500592_004711 | Ga0500592_004711_536_862 | 108 |
| 839 | 3300053117 | Ga0500593_002479 | Ga0500593_002479_5276_5602 | 108 |
| 840 | 3300053118 | Ga0500594_0024273 | Ga0500594_0024273_1139_1465 | 108 |
| 841 | 3300053120 | Ga0500597_069253 | Ga0500597_069253_1057_1383 | 108 |
| 842 | 3300053121 | Ga0500607_011657 | Ga0500607_011657_3630_3956 | 108 |
| 843 | 3300053122 | Ga0500608_019812 | Ga0500608_019812_1642_1968 | 108 |
| 844 | 3300053122 | Ga0500608_088279 | Ga0500608_088279_77_403 | 108 |
| 845 | 3300053128 | Ga0500626_031523 | Ga0500626_031523_1511_1837 | 108 |
| 846 | 3300053133 | Ga0500655_000665 | Ga0500655_000665_4284_4610 | 108 |
| 847 | 3300053134 | Ga0500658_0002393 | Ga0500658_0002393_2393_2719 | 108 |
| 848 | 3300053134 | Ga0500658_0003299 | Ga0500658_0003299_1247_1573 | 108 |
| 849 | 3300053136 | Ga0500559_0026484 | Ga0500559_0026484_1206_1532 | 108 |
| 850 | 3300053138 | Ga0500564_014576 | Ga0500564_014576_1118_1444 | 108 |
| 851 | 3300053139 | Ga0500568_0000554 | Ga0500568_0000554_18926_19252 | 108 |
| 852 | 3300053153 | Ga0500616_0099064 | Ga0500616_0099064_945_1271 | 108 |
| 853 | 3300053157 | Ga0500624_024925 | Ga0500624_024925_567_893 | 108 |
| 854 | 3300053158 | Ga0500627_0060057 | Ga0500627_0060057_145_471 | 108 |
| 855 | 3300053160 | Ga0500633_0122162 | Ga0500633_0122162_555_881 | 108 |
| 856 | 3300053161 | Ga0500634_0203894 | Ga0500634_0203894_134_460 | 108 |
| 857 | 3300053162 | Ga0500638_028219 | Ga0500638_028219_1240_1566 | 108 |
| 858 | 3300053734 | Ga0500565_001007 | Ga0500565_001007_436_762 | 108 |
| 859 | 3300060346 | Ga0587111_0125472 | Ga0587111_0125472_148_474 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wul-assembly1.cif.gz_D | crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster | 0.9705 | 5 | 104 |
| 2wci-assembly1.cif.gz_A | structure of e. coli monothiol glutaredoxin grx4 homodimer | 0.9572 | 1 | 104 |
| 2mma-assembly1.cif.gz_A | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.9565 | 1 | 104 |
| 3zyw-assembly1.cif.gz_A | crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) | 0.9541 | 3 | 102 |
| 2yan-assembly2.cif.gz_B | crystal structure of the second glutaredoxin domain of human txnl2 | 0.9265 | 1 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q555C8_40_141_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9804 | 8 | 104 | 3.40.30.10 |
| af_O97232_76_171_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9739 | 8 | 103 | 3.40.30.10 |
| af_B6TEC7_84_191_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9724 | 8 | 104 | 3.40.30.10 |
| 2wemC01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9682 | 8 | 104 | 3.40.30.10 |
| af_C6KSR7_119_214_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.968 | 7 | 102 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A562BC22-F1-model_v4 | Glutaredoxin | 1.001 | 1 | 105 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A431KB48-F1-model_v4 | Glutaredoxin | 0.9948 | 1 | 106 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A2P7NUZ1-F1-model_v4 | Glutaredoxin | 0.9917 | 4 | 102 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A2S5LYP8-F1-model_v4 | Glutaredoxin | 0.9907 | 3 | 104 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A521Y5Y7-F1-model_v4 | Glutaredoxin | 0.9904 | 4 | 104 |
GO:0015036
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar