F483792

General Info

Members Datasets Scaffolds Average Seq Length
859 454 808 108

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0045688|Ga0495656_0045688_861_1232
Length 123
Sequence MCADGAPQGEFEMSDVQQRIDQLVKSNDVLLFMKGSASFPMCGFSGRAIQILKACGVDPRAVATVNVLEDDEIRQAIKDYSNWPTIPQLYVRGEFIGGSDIMMEMYQSGELQQVLGSTAGTQG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
11 2643221652 Acidovorax sp. Root402 Isolate Unclassified
12 2643221658 Variovorax sp. Root411 Isolate Unclassified
13 2643221672 Variovorax sp. Root434 Isolate Unclassified
14 2643221683 Variovorax sp. Root473 Isolate Unclassified
15 2721755523 Delftia sp. HK171 Isolate Unclassified
16 2738541277 Variovorax sp. GV051 Isolate Unclassified
17 2738541307 Variovorax sp. GV008 Isolate Unclassified
18 2738543013 Variovorax sp. BT01 Isolate Unclassified
19 2738543019 Variovorax sp. GV040 Isolate Unclassified
20 2818991446 Variovorax sp. 1180 Isolate Unclassified
21 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
22 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
23 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
24 2842677519 Variovorax sp. R-72495 Isolate Unclassified
25 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
26 2842747753 Variovorax sp. R-72060 Isolate Unclassified
27 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
28 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
29 2885198086 Variovorax sp. 679 Isolate Unclassified
30 2885211737 Variovorax sp. 553 Isolate Unclassified
31 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
32 2899924645 Variovorax sp. 369 Isolate Unclassified
33 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
34 2904456579 Variovorax sp. 2002 Isolate Unclassified
35 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
36 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
37 2928037797 Variovorax sp. 1126 Isolate Unclassified
38 2928044640 Variovorax sp. 1128 Isolate Unclassified
39 2928051484 Variovorax sp. 1133 Isolate Unclassified
40 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
41 2928070936 Variovorax gossypii 1167 Isolate Unclassified
42 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
43 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
44 2929520902 Variovorax beijingensis 502 Isolate Unclassified
45 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
46 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
47 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
48 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
49 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
50 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
51 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
52 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
53 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
54 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
55 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
56 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
60 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
61 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
62 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
63 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
64 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
65 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
66 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
67 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
68 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
69 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
70 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
71 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
75 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
76 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
78 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
79 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
80 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
81 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
82 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
87 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
90 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
139 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
140 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
150 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
151 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
152 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
158 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
209 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
215 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
220 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
221 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
222 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
223 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
224 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
225 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
226 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
227 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
228 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
229 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
230 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
231 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
255 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
256 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
257 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
258 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
259 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
260 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
261 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
262 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
263 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
264 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
265 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
266 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
267 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
268 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
269 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
270 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
271 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
272 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
273 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
274 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
275 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
276 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
277 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
278 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
279 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
280 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
281 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
282 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
283 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
284 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
285 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
286 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
287 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
288 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
289 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
290 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
291 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
292 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
293 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
294 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
295 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
296 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
297 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
298 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
299 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
300 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
301 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
302 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
303 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
304 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
305 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
306 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
307 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
308 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
309 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
310 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
311 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
312 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
313 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
316 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
317 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
318 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
319 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
320 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
321 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
322 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
323 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
324 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
325 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
326 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
327 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
328 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
329 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
330 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
331 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
332 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
333 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
334 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
335 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
336 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
337 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
338 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
339 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
343 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
344 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
345 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
346 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
347 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
350 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
351 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
352 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
353 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
354 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
355 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
356 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
357 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
358 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
359 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
360 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
361 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
364 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
365 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
374 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
375 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
376 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
377 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
378 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
379 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
380 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
381 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
382 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
383 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
384 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
385 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
386 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
387 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
388 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
389 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
392 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
393 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
402 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
403 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
404 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
405 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
406 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
407 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
408 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
409 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
410 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
411 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
412 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
414 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
415 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
416 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
417 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
418 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
419 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
420 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
421 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
422 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
423 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
424 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
425 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
426 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
427 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
428 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
429 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
430 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
431 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
432 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
433 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
434 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
435 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
436 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
437 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
438 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
439 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
440 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
441 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
442 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
443 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
444 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
445 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
446 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
447 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
448 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
449 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
450 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
451 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.25
Metatranscriptomes 0.81
Isolates 5.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.03
Nodule 1.05
Rhizoplane 3.14
Rhizosphere 61.58
Stem 0
Stem Tuber 0
Unclassified 9.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC11605_b1 2010549000 Bacteria 793
2 SwRhRL2b_contig_3060296 2162886007 Bacteria 1195
3 JGI24739J22299_10013643 3300001989 Bacteria 2963
4 JGI24739J22299_10138015 3300001989 Bacteria 723
5 JGI25152J39213_1002889 3300002773 Bacteria 6135
6 JGI25152J39213_1016851 3300002773 Bacteria 1396
7 JGI25150J39212_1006078 3300002774 Bacteria 2524
8 JGI25150J39212_1025694 3300002774 Bacteria 857
9 JGI25159J45721_1001816 3300002987 Bacteria 8556
10 JGI25159J45721_1002828 3300002987 Bacteria 6384
11 JGI25159J45721_1033993 3300002987 Bacteria 793
12 JGI25151J46595_10004995 3300003187 Bacteria 6914
13 JGI25151J46595_10017825 3300003187 Bacteria 3066
14 JGI25151J46595_10024337 3300003187 Bacteria 2479
15 JGI25153J46596_10004350 3300003215 Bacteria 7645
16 JGI25153J46596_10005841 3300003215 Bacteria 6384
17 JGI25160J50197_1012388 3300003354 Bacteria 2962
18 JGI25160J50197_1013852 3300003354 Bacteria 2728
19 JGI25161J50226_1004882 3300003374 Bacteria 2728
20 JGI25161J50226_1006067 3300003374 Bacteria 2237
21 Ga0006562J51391_1023601 3300003578 Bacteria 3080
22 Ga0006562J51391_1031095 3300003578 Bacteria 5610
23 Ga0055527_1028814 3300003760 Bacteria 553
24 Ga0055535_1000221 3300003761 Bacteria 60185
25 Ga0055542_1000129 3300003762 Bacteria 99542
26 Ga0055526_1017544 3300003771 Bacteria 2728
27 Ga0055526_1040627 3300003771 Bacteria 1170
28 Ga0055537_1000717 3300003773 Bacteria 17146
29 Ga0055537_1007164 3300003773 Bacteria 2728
30 Ga0055537_1015506 3300003773 Bacteria 1332
31 Ga0055524_1015864 3300003775 Bacteria 2728
32 Ga0055524_1016902 3300003775 Bacteria 2594
33 Ga0055536_1006575 3300003781 Bacteria 5386
34 Ga0055536_1009252 3300003781 Bacteria 4102
35 Ga0055536_1009441 3300003781 Bacteria 4034
36 Ga0055536_1010970 3300003781 Bacteria 3530
37 Ga0055536_1061959 3300003781 Bacteria 771
38 Ga0055534_1000337 3300003784 Bacteria 30592
39 Ga0055534_1000467 3300003784 Bacteria 22933
40 Ga0055534_1002468 3300003784 Bacteria 6384
41 Ga0055534_1012342 3300003784 Bacteria 1692
42 Ga0055528_1001984 3300003790 Bacteria 11532
43 Ga0055528_1015651 3300003790 Bacteria 2728
44 Ga0055528_1032456 3300003790 Bacteria 1332
45 Ga0055528_1052237 3300003790 Bacteria 818
46 Ga0055528_1089800 3300003790 Bacteria 529
47 Ga0055530_10001548 3300003791 Bacteria 16519
48 Ga0055530_10010358 3300003791 Bacteria 3455
49 Ga0055540_1003024 3300003792 Bacteria 8408
50 Ga0055540_1007603 3300003792 Bacteria 4052
51 Ga0055540_1007907 3300003792 Bacteria 3917
52 Ga0055540_1012195 3300003792 Bacteria 2716
53 Ga0055540_1040378 3300003792 Bacteria 1011
54 Ga0055540_1044687 3300003792 Bacteria 939
55 Ga0055531_10000158 3300003794 Bacteria 77918
56 Ga0055531_10002327 3300003794 Bacteria 12826
57 Ga0055531_10008168 3300003794 Bacteria 5576
58 Ga0055531_10027234 3300003794 Bacteria 2012
59 Ga0055531_10043413 3300003794 Bacteria 1272
60 Ga0055543_1002078 3300004625 Bacteria 6980
61 Ga0065165_1005994 3300005262 Bacteria 6557
62 Ga0065165_1006660 3300005262 Bacteria 5962
63 Ga0065714_10068656 3300005288 Bacteria 4601
64 Ga0065714_10084655 3300005288 Bacteria 2186
65 Ga0065704_10433009 3300005289 Bacteria 721
66 Ga0065707_10141451 3300005295 Bacteria 1767
67 Ga0070658_10159049 3300005327 Bacteria 1895
68 Ga0070658_10538782 3300005327 Bacteria 1010
69 Ga0070658_10595729 3300005327 Bacteria 958
70 Ga0070676_10591970 3300005328 Bacteria 799
71 Ga0070690_100369457 3300005330 Bacteria 1046
72 Ga0070677_10470703 3300005333 Bacteria 676
73 Ga0070677_10728494 3300005333 Bacteria 561
74 Ga0068869_101249725 3300005334 Bacteria 654
75 Ga0070666_10276076 3300005335 Bacteria 1194
76 Ga0070666_11104357 3300005335 Bacteria 590
77 Ga0068868_100309726 3300005338 Bacteria 1343
78 Ga0070660_100555832 3300005339 Bacteria 958
79 Ga0070661_100239143 3300005344 Bacteria 1398
80 Ga0070668_100434588 3300005347 Bacteria 1126
81 Ga0070668_101596082 3300005347 Bacteria 598
82 Ga0070669_100023404 3300005353 Bacteria 4423
83 Ga0070669_100122889 3300005353 Bacteria 1983
84 Ga0070674_100300173 3300005356 Bacteria 1280
85 Ga0070674_100535004 3300005356 Bacteria 981
86 Ga0070673_100747071 3300005364 Bacteria 901
87 Ga0070673_100965950 3300005364 Bacteria 792
88 Ga0070667_100062199 3300005367 Bacteria 3162
89 Ga0070667_100319899 3300005367 Bacteria 1400
90 Ga0070678_100025831 3300005456 Bacteria 3960
91 Ga0070678_100508314 3300005456 Bacteria 1064
92 Ga0070678_100766973 3300005456 Bacteria 873
93 Ga0070662_100815638 3300005457 Bacteria 794
94 Ga0070662_101731189 3300005457 Bacteria 540
95 Ga0068867_101178652 3300005459 Bacteria 703
96 Ga0068867_101277968 3300005459 Bacteria 677
97 Ga0070685_10134774 3300005466 Bacteria 1548
98 Ga0068853_100192086 3300005539 Bacteria 1855
99 Ga0070672_100554661 3300005543 Bacteria 998
100 Ga0070665_100066375 3300005548 Bacteria 3619
101 Ga0070665_100363848 3300005548 Bacteria 1453
102 Ga0068855_100447999 3300005563 Bacteria 1409
103 Ga0068855_101390765 3300005563 Bacteria 723
104 Ga0070664_100034087 3300005564 Bacteria 4270
105 Ga0068857_100301577 3300005577 Bacteria 1477
106 Ga0068857_100302096 3300005577 Bacteria 1476
107 Ga0068857_102263502 3300005577 Bacteria 534
108 Ga0068854_100116114 3300005578 Bacteria 2025
109 Ga0068854_100704906 3300005578 Bacteria 872
110 Ga0068856_100513221 3300005614 Bacteria 1220
111 Ga0068852_100105818 3300005616 Bacteria 2549
112 Ga0068852_101071830 3300005616 Bacteria 826
113 Ga0068851_10650954 3300005834 Bacteria 645
114 Ga0068858_100699827 3300005842 Bacteria 986
115 Ga0075365_10163106 3300006038 Bacteria 1554
116 Ga0075365_10524231 3300006038 Bacteria 838
117 Ga0075368_10088109 3300006042 Bacteria 1268
118 Ga0075368_10202258 3300006042 Bacteria 841
119 Ga0075363_100001894 3300006048 Bacteria 8269
120 Ga0075363_100002355 3300006048 Bacteria 7688
121 Ga0075363_100137334 3300006048 Bacteria 1375
122 Ga0075363_100241283 3300006048 Bacteria 1039
123 Ga0075364_10014749 3300006051 Bacteria 4834
124 Ga0075364_10090363 3300006051 Bacteria 2031
125 Ga0075364_10471707 3300006051 Bacteria 858
126 Ga0075364_10601099 3300006051 Bacteria 752
127 Ga0075432_10030991 3300006058 Bacteria 1851
128 Ga0070715_10927387 3300006163 Bacteria 538
129 Ga0075362_10024189 3300006177 Bacteria 2575
130 Ga0075362_10127290 3300006177 Bacteria 1209
131 Ga0075362_10204167 3300006177 Bacteria 963
132 Ga0075362_10458926 3300006177 Bacteria 648
133 Ga0075367_10066066 3300006178 Bacteria 2167
134 Ga0075369_10063213 3300006186 Bacteria 1619
135 Ga0075369_10309748 3300006186 Bacteria 738
136 Ga0075366_10010628 3300006195 Bacteria 5170
137 Ga0075366_10033205 3300006195 Bacteria 3039
138 Ga0075366_10044518 3300006195 Bacteria 2630
139 Ga0075366_10192843 3300006195 Bacteria 1238
140 Ga0097621_100497298 3300006237 Bacteria 1104
141 Ga0097621_100544574 3300006237 Bacteria 1056
142 Ga0097621_101326845 3300006237 Bacteria 680
143 Ga0075370_10000910 3300006353 Bacteria 12135
144 Ga0075370_10002650 3300006353 Bacteria 8360
145 Ga0075370_10035610 3300006353 Bacteria 2794
146 Ga0075370_10090565 3300006353 Bacteria 1764
147 Ga0075370_10337909 3300006353 Bacteria 898
148 Ga0075370_10372816 3300006353 Bacteria 854
149 Ga0075370_10666586 3300006353 Bacteria 632
150 Ga0075370_10787231 3300006353 Bacteria 580
151 Ga0068871_100819762 3300006358 Bacteria 859
152 Ga0075428_101712536 3300006844 Bacteria 656
153 Ga0075430_100152368 3300006846 Bacteria 1925
154 Ga0075429_101508145 3300006880 Bacteria 585
155 Ga0079104_1000055 3300006946 Bacteria 166522
156 Ga0099826_10001050 3300006948 Bacteria 15606
157 Ga0099826_10182867 3300006948 Bacteria 1164
158 Ga0099826_10508711 3300006948 Bacteria 561
159 Ga0105244_10003265 3300009036 Bacteria 11688
160 Ga0105244_10128001 3300009036 Bacteria 1226
161 Ga0105250_10001192 3300009092 Bacteria 14517
162 Ga0105240_10492308 3300009093 Bacteria 1365
163 Ga0105240_10659293 3300009093 Bacteria 1146
164 Ga0105245_10191294 3300009098 Bacteria 1960
165 Ga0105245_11770883 3300009098 Bacteria 670
166 Ga0105245_12027764 3300009098 Bacteria 629
167 Ga0105243_10002036 3300009148 Bacteria 17143
168 Ga0105243_10002550 3300009148 Bacteria 15218
169 Ga0105243_10002600 3300009148 Bacteria 15051
170 Ga0105243_10034165 3300009148 Bacteria 3935
171 Ga0105243_11037711 3300009148 Bacteria 825
172 Ga0105243_12718157 3300009148 Bacteria 535
173 Ga0105241_11363289 3300009174 Bacteria 678
174 Ga0105242_10006501 3300009176 Bacteria 9001
175 Ga0105237_10307105 3300009545 Bacteria 1589
176 Ga0105238_10159439 3300009551 Bacteria 2231
177 Ga0105238_10395476 3300009551 Bacteria 1375
178 Ga0105238_12073272 3300009551 Bacteria 603
179 Ga0105249_12219139 3300009553 Bacteria 622
180 Ga0105239_10283024 3300010375 Bacteria 1867
181 Ga0105239_10947390 3300010375 Bacteria 989
182 Ga0105246_10062869 3300011119 Bacteria 2587
183 Ga0105246_10168653 3300011119 Bacteria 1674
184 Ga0105246_11667610 3300011119 Bacteria 605
185 Ga0157319_1008614 3300012497 Bacteria 784
186 Ga0157347_1001331 3300012502 Bacteria 1917
187 Ga0157339_1008668 3300012505 Bacteria 882
188 Ga0157373_10106608 3300013100 Bacteria 1970
189 Ga0157371_10048625 3300013102 Bacteria 3015
190 Ga0157370_10012858 3300013104 Bacteria 8653
191 Ga0157370_10190926 3300013104 Bacteria 1901
192 Ga0157369_10008671 3300013105 Bacteria 11657
193 Ga0157369_10416856 3300013105 Bacteria 1392
194 Ga0163162_10112117 3300013306 Bacteria 2826
195 Ga0163162_10603155 3300013306 Bacteria 1224
196 Ga0163162_11655664 3300013306 Bacteria 730
197 Ga0163162_12844920 3300013306 Bacteria 557
198 Ga0157375_10059275 3300013308 Bacteria 3792
199 Ga0157375_10626110 3300013308 Bacteria 1234
200 Ga0182008_10015193 3300014497 Bacteria 4021
201 Ga0182008_10085809 3300014497 Bacteria 1550
202 Ga0182008_10186350 3300014497 Bacteria 1052
203 Ga0157379_11588319 3300014968 Bacteria 638
204 Ga0182006_1043742 3300015261 Bacteria 1750
205 Ga0182006_1134424 3300015261 Bacteria 849
206 Ga0182007_10000642 3300015262 Bacteria 20182
207 Ga0182007_10000951 3300015262 Bacteria 15906
208 Ga0182007_10045568 3300015262 Bacteria 1453
209 Ga0182005_1093030 3300015265 Bacteria 840
210 Ga0182005_1124589 3300015265 Bacteria 736
211 Ga0183362_10003 3300015683 Bacteria 977584
212 Ga0163161_10001265 3300017792 Bacteria 18886
213 Ga0163161_10016923 3300017792 Bacteria 5097
214 Ga0163161_10026103 3300017792 Bacteria 4138
215 Ga0163161_10066713 3300017792 Bacteria 2628
216 Ga0163161_10074264 3300017792 Bacteria 2493
217 Ga0163161_10760085 3300017792 Bacteria 812
218 Ga0163161_11324157 3300017792 Bacteria 627
219 Ga0209436_105358 3300025208 Bacteria 2968
220 Ga0209436_110704 3300025208 Bacteria 1657
221 Ga0209672_102876 3300025228 Bacteria 3868
222 Ga0209258_100240 3300025242 Bacteria 100990
223 Ga0207425_1001344 3300025245 Bacteria 10540
224 Ga0207425_1003603 3300025245 Bacteria 4899
225 Ga0209148_1000033 3300025254 Bacteria 555508
226 Ga0209129_1000054 3300025258 Bacteria 261997
227 Ga0209129_1003094 3300025258 Bacteria 7491
228 Ga0209129_1006468 3300025258 Bacteria 3775
229 Ga0209565_1000067 3300025263 Bacteria 171247
230 Ga0209565_1000648 3300025263 Bacteria 22443
231 Ga0209565_1002007 3300025263 Bacteria 7887
232 Ga0209673_1000097 3300025273 Bacteria 193482
233 Ga0209673_1000172 3300025273 Bacteria 133472
234 Ga0209673_1001430 3300025273 Bacteria 22800
235 Ga0209673_1021934 3300025273 Bacteria 2219
236 Ga0209673_1035424 3300025273 Bacteria 1494
237 Ga0209673_1054438 3300025273 Bacteria 1036
238 Ga0209130_1000954 3300025284 Bacteria 22871
239 Ga0209130_1001108 3300025284 Bacteria 19845
240 Ga0209130_1001362 3300025284 Bacteria 16486
241 Ga0209675_1000038 3300025291 Bacteria 250481
242 Ga0209675_1000527 3300025291 Bacteria 28098
243 Ga0209675_1000690 3300025291 Bacteria 23483
244 Ga0209675_1001272 3300025291 Bacteria 15081
245 Ga0209675_1007572 3300025291 Bacteria 4136
246 Ga0209676_1000048 3300025292 Bacteria 403716
247 Ga0209676_1000739 3300025292 Bacteria 44487
248 Ga0209676_1000836 3300025292 Bacteria 39908
249 Ga0209676_1004722 3300025292 Bacteria 7462
250 Ga0209676_1013256 3300025292 Bacteria 3181
251 Ga0209676_1026113 3300025292 Bacteria 1861
252 Ga0209676_1049862 3300025292 Bacteria 1108
253 Ga0209676_1058224 3300025292 Bacteria 976
254 Ga0209025_1000174 3300025294 Bacteria 158915
255 Ga0209025_1002139 3300025294 Bacteria 22147
256 Ga0209025_1006091 3300025294 Bacteria 9530
257 Ga0209025_1009762 3300025294 Bacteria 6626
258 Ga0209025_1039557 3300025294 Bacteria 2055
259 Ga0209564_1000241 3300025295 Bacteria 118237
260 Ga0209564_1001515 3300025295 Bacteria 23174
261 Ga0209758_1000034 3300025297 Bacteria 467637
262 Ga0209758_1008758 3300025297 Bacteria 6457
263 Ga0209758_1074214 3300025297 Bacteria 1056
264 Ga0209050_1000012 3300025298 Bacteria 813717
265 Ga0209050_1000294 3300025298 Bacteria 105705
266 Ga0209050_1002666 3300025298 Bacteria 14582
267 Ga0209050_1007315 3300025298 Bacteria 6229
268 Ga0209256_1000103 3300025299 Bacteria 193900
269 Ga0209256_1000165 3300025299 Bacteria 135104
270 Ga0209256_1075865 3300025299 Bacteria 745
271 Ga0207426_1000058 3300025302 Bacteria 363857
272 Ga0207426_1000067 3300025302 Bacteria 342108
273 Ga0207426_1140656 3300025302 Bacteria 574
274 Ga0209051_1000019 3300025303 Bacteria 511268
275 Ga0209051_1000315 3300025303 Bacteria 73579
276 Ga0209051_1001398 3300025303 Bacteria 20776
277 Ga0209051_1001450 3300025303 Bacteria 20110
278 Ga0209051_1001560 3300025303 Bacteria 18951
279 Ga0209051_1002634 3300025303 Bacteria 12590
280 Ga0209051_1015020 3300025303 Bacteria 3584
281 Ga0209051_1024147 3300025303 Bacteria 2508
282 Ga0209051_1114300 3300025303 Bacteria 697
283 Ga0209257_1000024 3300025304 Bacteria 726068
284 Ga0209257_1000057 3300025304 Bacteria 396985
285 Ga0209257_1000309 3300025304 Bacteria 104166
286 Ga0209257_1007111 3300025304 Bacteria 6900
287 Ga0209257_1009377 3300025304 Bacteria 5264
288 Ga0209257_1068617 3300025304 Bacteria 941
289 Ga0207696_1001691 3300025711 Bacteria 11466
290 Ga0207655_1000639 3300025728 Bacteria 41880
291 Ga0207682_10051721 3300025893 Bacteria 1702
292 Ga0207682_10490311 3300025893 Bacteria 582
293 Ga0207688_10506405 3300025901 Bacteria 756
294 Ga0207680_10182202 3300025903 Bacteria 1421
295 Ga0207645_10077097 3300025907 Bacteria 2136
296 Ga0207645_10605106 3300025907 Bacteria 744
297 Ga0207705_10522442 3300025909 Bacteria 922
298 Ga0207705_10604173 3300025909 Bacteria 853
299 Ga0207695_10353626 3300025913 Bacteria 1356
300 Ga0207671_10495882 3300025914 Bacteria 974
301 Ga0207657_10766528 3300025919 Bacteria 747
302 Ga0207681_10167718 3300025923 Bacteria 1661
303 Ga0207681_10321139 3300025923 Bacteria 1231
304 Ga0207694_10106627 3300025924 Bacteria 2225
305 Ga0207690_10458229 3300025932 Bacteria 1026
306 Ga0207690_10567080 3300025932 Bacteria 924
307 Ga0207706_10127382 3300025933 Bacteria 2239
308 Ga0207686_10002565 3300025934 Bacteria 9879
309 Ga0207709_10000111 3300025935 Bacteria 127580
310 Ga0207709_10000874 3300025935 Bacteria 22951
311 Ga0207709_10025717 3300025935 Bacteria 3372
312 Ga0207669_10143110 3300025937 Bacteria 1663
313 Ga0207669_10285882 3300025937 Bacteria 1246
314 Ga0207669_10490133 3300025937 Bacteria 981
315 Ga0207669_11358229 3300025937 Bacteria 604
316 Ga0207704_11455649 3300025938 Bacteria 587
317 Ga0207691_10500935 3300025940 Bacteria 1031
318 Ga0207689_10300263 3300025942 Bacteria 1331
319 Ga0207679_10053805 3300025945 Bacteria 2960
320 Ga0207667_10371498 3300025949 Bacteria 1457
321 Ga0207651_11329473 3300025960 Bacteria 646
322 Ga0207668_10601637 3300025972 Bacteria 958
323 Ga0207640_10098316 3300025981 Bacteria 2046
324 Ga0207658_10161411 3300025986 Bacteria 1837
325 Ga0207658_10320184 3300025986 Bacteria 1342
326 Ga0207677_10125692 3300026023 Bacteria 1938
327 Ga0207703_10793673 3300026035 Bacteria 904
328 Ga0207639_10007668 3300026041 Bacteria 7368
329 Ga0207639_10109792 3300026041 Bacteria 2245
330 Ga0207639_11516496 3300026041 Bacteria 629
331 Ga0207678_10541618 3300026067 Bacteria 1017
332 Ga0207678_11636254 3300026067 Bacteria 566
333 Ga0207702_10460583 3300026078 Bacteria 1235
334 Ga0207648_10203104 3300026089 Bacteria 1758
335 Ga0207648_11313797 3300026089 Bacteria 680
336 Ga0207648_11632720 3300026089 Bacteria 606
337 Ga0207674_10383653 3300026116 Bacteria 1358
338 Ga0207674_10664000 3300026116 Bacteria 1007
339 Ga0207683_10054704 3300026121 Bacteria 3499
340 Ga0207683_10516967 3300026121 Bacteria 1103
341 Ga0207683_11864906 3300026121 Bacteria 550
342 Ga0207698_10034645 3300026142 Bacteria 3683
343 Ga0207698_10807050 3300026142 Bacteria 941
344 Ga0207698_12422896 3300026142 Bacteria 536
345 Ga0209281_1000007 3300027111 Bacteria 938265
346 Ga0209973_1016250 3300027252 Bacteria 947
347 Ga0209969_1020290 3300027360 Bacteria 989
348 Ga0209995_1089223 3300027471 Bacteria 530
349 Ga0209970_1000429 3300027614 Bacteria 7139
350 Ga0209983_1020676 3300027665 Bacteria 1372
351 Ga0209983_1020895 3300027665 Bacteria 1367
352 Ga0209282_1000250 3300027666 Bacteria 26928
353 Ga0209282_1288768 3300027666 Bacteria 703
354 Ga0209971_1002246 3300027682 Bacteria 4677
355 Ga0209974_10013726 3300027876 Bacteria 2699
356 Ga0209974_10027694 3300027876 Bacteria 1875
357 Ga0207428_10247795 3300027907 Bacteria 1329
358 Ga0268266_10021518 3300028379 Bacteria 5494
359 Ga0268266_10877237 3300028379 Bacteria 867
360 Ga0307517_10260146 3300028786 Bacteria 1009
361 Ga0307515_10000472 3300028794 Bacteria 96172
362 Ga0307515_10046485 3300028794 Bacteria 6633
363 Ga0307515_10693766 3300028794 Bacteria 633
364 Ga0316177_1034408 3300030731 Bacteria 3651
365 Ga0316177_1080169 3300030731 Bacteria 684
366 Ga0314311_1027844 3300030733 Bacteria 4749
367 Ga0316179_1049987 3300030734 Bacteria 1003
368 Ga0316178_1145977 3300030735 Bacteria 2566
369 Ga0316183_1069619 3300030742 Bacteria 1978
370 Ga0316183_1109757 3300030742 Bacteria 4328
371 Ga0316181_1020350 3300030744 Bacteria 2824
372 Ga0316182_1118407 3300030745 Bacteria 2524
373 Ga0265330_10000046 3300031235 Bacteria 108853
374 Ga0265332_10000028 3300031238 Bacteria 184029
375 Ga0265332_10030174 3300031238 Bacteria 2368
376 Ga0265325_10002346 3300031241 Bacteria 12816
377 Ga0265329_10086791 3300031242 Bacteria 992
378 Ga0265331_10200757 3300031250 Bacteria 898
379 Ga0265327_10001288 3300031251 Bacteria 32919
380 Ga0307513_10167176 3300031456 Bacteria 2082
381 Ga0307513_10324239 3300031456 Bacteria 1297
382 Ga0307408_100000456 3300031548 Bacteria 35728
383 Ga0307408_100068273 3300031548 Bacteria 2617
384 Ga0307408_100128683 3300031548 Bacteria 1972
385 Ga0307408_100177894 3300031548 Bacteria 1703
386 Ga0307408_100356005 3300031548 Bacteria 1243
387 Ga0307408_100418682 3300031548 Bacteria 1154
388 Ga0307408_101693924 3300031548 Bacteria 602
389 Ga0265314_10000054 3300031711 Bacteria 184029
390 Ga0265314_10020486 3300031711 Bacteria 5105
391 Ga0265342_10203259 3300031712 Bacteria 1075
392 Ga0307405_10035253 3300031731 Bacteria 2986
393 Ga0307405_10110899 3300031731 Bacteria 1858
394 Ga0307405_10138426 3300031731 Bacteria 1693
395 Ga0307405_10226574 3300031731 Bacteria 1375
396 Ga0307413_10032421 3300031824 Bacteria 2961
397 Ga0307413_10046453 3300031824 Bacteria 2582
398 Ga0307413_10120537 3300031824 Bacteria 1776
399 Ga0307410_10365805 3300031852 Bacteria 1156
400 Ga0307410_10525078 3300031852 Bacteria 977
401 Ga0307406_10000225 3300031901 Bacteria 34443
402 Ga0307406_10003957 3300031901 Bacteria 8050
403 Ga0307406_10704579 3300031901 Bacteria 843
404 Ga0307406_11197726 3300031901 Bacteria 659
405 Ga0307406_11265560 3300031901 Bacteria 643
406 Ga0307406_11558465 3300031901 Bacteria 583
407 Ga0307407_10111725 3300031903 Bacteria 1716
408 Ga0307407_10343576 3300031903 Bacteria 1055
409 Ga0307407_10892760 3300031903 Bacteria 681
410 Ga0307412_10047673 3300031911 Bacteria 2815
411 Ga0307412_10060086 3300031911 Bacteria 2550
412 Ga0307412_10066350 3300031911 Bacteria 2446
413 Ga0307412_10316613 3300031911 Bacteria 1239
414 Ga0307412_10360466 3300031911 Bacteria 1170
415 Ga0307412_10738684 3300031911 Bacteria 848
416 Ga0307412_11014099 3300031911 Bacteria 734
417 Ga0307409_101928884 3300031995 Bacteria 620
418 Ga0307416_100030507 3300032002 Bacteria 4046
419 Ga0307416_100201880 3300032002 Bacteria 1887
420 Ga0307416_100259942 3300032002 Bacteria 1696
421 Ga0307416_101838027 3300032002 Bacteria 709
422 Ga0307414_10026501 3300032004 Bacteria 3731
423 Ga0307414_10765311 3300032004 Bacteria 878
424 Ga0307414_11421413 3300032004 Bacteria 645
425 Ga0307411_10169978 3300032005 Bacteria 1642
426 Ga0307411_10570046 3300032005 Bacteria 969
427 Ga0307411_11037101 3300032005 Bacteria 736
428 Ga0307411_11627789 3300032005 Bacteria 596
429 Ga0307411_11819561 3300032005 Bacteria 566
430 Ga0307411_11956100 3300032005 Bacteria 547
431 Ga0307411_11967929 3300032005 Bacteria 545
432 Ga0307415_102135942 3300032126 Bacteria 547
433 Ga0395899_0003383 3300037312 Bacteria 12655
434 Ga0395899_0006534 3300037312 Bacteria 9035
435 Ga0395899_0036718 3300037312 Bacteria 3675
436 Ga0395899_0232426 3300037312 Bacteria 1272
437 Ga0395899_0294665 3300037312 Bacteria 1100
438 Ga0395900_0008463 3300037418 Bacteria 10579
439 Ga0395900_0014177 3300037418 Bacteria 8139
440 Ga0395900_0086732 3300037418 Bacteria 3217
441 Ga0395900_0094241 3300037418 Bacteria 3075
442 Ga0395900_0217707 3300037418 Bacteria 1926
443 Ga0395900_0414353 3300037418 Bacteria 1309
444 Ga0395900_1761372 3300037418 Bacteria 530
445 Ga0395898_0010814 3300037466 Bacteria 9535
446 Ga0395898_0020733 3300037466 Bacteria 6673
447 Ga0395898_0023184 3300037466 Bacteria 6274
448 Ga0395905_0000088 3300037471 Bacteria 152506
449 Ga0395905_0001245 3300037471 Bacteria 31535
450 Ga0395905_0126059 3300037471 Bacteria 2407
451 Ga0395905_0156874 3300037471 Bacteria 2140
452 Ga0395905_0171382 3300037471 Bacteria 2039
453 Ga0395905_0221292 3300037471 Bacteria 1771
454 Ga0395905_0261549 3300037471 Bacteria 1615
455 Ga0395905_0484311 3300037471 Bacteria 1137
456 Ga0395905_0519340 3300037471 Bacteria 1091
457 Ga0395905_0577514 3300037471 Bacteria 1025
458 Ga0395905_0758292 3300037471 Bacteria 873
459 Ga0395905_0784777 3300037471 Bacteria 855
460 Ga0395901_0039778 3300038443 Bacteria 4867
461 Ga0395901_0117489 3300038443 Bacteria 2794
462 Ga0395901_0121401 3300038443 Bacteria 2746
463 Ga0395901_0123823 3300038443 Bacteria 2716
464 Ga0395901_0138444 3300038443 Bacteria 2558
465 Ga0395901_0452615 3300038443 Bacteria 1313
466 Ga0395901_0682993 3300038443 Bacteria 1026
467 Ga0436361_0101461 3300039447 Bacteria 19447
468 Ga0439436_0000328 3300041404 Bacteria 11648
469 Ga0439436_0004062 3300041404 Bacteria 4487
470 Ga0439438_024290 3300041405 Bacteria 1660
471 Ga0439439_0008740 3300041406 Bacteria 2397
472 Ga0439439_0174931 3300041406 Bacteria 616
473 Ga0439447_011668 3300041407 Bacteria 2553
474 Ga0439447_027912 3300041407 Bacteria 1438
475 Ga0439453_0009846 3300041408 Bacteria 1565
476 Ga0439461_0083485 3300041410 Bacteria 757
477 Ga0439461_0112290 3300041410 Bacteria 674
478 Ga0439461_0152825 3300041410 Bacteria 597
479 Ga0439466_0003860 3300041411 Bacteria 5780
480 Ga0439466_0004758 3300041411 Bacteria 5217
481 Ga0439465_0000335 3300041413 Bacteria 13395
482 Ga0439465_0021529 3300041413 Bacteria 2022
483 Ga0451787_422576 3300041441 Bacteria 664
484 Ga0451791_0144114 3300041451 Bacteria 729
485 Ga0451797_0753891 3300041453 Bacteria 518
486 Ga0451807_0354829 3300041486 Bacteria 760
487 Ga0451837_0713402 3300041494 Bacteria 944
488 Ga0451847_1003343 3300041503 Bacteria 627
489 Ga0451851_1277293 3300041507 Bacteria 550
490 Ga0451843_1126288 3300041509 Bacteria 588
491 Ga0451855_0013712 3300041511 Bacteria 705
492 Ga0451853_1371493 3300041512 Bacteria 797
493 Ga0439431_0002745 3300041997 Bacteria 3868
494 Ga0439433_0001040 3300041999 Bacteria 5623
495 Ga0439442_003077 3300042002 Bacteria 3301
496 Ga0439442_003207 3300042002 Bacteria 3237
497 Ga0439442_013480 3300042002 Bacteria 1677
498 Ga0439445_0002157 3300042004 Bacteria 4359
499 Ga0439445_0020234 3300042004 Bacteria 1664
500 Ga0439445_0052016 3300042004 Bacteria 1107
501 Ga0439432_001277 3300042006 Bacteria 9513
502 Ga0439432_007245 3300042006 Bacteria 3940
503 Ga0439449_0001202 3300042007 Bacteria 10165
504 Ga0439449_0003003 3300042007 Bacteria 6582
505 Ga0439449_0007077 3300042007 Bacteria 4272
506 Ga0439449_0041944 3300042007 Bacteria 1701
507 Ga0439452_003207 3300042010 Bacteria 5781
508 Ga0439452_023010 3300042010 Bacteria 1608
509 Ga0439454_030628 3300042011 Bacteria 842
510 Ga0439457_001739 3300042014 Bacteria 6451
511 Ga0439457_024364 3300042014 Bacteria 1339
512 Ga0439462_0001618 3300042015 Bacteria 5062
513 Ga0439462_0003446 3300042015 Bacteria 3796
514 Ga0439462_0014579 3300042015 Bacteria 2021
515 Ga0439462_0068215 3300042015 Bacteria 965
516 Ga0439463_031283 3300042016 Bacteria 1343
517 Ga0450911_001790 3300042115 Bacteria 4615
518 Ga0450912_006428 3300042116 Bacteria 931
519 Ga0450920_053079 3300042122 Bacteria 814
520 Ga0450921_007502 3300042123 Bacteria 868
521 Ga0450921_029709 3300042123 Bacteria 553
522 Ga0450923_003016 3300042125 Bacteria 2491
523 Ga0450897_016804 3300042128 Bacteria 757
524 Ga0450894_013319 3300042131 Bacteria 1079
525 Ga0450896_014494 3300042133 Bacteria 1125
526 Ga0450896_039304 3300042133 Bacteria 733
527 Ga0450898_002224 3300042134 Bacteria 2698
528 Ga0450898_027176 3300042134 Bacteria 1034
529 Ga0450906_003495 3300042145 Bacteria 3375
530 Ga0450907_008273 3300042146 Bacteria 1731
531 Ga0450910_006248 3300042147 Bacteria 1639
532 Ga0439446_0001983 3300042156 Bacteria 4836
533 Ga0439446_0032073 3300042156 Bacteria 1522
534 Ga0450908_013209 3300042184 Bacteria 1490
535 Ga0450908_053513 3300042184 Bacteria 704
536 Ga0450909_009490 3300042185 Bacteria 1421
537 Ga0450909_013238 3300042185 Bacteria 1212
538 Ga0439434_0016246 3300042435 Bacteria 2223
539 Ga0439434_0023986 3300042435 Bacteria 1838
540 Ga0439434_0032026 3300042435 Bacteria 1600
541 Ga0439434_0036215 3300042435 Bacteria 1509
542 Ga0439464_0059805 3300042439 Bacteria 1114
543 Ga0450916_071003 3300042530 Bacteria 581
544 Ga0450918_000837 3300042531 Bacteria 6485
545 Ga0451577_0000276 3300042876 Bacteria 99531
546 Ga0451577_0003205 3300042876 Bacteria 18390
547 Ga0451577_0017089 3300042876 Bacteria 6708
548 Ga0451577_1479152 3300042876 Bacteria 601
549 Ga0466969_0025202 3300044656 Bacteria 3059
550 Ga0466969_0147217 3300044656 Bacteria 1086
551 Ga0466969_0169310 3300044656 Bacteria 1002
552 Ga0466972_0209843 3300044658 Bacteria 911
553 Ga0453683_0012232 3300044673 Bacteria 5630
554 Ga0453683_0141395 3300044673 Bacteria 1519
555 Ga0453683_0802047 3300044673 Bacteria 620
556 Ga0466965_0039866 3300044683 Bacteria 2310
557 Ga0466965_0043939 3300044683 Bacteria 2207
558 Ga0466965_0075588 3300044683 Bacteria 1699
559 Ga0466966_0009243 3300044684 Bacteria 6526
560 Ga0466966_0235141 3300044684 Bacteria 1105
561 Ga0466961_0036383 3300044693 Bacteria 3160
562 Ga0466961_0056640 3300044693 Bacteria 2498
563 Ga0466961_0168159 3300044693 Bacteria 1364
564 Ga0453684_0000891 3300044712 Bacteria 99637
565 Ga0453684_0029360 3300044712 Bacteria 7809
566 Ga0453684_0328610 3300044712 Bacteria 1730
567 Ga0453684_0517621 3300044712 Bacteria 1319
568 Ga0453684_2041060 3300044712 Bacteria 576
569 Ga0466968_0043217 3300044735 Bacteria 1907
570 Ga0466968_0584257 3300044735 Bacteria 563
571 Ga0466957_0085418 3300044842 Bacteria 1971
572 Ga0466960_0014488 3300044901 Bacteria 3376
573 Ga0466960_0176268 3300044901 Bacteria 1157
574 Ga0466960_0307708 3300044901 Bacteria 894
575 Ga0466960_1024777 3300044901 Bacteria 508
576 Ga0466959_0071642 3300045049 Bacteria 2509
577 Ga0466959_0224187 3300045049 Bacteria 1303
578 Ga0451576_0002262 3300045051 Bacteria 29416
579 Ga0451576_0004706 3300045051 Bacteria 17540
580 Ga0451576_0596329 3300045051 Bacteria 1161
581 Ga0451576_0605340 3300045051 Bacteria 1152
582 Ga0466958_0419431 3300045836 Bacteria 865
583 Ga0495627_010560 3300046453 Bacteria 3350
584 Ga0495592_0428935 3300046454 Bacteria 832
585 Ga0495629_0185708 3300046459 Bacteria 1440
586 Ga0495629_0402427 3300046459 Bacteria 930
587 Ga0495651_0149023 3300046462 Bacteria 1689
588 Ga0495653_0205963 3300046463 Bacteria 1332
589 Ga0495653_0744655 3300046463 Bacteria 592
590 Ga0495639_0012096 3300046475 Bacteria 3720
591 Ga0495664_0157147 3300046477 Unclassified 1379
592 Ga0495610_0024146 3300046512 Bacteria 3286
593 Ga0495610_0195897 3300046512 Bacteria 831
594 Ga0495616_0006871 3300046513 Bacteria 6853
595 Ga0495618_0180871 3300046514 Bacteria 1340
596 Ga0495620_0064465 3300046515 Bacteria 1515
597 Ga0495620_0140238 3300046515 Bacteria 945
598 Ga0495628_0278829 3300046516 Bacteria 1242
599 Ga0495630_1344912 3300046517 Bacteria 538
600 Ga0495631_0004279 3300046518 Bacteria 7622
601 Ga0495637_0006661 3300046520 Bacteria 5783
602 Ga0495663_0024751 3300046525 Bacteria 1747
603 Ga0495663_0090132 3300046525 Bacteria 999
604 Ga0495642_0035383 3300046528 Bacteria 2015
605 Ga0495642_0118454 3300046528 Bacteria 1135
606 Ga0495652_0294786 3300046529 Bacteria 1182
607 Ga0495652_0841240 3300046529 Bacteria 609
608 Ga0495654_0043341 3300046530 Bacteria 2230
609 Ga0495586_0332902 3300046535 Bacteria 871
610 Ga0495587_0447736 3300046536 Bacteria 716
611 Ga0495609_0088811 3300046538 Bacteria 1345
612 Ga0495621_0060176 3300046539 Bacteria 1377
613 Ga0495621_0157890 3300046539 Bacteria 895
614 Ga0495645_0431969 3300046543 Bacteria 834
615 Ga0495622_0289819 3300046557 Bacteria 714
616 Ga0495633_0042415 3300046558 Bacteria 2161
617 Ga0495633_0288542 3300046558 Bacteria 746
618 Ga0495656_0000090 3300046615 Bacteria 39387
619 Ga0495656_0045688 3300046615 Bacteria 1850
620 Ga0495656_0064024 3300046615 Bacteria 1613
621 Ga0495656_0163209 3300046615 Bacteria 1084
622 Ga0495625_0001055 3300046660 Bacteria 36138
623 Ga0495625_0035184 3300046660 Bacteria 3693
624 Ga0495625_0058131 3300046660 Bacteria 2748
625 Ga0495635_0568777 3300046663 Bacteria 742
626 Ga0495661_0149149 3300046665 Bacteria 1265
627 Ga0495661_0338856 3300046665 Bacteria 743
628 Ga0495588_0065501 3300046674 Bacteria 1885
629 Ga0495588_0134042 3300046674 Bacteria 1307
630 Ga0495657_0357776 3300046675 Bacteria 863
631 Ga0495669_0092764 3300046684 Bacteria 1396
632 Ga0495669_0451213 3300046684 Bacteria 624
633 Ga0495613_0516400 3300046689 Bacteria 803
634 Ga0495624_0125401 3300046690 Unclassified 1576
635 Ga0495624_0459963 3300046690 Bacteria 762
636 Ga0495670_0156653 3300046691 Bacteria 1195
637 Ga0495670_0370342 3300046691 Bacteria 772
638 Ga0495671_0033400 3300046692 Bacteria 2621
639 Ga0495600_0673660 3300046809 Bacteria 624
640 Ga0495636_0035291 3300047318 Bacteria 2060
641 Ga0495674_0149356 3300047319 Bacteria 1960
642 Ga0495676_0077660 3300047321 Bacteria 2531
643 Ga0495676_0339912 3300047321 Bacteria 1005
644 Ga0495676_0661797 3300047321 Bacteria 677
645 Ga0495676_0754657 3300047321 Bacteria 628
646 Ga0495680_0649593 3300047322 Bacteria 701
647 Ga0495677_0185109 3300047445 Bacteria 808
648 Ga0495685_020122 3300047447 Bacteria 2293
649 Ga0495684_0211415 3300047471 Bacteria 1426
650 Ga0495686_0252038 3300047472 Bacteria 992
651 Ga0495686_0289959 3300047472 Bacteria 907
652 Ga0495602_0268765 3300048088 Bacteria 1261
653 Ga0495602_0391660 3300048088 Bacteria 993
654 Ga0495614_0029162 3300048089 Bacteria 2375
655 Ga0495614_0031400 3300048089 Bacteria 2286
656 Ga0495615_0036591 3300048090 Bacteria 1205
657 Ga0495615_0164403 3300048090 Bacteria 668
658 Ga0496100_0523034 3300048903 Bacteria 916
659 Ga0496100_0758544 3300048903 Bacteria 759
660 Ga0496100_0824716 3300048903 Bacteria 727
661 Ga0496100_1092987 3300048903 Bacteria 628
662 Ga0496101_0051772 3300048904 Bacteria 2959
663 Ga0496102_0004957 3300048905 Bacteria 11277
664 Ga0496102_0160011 3300048905 Bacteria 2118
665 Ga0496102_0168147 3300048905 Bacteria 2064
666 Ga0496103_0103764 3300048906 Bacteria 1801
667 Ga0496104_0008675 3300048907 Bacteria 9040
668 Ga0496105_0010700 3300048908 Bacteria 7220
669 Ga0496106_0008933 3300048909 Bacteria 7407
670 Ga0496108_0090817 3300048911 Bacteria 2596
671 Ga0496109_0250036 3300048912 Bacteria 1669
672 Ga0496110_0334323 3300048913 Bacteria 1380
673 Ga0496110_0450067 3300048913 Bacteria 1173
674 Ga0496110_0681768 3300048913 Bacteria 928
675 Ga0496111_0623212 3300048914 Bacteria 788
676 Ga0496112_0247614 3300048915 Bacteria 1734
677 Ga0496113_0209231 3300048916 Bacteria 1552
678 Ga0496116_0026461 3300048919 Bacteria 4242
679 Ga0496117_0048605 3300048920 Bacteria 3027
680 Ga0496117_0099448 3300048920 Bacteria 1845
681 Ga0496118_0038816 3300048921 Bacteria 3810
682 Ga0496118_0100657 3300048921 Bacteria 1954
683 Ga0496119_0179091 3300048922 Bacteria 1113
684 Ga0496119_0205620 3300048922 Bacteria 1016
685 Ga0496121_0010814 3300048924 Bacteria 10220
686 Ga0496121_0057522 3300048924 Bacteria 3222
687 Ga0496121_0325745 3300048924 Bacteria 1032
688 Ga0496122_0003683 3300048925 Bacteria 19870
689 Ga0496122_0026344 3300048925 Bacteria 5015
690 Ga0496122_0062562 3300048925 Bacteria 2724
691 Ga0496122_0096773 3300048925 Bacteria 1989
692 Ga0496123_0000274 3300048926 Bacteria 101783
693 Ga0496123_0045998 3300048926 Bacteria 2965
694 Ga0496123_0064937 3300048926 Bacteria 2323
695 Ga0496123_0066798 3300048926 Bacteria 2276
696 Ga0496123_0319517 3300048926 Bacteria 733
697 Ga0496124_0037636 3300048927 Bacteria 4206
698 Ga0496124_0073316 3300048927 Bacteria 2833
699 Ga0496124_0122698 3300048927 Bacteria 2074
700 Ga0496124_0165467 3300048927 Bacteria 1719
701 Ga0496124_0181661 3300048927 Bacteria 1618
702 Ga0496124_0363754 3300048927 Bacteria 1018
703 Ga0496124_0602261 3300048927 Bacteria 714
704 Ga0496125_0006965 3300048928 Bacteria 12106
705 Ga0496125_0026721 3300048928 Bacteria 5247
706 Ga0496125_0030178 3300048928 Bacteria 4854
707 Ga0496125_0090108 3300048928 Bacteria 2303
708 Ga0496125_0090995 3300048928 Bacteria 2287
709 Ga0496125_0154906 3300048928 Bacteria 1567
710 Ga0496125_0334759 3300048928 Bacteria 911
711 Ga0496126_0076988 3300048929 Bacteria 2958
712 Ga0496126_0372416 3300048929 Bacteria 1164
713 Ga0496126_0469191 3300048929 Bacteria 1010
714 Ga0496126_0571419 3300048929 Bacteria 894
715 Ga0496126_0753893 3300048929 Bacteria 751
716 Ga0501306_050789 3300049127 Bacteria 664
717 Ga0501310_039787 3300049130 Bacteria 651
718 Ga0501292_134997 3300049515 Bacteria 512
719 Ga0501303_026821 3300049526 Bacteria 649
720 Ga0501034_0098321 3300049571 Bacteria 2922
721 Ga0501036_0070727 3300049572 Bacteria 2951
722 Ga0501036_0484402 3300049572 Bacteria 1030
723 Ga0501038_0153558 3300049574 Bacteria 1876
724 Ga0501039_0117354 3300049575 Bacteria 2084
725 Ga0501043_0032689 3300049579 Bacteria 4091
726 Ga0501043_0183849 3300049579 Bacteria 1628
727 Ga0501046_0603846 3300049580 Bacteria 778
728 Ga0501047_0043447 3300049581 Bacteria 4342
729 Ga0501047_0076351 3300049581 Bacteria 3224
730 Ga0501047_0166057 3300049581 Bacteria 2078
731 Ga0501073_0200747 3300049589 Bacteria 1379
732 Ga0501073_0920579 3300049589 Bacteria 602
733 Ga0501206_037287 3300049653 Bacteria 740
734 Ga0501249_093532 3300049679 Bacteria 715
735 Ga0501252_045450 3300049682 Bacteria 649
736 Ga0501221_080328 3300049704 Bacteria 784
737 Ga0501225_0077783 3300049705 Bacteria 950
738 Ga0501234_084814 3300049707 Bacteria 562
739 Ga0501080_0052740 3300049742 Bacteria 3785
740 Ga0501083_0963603 3300049744 Bacteria 555
741 Ga0501241_020331 3300049758 Bacteria 1221
742 Ga0501241_111436 3300049758 Bacteria 599
743 Ga0501262_001111 3300049759 Bacteria 3056
744 Ga0501263_046701 3300049760 Bacteria 649
745 Ga0501263_080653 3300049760 Bacteria 537
746 Ga0501035_0598727 3300049822 Bacteria 898
747 Ga0501044_0073507 3300049823 Bacteria 3475
748 Ga0501044_0455396 3300049823 Bacteria 1185
749 nmdc:mga03683_10715_c1 3300050489 Bacteria 3294
750 nmdc:mga03683_28534_c1 3300050489 Bacteria 2220
751 nmdc:mga03683_47346_c1 3300050489 Bacteria 1784
752 nmdc:mga03683_50064_c1 3300050489 Bacteria 1741
753 nmdc:mga03n38_119223_c1 3300050490 Bacteria 1295
754 nmdc:mga03n38_1785_c1 3300050490 Bacteria 6376
755 nmdc:mga03n38_9395_c1 3300050490 Bacteria 3557
756 nmdc:mga00v17_128409_c1 3300050491 Bacteria 1619
757 nmdc:mga00v17_50354_c1 3300050491 Bacteria 2530
758 nmdc:mga0yw44_27946_c1 3300050492 Bacteria 3239
759 nmdc:mga0yw44_392178_c1 3300050492 Bacteria 938
760 nmdc:mga0k408_11950_c1 3300050493 Bacteria 4737
761 nmdc:mga0k408_313196_c1 3300050493 Bacteria 937
762 nmdc:mga0k408_61906_c1 3300050493 Bacteria 2175
763 nmdc:mga0k408_6410_c1 3300050493 Bacteria 6277
764 nmdc:mga06z11_123205_c1 3300050494 Bacteria 1448
765 nmdc:mga06z11_391076_c1 3300050494 Bacteria 836
766 nmdc:mga07m45_135590_c1 3300050496 Bacteria 1425
767 nmdc:mga07m45_22136_c1 3300050496 Bacteria 3469
768 nmdc:mga07m45_320007_c1 3300050496 Unclassified 902
769 nmdc:mga07m45_32397_c1 3300050496 Bacteria 2899
770 nmdc:mga07m45_3705_c1 3300050496 Bacteria 7393
771 nmdc:mga07m45_51559_c1 3300050496 Bacteria 2321
772 nmdc:mga07m45_67562_c1 3300050496 Bacteria 2031
773 nmdc:mga06r32_853514_c1 3300050510 Bacteria 869
774 nmdc:mga0sz30_64676_c1 3300050516 Bacteria 1567
775 Ga0500610_0000435 3300053079 Bacteria 12885
776 Ga0500643_006042 3300053087 Bacteria 5118
777 Ga0500644_0107994 3300053088 Bacteria 1068
778 Ga0500651_0000400 3300053093 Bacteria 23590
779 Ga0500566_0527390 3300053094 Bacteria 504
780 Ga0500560_011563 3300053107 Bacteria 2257
781 Ga0500562_014764 3300053108 Bacteria 2001
782 Ga0500569_095370 3300053109 Bacteria 969
783 Ga0500571_000129 3300053110 Bacteria 25327
784 Ga0500592_004711 3300053116 Bacteria 2169
785 Ga0500593_002479 3300053117 Bacteria 6777
786 Ga0500594_0024273 3300053118 Bacteria 1543
787 Ga0500597_069253 3300053120 Bacteria 1524
788 Ga0500607_011657 3300053121 Bacteria 5191
789 Ga0500608_019812 3300053122 Bacteria 3089
790 Ga0500608_088279 3300053122 Bacteria 1453
791 Ga0500626_031523 3300053128 Bacteria 2395
792 Ga0500655_000665 3300053133 Bacteria 6824
793 Ga0500658_0002393 3300053134 Bacteria 7265
794 Ga0500658_0003299 3300053134 Bacteria 6124
795 Ga0500559_0026484 3300053136 Bacteria 2470
796 Ga0500564_014576 3300053138 Bacteria 3537
797 Ga0500568_0000554 3300053139 Bacteria 27551
798 Ga0500616_0023705 3300053153 Bacteria 3417
799 Ga0500616_0099064 3300053153 Bacteria 1428
800 Ga0500624_024925 3300053157 Bacteria 991
801 Ga0500627_0060057 3300053158 Bacteria 1671
802 Ga0500633_0122162 3300053160 Bacteria 969
803 Ga0500634_0203894 3300053161 Bacteria 865
804 Ga0500638_028219 3300053162 Bacteria 2696
805 Ga0500565_001007 3300053734 Bacteria 1758
806 Ga0587083_0126568 3300059505 Bacteria 666
807 Ga0587079_092884 3300059647 Bacteria 709
808 Ga0587111_0125472 3300060346 Bacteria 666

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046663 Ga0495635_0568777 Ga0495635_0568777_436_726 94
2 3300050496 nmdc:mga07m45_320007_c1 nmdc:mga07m45_320007_c1_185_499 102
3 iso_pu_bacteria 2842747753 2842748870 102
4 iso_pu_bacteria 2904479285 2904481651 102
5 iso_pu_bacteria 8056667051 8056670980 102
6 3300027360 Ga0209969_1020290 Ga0209969_10202902 103
7 3300037312 Ga0395899_0036718 Ga0395899_0036718_3124_3435 103
8 iso_pu_bacteria 2643221570 2643867769 103
9 iso_pu_bacteria 2643221596 2643991632 103
10 iso_pu_bacteria 2643221652 2644293378 103
11 iso_pu_bacteria 2721755523 2722881986 103
12 iso_pu_bacteria 2839138175 2839141879 103
13 iso_pu_bacteria 2842718218 2842718722 103
14 iso_pu_bacteria 2928115317 2928120658 103
15 iso_pu_bacteria 2974320154 2974320397 103
16 iso_pu_bacteria 2990710928 2990713921 103
17 3300037418 Ga0395900_0086732 Ga0395900_0086732_1816_2133 104
18 3300042876 Ga0451577_0003205 Ga0451577_0003205_1166_1480 104
19 3300046462 Ga0495651_0149023 Ga0495651_0149023_1294_1617 104
20 3300046463 Ga0495653_0205963 Ga0495653_0205963_368_691 104
21 3300046477 Ga0495664_0157147 Ga0495664_0157147_413_736 104
22 3300046516 Ga0495628_0278829 Ga0495628_0278829_189_512 104
23 3300046529 Ga0495652_0841240 Ga0495652_0841240_86_409 104
24 3300046690 Ga0495624_0125401 Ga0495624_0125401_247_570 104
25 3300047319 Ga0495674_0149356 Ga0495674_0149356_505_828 104
26 3300047321 Ga0495676_0339912 Ga0495676_0339912_15_338 104
27 3300047471 Ga0495684_0211415 Ga0495684_0211415_1007_1330 104
28 3300048088 Ga0495602_0391660 Ga0495602_0391660_624_947 104
29 3300049575 Ga0501039_0117354 Ga0501039_0117354_1479_1823 104
30 iso_pu_bacteria 2513020051 2513229178 104
31 iso_pu_bacteria 2599185214 2599623399 104
32 iso_pu_bacteria 2599185226 2599675383 104
33 iso_pu_bacteria 2599185227 2599681004 104
34 iso_pu_bacteria 2599185229 2599693019 104
35 iso_pu_bacteria 2643221628 2644161843 104
36 iso_pu_bacteria 2643221658 2644325560 104
37 iso_pu_bacteria 2643221672 2644399279 104
38 iso_pu_bacteria 2643221683 2644467031 104
39 iso_pu_bacteria 2738541277 2738718195 104
40 iso_pu_bacteria 2738541307 2738880419 104
41 iso_pu_bacteria 2738543013 2739248278 104
42 iso_pu_bacteria 2738543019 2739281382 104
43 iso_pu_bacteria 2818991446 2819600575 104
44 iso_pu_bacteria 2831265667 2831267699 104
45 iso_pu_bacteria 2838054893 2838061095 104
46 iso_pu_bacteria 2842677519 2842679824 104
47 iso_pu_bacteria 2881101125 2881103134 104
48 iso_pu_bacteria 2885192300 2885196935 104
49 iso_pu_bacteria 2885198086 2885198831 104
50 iso_pu_bacteria 2885211737 2885211789 104
51 iso_pu_bacteria 2894023352 2894024335 104
52 iso_pu_bacteria 2899924645 2899928278 104
53 iso_pu_bacteria 2904449895 2904452446 104
54 iso_pu_bacteria 2904456579 2904460955 104
55 iso_pu_bacteria 2919462493 2919463922 104
56 iso_pu_bacteria 2928037797 2928041230 104
57 iso_pu_bacteria 2928044640 2928048072 104
58 iso_pu_bacteria 2928051484 2928055913 104
59 iso_pu_bacteria 2928064002 2928066606 104
60 iso_pu_bacteria 2928070936 2928077240 104
61 iso_pu_bacteria 2928084124 2928087541 104
62 iso_pu_bacteria 2929520902 2929522938 104
63 iso_pu_bacteria 2939631187 2939636212 104
64 iso_pu_bacteria 2945909444 2945910085 104
65 iso_pu_bacteria 2945945610 2945946058 104
66 iso_pu_bacteria 2945972063 2945975657 104
67 iso_pu_bacteria 2945984333 2945987899 104
68 iso_pu_bacteria 2954767861 2954768900 104
69 3300005327 Ga0070658_10595729 Ga0070658_105957292 105
70 3300006353 Ga0075370_10000910 Ga0075370_100009108 105
71 3300009098 Ga0105245_11770883 Ga0105245_117708831 105
72 3300026142 Ga0207698_10807050 Ga0207698_108070502 105
73 3300031235 Ga0265330_10000046 Ga0265330_100000468 105
74 3300031238 Ga0265332_10000028 Ga0265332_10000028104 105
75 3300031241 Ga0265325_10002346 Ga0265325_100023467 105
76 3300031711 Ga0265314_10000054 Ga0265314_10000054104 105
77 3300041494 Ga0451837_0713402 Ga0451837_0713402_228_545 105
78 3300044712 Ga0453684_0517621 Ga0453684_0517621_565_882 105
79 3300050496 nmdc:mga07m45_3705_c1 nmdc:mga07m45_3705_c1_858_1175 105
80 3300005353 Ga0070669_100023404 Ga0070669_1000234045 106
81 3300006038 Ga0075365_10524231 Ga0075365_105242312 106
82 3300013104 Ga0157370_10190926 Ga0157370_101909263 106
83 3300017792 Ga0163161_10760085 Ga0163161_107600851 106
84 3300025923 Ga0207681_10167718 Ga0207681_101677181 106
85 3300032005 Ga0307411_11627789 Ga0307411_116277892 106
86 3300032126 Ga0307415_102135942 Ga0307415_1021359421 106
87 3300042015 Ga0439462_0003446 Ga0439462_0003446_1542_1862 106
88 3300045051 Ga0451576_0596329 Ga0451576_0596329_515_835 106
89 3300046665 Ga0495661_0338856 Ga0495661_0338856_169_489 106
90 3300048925 Ga0496122_0003683 Ga0496122_0003683_10166_10489 106
91 3300048926 Ga0496123_0000274 Ga0496123_0000274_5210_5533 106
92 3300048927 Ga0496124_0165467 Ga0496124_0165467_1186_1509 106
93 3300048927 Ga0496124_0363754 Ga0496124_0363754_639_962 106
94 3300048929 Ga0496126_0469191 Ga0496126_0469191_149_472 106
95 3300048929 Ga0496126_0753893 Ga0496126_0753893_284_607 106
96 3300049758 Ga0501241_020331 Ga0501241_020331_36_359 106
97 2162886007 SwRhRL2b_contig_3060296 SwRhRL2b_0634.00000280 107
98 3300005327 Ga0070658_10538782 Ga0070658_105387822 107
99 3300005330 Ga0070690_100369457 Ga0070690_1003694572 107
100 3300005333 Ga0070677_10728494 Ga0070677_107284941 107
101 3300005539 Ga0068853_100192086 Ga0068853_1001920862 107
102 3300005563 Ga0068855_100447999 Ga0068855_1004479992 107
103 3300006051 Ga0075364_10014749 Ga0075364_100147495 107
104 3300006353 Ga0075370_10787231 Ga0075370_107872312 107
105 3300006946 Ga0079104_1000055 Ga0079104_100005542 107
106 3300009092 Ga0105250_10001192 Ga0105250_100011924 107
107 3300009098 Ga0105245_10191294 Ga0105245_101912943 107
108 3300009098 Ga0105245_12027764 Ga0105245_120277642 107
109 3300009148 Ga0105243_10002600 Ga0105243_1000260012 107
110 3300009176 Ga0105242_10006501 Ga0105242_100065011 107
111 3300015262 Ga0182007_10045568 Ga0182007_100455682 107
112 3300025711 Ga0207696_1001691 Ga0207696_100169110 107
113 3300025893 Ga0207682_10490311 Ga0207682_104903111 107
114 3300025909 Ga0207705_10522442 Ga0207705_105224422 107
115 3300025934 Ga0207686_10002565 Ga0207686_100025657 107
116 3300025935 Ga0207709_10000111 Ga0207709_1000011191 107
117 3300026041 Ga0207639_10109792 Ga0207639_101097923 107
118 3300026041 Ga0207639_11516496 Ga0207639_115164961 107
119 3300026142 Ga0207698_12422896 Ga0207698_124228962 107
120 3300027111 Ga0209281_1000007 Ga0209281_1000007787 107
121 3300027252 Ga0209973_1016250 Ga0209973_10162502 107
122 3300027614 Ga0209970_1000429 Ga0209970_10004292 107
123 3300027665 Ga0209983_1020676 Ga0209983_10206762 107
124 3300027665 Ga0209983_1020895 Ga0209983_10208952 107
125 3300027682 Ga0209971_1002246 Ga0209971_10022464 107
126 3300027876 Ga0209974_10013726 Ga0209974_100137263 107
127 3300027876 Ga0209974_10027694 Ga0209974_100276942 107
128 3300028794 Ga0307515_10046485 Ga0307515_100464853 107
129 3300031238 Ga0265332_10030174 Ga0265332_100301743 107
130 3300031242 Ga0265329_10086791 Ga0265329_100867912 107
131 3300031250 Ga0265331_10200757 Ga0265331_102007572 107
132 3300031456 Ga0307513_10167176 Ga0307513_101671762 107
133 3300031548 Ga0307408_100000456 Ga0307408_10000045635 107
134 3300031711 Ga0265314_10020486 Ga0265314_100204863 107
135 3300031712 Ga0265342_10203259 Ga0265342_102032592 107
136 3300031901 Ga0307406_10000225 Ga0307406_1000022534 107
137 3300032004 Ga0307414_11421413 Ga0307414_114214132 107
138 3300037312 Ga0395899_0006534 Ga0395899_0006534_2077_2436 107
139 3300037312 Ga0395899_0232426 Ga0395899_0232426_132_455 107
140 3300037418 Ga0395900_0008463 Ga0395900_0008463_1418_1741 107
141 3300037418 Ga0395900_0094241 Ga0395900_0094241_1746_2105 107
142 3300037418 Ga0395900_0414353 Ga0395900_0414353_58_381 107
143 3300037418 Ga0395900_1761372 Ga0395900_1761372_177_500 107
144 3300037466 Ga0395898_0020733 Ga0395898_0020733_165_488 107
145 3300037466 Ga0395898_0023184 Ga0395898_0023184_4171_4530 107
146 3300037471 Ga0395905_0000088 Ga0395905_0000088_32893_33216 107
147 3300037471 Ga0395905_0001245 Ga0395905_0001245_17214_17537 107
148 3300037471 Ga0395905_0156874 Ga0395905_0156874_269_592 107
149 3300037471 Ga0395905_0171382 Ga0395905_0171382_94_417 107
150 3300037471 Ga0395905_0261549 Ga0395905_0261549_1144_1503 107
151 3300037471 Ga0395905_0519340 Ga0395905_0519340_411_734 107
152 3300037471 Ga0395905_0577514 Ga0395905_0577514_372_695 107
153 3300037471 Ga0395905_0784777 Ga0395905_0784777_517_840 107
154 3300038443 Ga0395901_0121401 Ga0395901_0121401_820_1143 107
155 3300038443 Ga0395901_0123823 Ga0395901_0123823_612_971 107
156 3300038443 Ga0395901_0138444 Ga0395901_0138444_1262_1585 107
157 3300038443 Ga0395901_0682993 Ga0395901_0682993_266_589 107
158 3300041507 Ga0451851_1277293 Ga0451851_1277293_33_356 107
159 3300041509 Ga0451843_1126288 Ga0451843_1126288_126_449 107
160 3300041511 Ga0451855_0013712 Ga0451855_0013712_235_558 107
161 3300042876 Ga0451577_0017089 Ga0451577_0017089_1043_1366 107
162 3300044656 Ga0466969_0025202 Ga0466969_0025202_1350_1673 107
163 3300044656 Ga0466969_0147217 Ga0466969_0147217_60_383 107
164 3300044656 Ga0466969_0169310 Ga0466969_0169310_73_396 107
165 3300044658 Ga0466972_0209843 Ga0466972_0209843_36_359 107
166 3300044673 Ga0453683_0141395 Ga0453683_0141395_1154_1477 107
167 3300044673 Ga0453683_0802047 Ga0453683_0802047_199_522 107
168 3300044683 Ga0466965_0039866 Ga0466965_0039866_705_1028 107
169 3300044684 Ga0466966_0009243 Ga0466966_0009243_1620_1943 107
170 3300044684 Ga0466966_0235141 Ga0466966_0235141_18_341 107
171 3300044693 Ga0466961_0036383 Ga0466961_0036383_1130_1453 107
172 3300044693 Ga0466961_0056640 Ga0466961_0056640_1134_1457 107
173 3300044712 Ga0453684_0029360 Ga0453684_0029360_6035_6358 107
174 3300044712 Ga0453684_0328610 Ga0453684_0328610_429_752 107
175 3300044712 Ga0453684_2041060 Ga0453684_2041060_203_526 107
176 3300044735 Ga0466968_0043217 Ga0466968_0043217_1201_1524 107
177 3300044735 Ga0466968_0584257 Ga0466968_0584257_155_478 107
178 3300044842 Ga0466957_0085418 Ga0466957_0085418_856_1179 107
179 3300044901 Ga0466960_0307708 Ga0466960_0307708_158_481 107
180 3300045049 Ga0466959_0071642 Ga0466959_0071642_909_1232 107
181 3300045049 Ga0466959_0224187 Ga0466959_0224187_777_1100 107
182 3300045051 Ga0451576_0002262 Ga0451576_0002262_4464_4787 107
183 3300045836 Ga0466958_0419431 Ga0466958_0419431_473_796 107
184 3300048905 Ga0496102_0168147 Ga0496102_0168147_749_1072 107
185 3300048913 Ga0496110_0334323 Ga0496110_0334323_283_606 107
186 3300048922 Ga0496119_0179091 Ga0496119_0179091_155_478 107
187 3300048925 Ga0496122_0026344 Ga0496122_0026344_2307_2663 107
188 3300048926 Ga0496123_0064937 Ga0496123_0064937_1185_1541 107
189 3300048926 Ga0496123_0066798 Ga0496123_0066798_1379_1702 107
190 3300048927 Ga0496124_0122698 Ga0496124_0122698_1061_1417 107
191 3300048928 Ga0496125_0006965 Ga0496125_0006965_2159_2515 107
192 3300048929 Ga0496126_0076988 Ga0496126_0076988_1367_1723 107
193 3300049571 Ga0501034_0098321 Ga0501034_0098321_2003_2326 107
194 3300049572 Ga0501036_0070727 Ga0501036_0070727_2227_2550 107
195 3300049574 Ga0501038_0153558 Ga0501038_0153558_353_676 107
196 3300049579 Ga0501043_0032689 Ga0501043_0032689_140_463 107
197 3300049579 Ga0501043_0183849 Ga0501043_0183849_245_568 107
198 3300049580 Ga0501046_0603846 Ga0501046_0603846_444_767 107
199 3300049581 Ga0501047_0076351 Ga0501047_0076351_1880_2203 107
200 3300049581 Ga0501047_0166057 Ga0501047_0166057_998_1321 107
201 3300049589 Ga0501073_0200747 Ga0501073_0200747_1041_1364 107
202 3300049589 Ga0501073_0920579 Ga0501073_0920579_73_396 107
203 3300049742 Ga0501080_0052740 Ga0501080_0052740_400_723 107
204 3300049744 Ga0501083_0963603 Ga0501083_0963603_70_393 107
205 3300049822 Ga0501035_0598727 Ga0501035_0598727_273_596 107
206 3300049823 Ga0501044_0073507 Ga0501044_0073507_1342_1665 107
207 3300049823 Ga0501044_0455396 Ga0501044_0455396_784_1107 107
208 3300050491 nmdc:mga00v17_50354_c1 nmdc:mga00v17_50354_c1_1622_1945 107
209 3300050493 nmdc:mga0k408_61906_c1 nmdc:mga0k408_61906_c1_1121_1444 107
210 3300053108 Ga0500562_014764 Ga0500562_014764_1218_1541 107
211 3300053153 Ga0500616_0023705 Ga0500616_0023705_1889_2212 107
212 3300059505 Ga0587083_0126568 Ga0587083_0126568_213_536 107
213 3300059647 Ga0587079_092884 Ga0587079_092884_100_423 107
214 2010549000 RicEn_FSXC11605_b1 RicEn_242400 108
215 3300001989 JGI24739J22299_10013643 JGI24739J22299_100136432 108
216 3300001989 JGI24739J22299_10138015 JGI24739J22299_101380152 108
217 3300002773 JGI25152J39213_1002889 JGI25152J39213_10028893 108
218 3300002773 JGI25152J39213_1016851 JGI25152J39213_10168513 108
219 3300002774 JGI25150J39212_1006078 JGI25150J39212_10060782 108
220 3300002774 JGI25150J39212_1025694 JGI25150J39212_10256942 108
221 3300002987 JGI25159J45721_1001816 JGI25159J45721_10018165 108
222 3300002987 JGI25159J45721_1002828 JGI25159J45721_10028284 108
223 3300002987 JGI25159J45721_1033993 JGI25159J45721_10339931 108
224 3300003187 JGI25151J46595_10004995 JGI25151J46595_100049953 108
225 3300003187 JGI25151J46595_10017825 JGI25151J46595_100178254 108
226 3300003187 JGI25151J46595_10024337 JGI25151J46595_100243373 108
227 3300003215 JGI25153J46596_10004350 JGI25153J46596_100043505 108
228 3300003215 JGI25153J46596_10005841 JGI25153J46596_100058415 108
229 3300003354 JGI25160J50197_1012388 JGI25160J50197_10123884 108
230 3300003354 JGI25160J50197_1013852 JGI25160J50197_10138524 108
231 3300003374 JGI25161J50226_1004882 JGI25161J50226_10048824 108
232 3300003374 JGI25161J50226_1006067 JGI25161J50226_10060672 108
233 3300003578 Ga0006562J51391_1023601 Ga0006562J51391_10236012 108
234 3300003578 Ga0006562J51391_1031095 Ga0006562J51391_10310957 108
235 3300003760 Ga0055527_1028814 Ga0055527_10288142 108
236 3300003761 Ga0055535_1000221 Ga0055535_100022155 108
237 3300003762 Ga0055542_1000129 Ga0055542_10001293 108
238 3300003771 Ga0055526_1017544 Ga0055526_10175444 108
239 3300003771 Ga0055526_1040627 Ga0055526_10406272 108
240 3300003773 Ga0055537_1000717 Ga0055537_10007175 108
241 3300003773 Ga0055537_1007164 Ga0055537_10071644 108
242 3300003773 Ga0055537_1015506 Ga0055537_10155062 108
243 3300003775 Ga0055524_1015864 Ga0055524_10158644 108
244 3300003775 Ga0055524_1016902 Ga0055524_10169023 108
245 3300003781 Ga0055536_1006575 Ga0055536_10065754 108
246 3300003781 Ga0055536_1009252 Ga0055536_10092525 108
247 3300003781 Ga0055536_1009441 Ga0055536_10094413 108
248 3300003781 Ga0055536_1010970 Ga0055536_10109705 108
249 3300003781 Ga0055536_1061959 Ga0055536_10619592 108
250 3300003784 Ga0055534_1000337 Ga0055534_100033724 108
251 3300003784 Ga0055534_1000467 Ga0055534_100046711 108
252 3300003784 Ga0055534_1002468 Ga0055534_10024684 108
253 3300003784 Ga0055534_1012342 Ga0055534_10123422 108
254 3300003790 Ga0055528_1001984 Ga0055528_10019842 108
255 3300003790 Ga0055528_1015651 Ga0055528_10156514 108
256 3300003790 Ga0055528_1032456 Ga0055528_10324562 108
257 3300003790 Ga0055528_1052237 Ga0055528_10522371 108
258 3300003790 Ga0055528_1089800 Ga0055528_10898001 108
259 3300003791 Ga0055530_10001548 Ga0055530_100015485 108
260 3300003791 Ga0055530_10010358 Ga0055530_100103581 108
261 3300003792 Ga0055540_1003024 Ga0055540_10030245 108
262 3300003792 Ga0055540_1007603 Ga0055540_10076034 108
263 3300003792 Ga0055540_1007907 Ga0055540_10079075 108
264 3300003792 Ga0055540_1012195 Ga0055540_10121953 108
265 3300003792 Ga0055540_1040378 Ga0055540_10403782 108
266 3300003792 Ga0055540_1044687 Ga0055540_10446872 108
267 3300003794 Ga0055531_10000158 Ga0055531_1000015877 108
268 3300003794 Ga0055531_10002327 Ga0055531_1000232710 108
269 3300003794 Ga0055531_10008168 Ga0055531_100081687 108
270 3300003794 Ga0055531_10027234 Ga0055531_100272343 108
271 3300003794 Ga0055531_10043413 Ga0055531_100434132 108
272 3300004625 Ga0055543_1002078 Ga0055543_10020784 108
273 3300005262 Ga0065165_1005994 Ga0065165_10059945 108
274 3300005262 Ga0065165_1006660 Ga0065165_10066605 108
275 3300005288 Ga0065714_10068656 Ga0065714_100686563 108
276 3300005288 Ga0065714_10084655 Ga0065714_100846553 108
277 3300005289 Ga0065704_10433009 Ga0065704_104330092 108
278 3300005295 Ga0065707_10141451 Ga0065707_101414512 108
279 3300005327 Ga0070658_10159049 Ga0070658_101590492 108
280 3300005328 Ga0070676_10591970 Ga0070676_105919701 108
281 3300005333 Ga0070677_10470703 Ga0070677_104707032 108
282 3300005334 Ga0068869_101249725 Ga0068869_1012497252 108
283 3300005335 Ga0070666_10276076 Ga0070666_102760762 108
284 3300005335 Ga0070666_11104357 Ga0070666_111043571 108
285 3300005338 Ga0068868_100309726 Ga0068868_1003097262 108
286 3300005339 Ga0070660_100555832 Ga0070660_1005558322 108
287 3300005344 Ga0070661_100239143 Ga0070661_1002391432 108
288 3300005347 Ga0070668_100434588 Ga0070668_1004345882 108
289 3300005347 Ga0070668_101596082 Ga0070668_1015960821 108
290 3300005353 Ga0070669_100122889 Ga0070669_1001228893 108
291 3300005356 Ga0070674_100300173 Ga0070674_1003001732 108
292 3300005356 Ga0070674_100535004 Ga0070674_1005350041 108
293 3300005364 Ga0070673_100747071 Ga0070673_1007470712 108
294 3300005364 Ga0070673_100965950 Ga0070673_1009659501 108
295 3300005367 Ga0070667_100062199 Ga0070667_1000621992 108
296 3300005367 Ga0070667_100319899 Ga0070667_1003198992 108
297 3300005456 Ga0070678_100025831 Ga0070678_1000258316 108
298 3300005456 Ga0070678_100508314 Ga0070678_1005083142 108
299 3300005456 Ga0070678_100766973 Ga0070678_1007669732 108
300 3300005457 Ga0070662_100815638 Ga0070662_1008156381 108
301 3300005457 Ga0070662_101731189 Ga0070662_1017311891 108
302 3300005459 Ga0068867_101178652 Ga0068867_1011786522 108
303 3300005459 Ga0068867_101277968 Ga0068867_1012779681 108
304 3300005466 Ga0070685_10134774 Ga0070685_101347743 108
305 3300005543 Ga0070672_100554661 Ga0070672_1005546612 108
306 3300005548 Ga0070665_100066375 Ga0070665_1000663752 108
307 3300005548 Ga0070665_100363848 Ga0070665_1003638481 108
308 3300005563 Ga0068855_101390765 Ga0068855_1013907652 108
309 3300005564 Ga0070664_100034087 Ga0070664_1000340873 108
310 3300005577 Ga0068857_100301577 Ga0068857_1003015772 108
311 3300005577 Ga0068857_100302096 Ga0068857_1003020962 108
312 3300005577 Ga0068857_102263502 Ga0068857_1022635022 108
313 3300005578 Ga0068854_100116114 Ga0068854_1001161142 108
314 3300005578 Ga0068854_100704906 Ga0068854_1007049062 108
315 3300005614 Ga0068856_100513221 Ga0068856_1005132212 108
316 3300005616 Ga0068852_100105818 Ga0068852_1001058183 108
317 3300005616 Ga0068852_101071830 Ga0068852_1010718301 108
318 3300005834 Ga0068851_10650954 Ga0068851_106509542 108
319 3300005842 Ga0068858_100699827 Ga0068858_1006998272 108
320 3300006038 Ga0075365_10163106 Ga0075365_101631062 108
321 3300006042 Ga0075368_10088109 Ga0075368_100881092 108
322 3300006042 Ga0075368_10202258 Ga0075368_102022582 108
323 3300006048 Ga0075363_100001894 Ga0075363_1000018946 108
324 3300006048 Ga0075363_100002355 Ga0075363_1000023557 108
325 3300006048 Ga0075363_100137334 Ga0075363_1001373342 108
326 3300006048 Ga0075363_100241283 Ga0075363_1002412832 108
327 3300006051 Ga0075364_10090363 Ga0075364_100903633 108
328 3300006051 Ga0075364_10471707 Ga0075364_104717072 108
329 3300006051 Ga0075364_10601099 Ga0075364_106010992 108
330 3300006058 Ga0075432_10030991 Ga0075432_100309912 108
331 3300006163 Ga0070715_10927387 Ga0070715_109273871 108
332 3300006177 Ga0075362_10024189 Ga0075362_100241893 108
333 3300006177 Ga0075362_10127290 Ga0075362_101272902 108
334 3300006177 Ga0075362_10204167 Ga0075362_102041672 108
335 3300006177 Ga0075362_10458926 Ga0075362_104589261 108
336 3300006178 Ga0075367_10066066 Ga0075367_100660663 108
337 3300006186 Ga0075369_10063213 Ga0075369_100632132 108
338 3300006186 Ga0075369_10309748 Ga0075369_103097482 108
339 3300006195 Ga0075366_10010628 Ga0075366_100106285 108
340 3300006195 Ga0075366_10033205 Ga0075366_100332054 108
341 3300006195 Ga0075366_10044518 Ga0075366_100445182 108
342 3300006195 Ga0075366_10192843 Ga0075366_101928432 108
343 3300006237 Ga0097621_100497298 Ga0097621_1004972982 108
344 3300006237 Ga0097621_100544574 Ga0097621_1005445742 108
345 3300006237 Ga0097621_101326845 Ga0097621_1013268452 108
346 3300006353 Ga0075370_10002650 Ga0075370_100026508 108
347 3300006353 Ga0075370_10035610 Ga0075370_100356102 108
348 3300006353 Ga0075370_10090565 Ga0075370_100905652 108
349 3300006353 Ga0075370_10337909 Ga0075370_103379092 108
350 3300006353 Ga0075370_10372816 Ga0075370_103728162 108
351 3300006353 Ga0075370_10666586 Ga0075370_106665861 108
352 3300006358 Ga0068871_100819762 Ga0068871_1008197622 108
353 3300006844 Ga0075428_101712536 Ga0075428_1017125362 108
354 3300006846 Ga0075430_100152368 Ga0075430_1001523682 108
355 3300006880 Ga0075429_101508145 Ga0075429_1015081451 108
356 3300006948 Ga0099826_10001050 Ga0099826_100010506 108
357 3300006948 Ga0099826_10182867 Ga0099826_101828672 108
358 3300006948 Ga0099826_10508711 Ga0099826_105087112 108
359 3300009036 Ga0105244_10003265 Ga0105244_100032655 108
360 3300009036 Ga0105244_10128001 Ga0105244_101280012 108
361 3300009093 Ga0105240_10492308 Ga0105240_104923082 108
362 3300009093 Ga0105240_10659293 Ga0105240_106592932 108
363 3300009148 Ga0105243_10002036 Ga0105243_1000203616 108
364 3300009148 Ga0105243_10002550 Ga0105243_1000255011 108
365 3300009148 Ga0105243_10034165 Ga0105243_100341654 108
366 3300009148 Ga0105243_11037711 Ga0105243_110377112 108
367 3300009148 Ga0105243_12718157 Ga0105243_127181572 108
368 3300009174 Ga0105241_11363289 Ga0105241_113632891 108
369 3300009545 Ga0105237_10307105 Ga0105237_103071051 108
370 3300009551 Ga0105238_10159439 Ga0105238_101594392 108
371 3300009551 Ga0105238_10395476 Ga0105238_103954763 108
372 3300009551 Ga0105238_12073272 Ga0105238_120732722 108
373 3300009553 Ga0105249_12219139 Ga0105249_122191392 108
374 3300010375 Ga0105239_10283024 Ga0105239_102830243 108
375 3300010375 Ga0105239_10947390 Ga0105239_109473902 108
376 3300011119 Ga0105246_10062869 Ga0105246_100628694 108
377 3300011119 Ga0105246_10168653 Ga0105246_101686532 108
378 3300011119 Ga0105246_11667610 Ga0105246_116676102 108
379 3300012497 Ga0157319_1008614 Ga0157319_10086142 108
380 3300012502 Ga0157347_1001331 Ga0157347_10013313 108
381 3300012505 Ga0157339_1008668 Ga0157339_10086682 108
382 3300013100 Ga0157373_10106608 Ga0157373_101066082 108
383 3300013102 Ga0157371_10048625 Ga0157371_100486253 108
384 3300013104 Ga0157370_10012858 Ga0157370_100128585 108
385 3300013105 Ga0157369_10008671 Ga0157369_100086714 108
386 3300013105 Ga0157369_10416856 Ga0157369_104168561 108
387 3300013306 Ga0163162_10112117 Ga0163162_101121172 108
388 3300013306 Ga0163162_10603155 Ga0163162_106031552 108
389 3300013306 Ga0163162_11655664 Ga0163162_116556642 108
390 3300013306 Ga0163162_12844920 Ga0163162_128449202 108
391 3300013308 Ga0157375_10059275 Ga0157375_100592752 108
392 3300013308 Ga0157375_10626110 Ga0157375_106261102 108
393 3300014497 Ga0182008_10015193 Ga0182008_100151932 108
394 3300014497 Ga0182008_10085809 Ga0182008_100858092 108
395 3300014497 Ga0182008_10186350 Ga0182008_101863502 108
396 3300014968 Ga0157379_11588319 Ga0157379_115883192 108
397 3300015261 Ga0182006_1043742 Ga0182006_10437422 108
398 3300015261 Ga0182006_1134424 Ga0182006_11344241 108
399 3300015262 Ga0182007_10000642 Ga0182007_1000064217 108
400 3300015262 Ga0182007_10000951 Ga0182007_1000095110 108
401 3300015265 Ga0182005_1093030 Ga0182005_10930302 108
402 3300015265 Ga0182005_1124589 Ga0182005_11245892 108
403 3300015683 Ga0183362_10003 Ga0183362_10003580 108
404 3300017792 Ga0163161_10001265 Ga0163161_100012655 108
405 3300017792 Ga0163161_10016923 Ga0163161_100169233 108
406 3300017792 Ga0163161_10026103 Ga0163161_100261033 108
407 3300017792 Ga0163161_10066713 Ga0163161_100667133 108
408 3300017792 Ga0163161_10074264 Ga0163161_100742643 108
409 3300017792 Ga0163161_11324157 Ga0163161_113241571 108
410 3300025208 Ga0209436_105358 Ga0209436_1053582 108
411 3300025208 Ga0209436_110704 Ga0209436_1107043 108
412 3300025228 Ga0209672_102876 Ga0209672_1028763 108
413 3300025242 Ga0209258_100240 Ga0209258_1002404 108
414 3300025245 Ga0207425_1001344 Ga0207425_10013448 108
415 3300025245 Ga0207425_1003603 Ga0207425_10036032 108
416 3300025254 Ga0209148_1000033 Ga0209148_10000334 108
417 3300025258 Ga0209129_1000054 Ga0209129_100005437 108
418 3300025258 Ga0209129_1003094 Ga0209129_10030945 108
419 3300025258 Ga0209129_1006468 Ga0209129_10064685 108
420 3300025263 Ga0209565_1000067 Ga0209565_1000067175 108
421 3300025263 Ga0209565_1000648 Ga0209565_100064818 108
422 3300025263 Ga0209565_1002007 Ga0209565_10020073 108
423 3300025273 Ga0209673_1000097 Ga0209673_100009769 108
424 3300025273 Ga0209673_1000172 Ga0209673_100017243 108
425 3300025273 Ga0209673_1001430 Ga0209673_10014305 108
426 3300025273 Ga0209673_1021934 Ga0209673_10219343 108
427 3300025273 Ga0209673_1035424 Ga0209673_10354243 108
428 3300025273 Ga0209673_1054438 Ga0209673_10544382 108
429 3300025284 Ga0209130_1000954 Ga0209130_100095418 108
430 3300025284 Ga0209130_1001108 Ga0209130_100110816 108
431 3300025284 Ga0209130_1001362 Ga0209130_100136218 108
432 3300025291 Ga0209675_1000038 Ga0209675_100003869 108
433 3300025291 Ga0209675_1000527 Ga0209675_100052723 108
434 3300025291 Ga0209675_1000690 Ga0209675_100069018 108
435 3300025291 Ga0209675_1001272 Ga0209675_10012729 108
436 3300025291 Ga0209675_1007572 Ga0209675_10075723 108
437 3300025292 Ga0209676_1000048 Ga0209676_1000048369 108
438 3300025292 Ga0209676_1000739 Ga0209676_100073934 108
439 3300025292 Ga0209676_1000836 Ga0209676_100083613 108
440 3300025292 Ga0209676_1004722 Ga0209676_10047224 108
441 3300025292 Ga0209676_1013256 Ga0209676_10132563 108
442 3300025292 Ga0209676_1026113 Ga0209676_10261132 108
443 3300025292 Ga0209676_1049862 Ga0209676_10498622 108
444 3300025292 Ga0209676_1058224 Ga0209676_10582242 108
445 3300025294 Ga0209025_1000174 Ga0209025_1000174125 108
446 3300025294 Ga0209025_1002139 Ga0209025_10021395 108
447 3300025294 Ga0209025_1006091 Ga0209025_10060915 108
448 3300025294 Ga0209025_1009762 Ga0209025_10097624 108
449 3300025294 Ga0209025_1039557 Ga0209025_10395572 108
450 3300025295 Ga0209564_1000241 Ga0209564_100024199 108
451 3300025295 Ga0209564_1001515 Ga0209564_100151518 108
452 3300025297 Ga0209758_1000034 Ga0209758_1000034401 108
453 3300025297 Ga0209758_1008758 Ga0209758_10087587 108
454 3300025297 Ga0209758_1074214 Ga0209758_10742142 108
455 3300025298 Ga0209050_1000012 Ga0209050_1000012369 108
456 3300025298 Ga0209050_1000294 Ga0209050_1000294103 108
457 3300025298 Ga0209050_1002666 Ga0209050_10026665 108
458 3300025298 Ga0209050_1007315 Ga0209050_10073153 108
459 3300025299 Ga0209256_1000103 Ga0209256_100010339 108
460 3300025299 Ga0209256_1000165 Ga0209256_1000165116 108
461 3300025299 Ga0209256_1075865 Ga0209256_10758652 108
462 3300025302 Ga0207426_1000058 Ga0207426_1000058167 108
463 3300025302 Ga0207426_1000067 Ga0207426_1000067290 108
464 3300025302 Ga0207426_1140656 Ga0207426_11406562 108
465 3300025303 Ga0209051_1000019 Ga0209051_1000019288 108
466 3300025303 Ga0209051_1000315 Ga0209051_100031517 108
467 3300025303 Ga0209051_1001398 Ga0209051_10013985 108
468 3300025303 Ga0209051_1001450 Ga0209051_100145020 108
469 3300025303 Ga0209051_1001560 Ga0209051_100156016 108
470 3300025303 Ga0209051_1002634 Ga0209051_100263411 108
471 3300025303 Ga0209051_1015020 Ga0209051_10150204 108
472 3300025303 Ga0209051_1024147 Ga0209051_10241473 108
473 3300025303 Ga0209051_1114300 Ga0209051_11143002 108
474 3300025304 Ga0209257_1000024 Ga0209257_1000024315 108
475 3300025304 Ga0209257_1000057 Ga0209257_1000057232 108
476 3300025304 Ga0209257_1000309 Ga0209257_100030929 108
477 3300025304 Ga0209257_1007111 Ga0209257_10071115 108
478 3300025304 Ga0209257_1009377 Ga0209257_10093772 108
479 3300025304 Ga0209257_1068617 Ga0209257_10686172 108
480 3300025728 Ga0207655_1000639 Ga0207655_100063928 108
481 3300025893 Ga0207682_10051721 Ga0207682_100517211 108
482 3300025901 Ga0207688_10506405 Ga0207688_105064051 108
483 3300025903 Ga0207680_10182202 Ga0207680_101822022 108
484 3300025907 Ga0207645_10077097 Ga0207645_100770972 108
485 3300025907 Ga0207645_10605106 Ga0207645_106051062 108
486 3300025909 Ga0207705_10604173 Ga0207705_106041732 108
487 3300025913 Ga0207695_10353626 Ga0207695_103536262 108
488 3300025914 Ga0207671_10495882 Ga0207671_104958822 108
489 3300025919 Ga0207657_10766528 Ga0207657_107665281 108
490 3300025923 Ga0207681_10321139 Ga0207681_103211392 108
491 3300025924 Ga0207694_10106627 Ga0207694_101066273 108
492 3300025932 Ga0207690_10458229 Ga0207690_104582291 108
493 3300025932 Ga0207690_10567080 Ga0207690_105670802 108
494 3300025933 Ga0207706_10127382 Ga0207706_101273823 108
495 3300025935 Ga0207709_10000874 Ga0207709_100008748 108
496 3300025935 Ga0207709_10025717 Ga0207709_100257172 108
497 3300025937 Ga0207669_10143110 Ga0207669_101431102 108
498 3300025937 Ga0207669_10285882 Ga0207669_102858822 108
499 3300025937 Ga0207669_10490133 Ga0207669_104901331 108
500 3300025937 Ga0207669_11358229 Ga0207669_113582291 108
501 3300025938 Ga0207704_11455649 Ga0207704_114556492 108
502 3300025940 Ga0207691_10500935 Ga0207691_105009352 108
503 3300025942 Ga0207689_10300263 Ga0207689_103002632 108
504 3300025945 Ga0207679_10053805 Ga0207679_100538053 108
505 3300025949 Ga0207667_10371498 Ga0207667_103714982 108
506 3300025960 Ga0207651_11329473 Ga0207651_113294732 108
507 3300025972 Ga0207668_10601637 Ga0207668_106016372 108
508 3300025981 Ga0207640_10098316 Ga0207640_100983163 108
509 3300025986 Ga0207658_10161411 Ga0207658_101614113 108
510 3300025986 Ga0207658_10320184 Ga0207658_103201842 108
511 3300026023 Ga0207677_10125692 Ga0207677_101256922 108
512 3300026035 Ga0207703_10793673 Ga0207703_107936732 108
513 3300026041 Ga0207639_10007668 Ga0207639_100076687 108
514 3300026067 Ga0207678_10541618 Ga0207678_105416182 108
515 3300026067 Ga0207678_11636254 Ga0207678_116362542 108
516 3300026078 Ga0207702_10460583 Ga0207702_104605832 108
517 3300026089 Ga0207648_10203104 Ga0207648_102031042 108
518 3300026089 Ga0207648_11313797 Ga0207648_113137972 108
519 3300026089 Ga0207648_11632720 Ga0207648_116327201 108
520 3300026116 Ga0207674_10383653 Ga0207674_103836532 108
521 3300026116 Ga0207674_10664000 Ga0207674_106640002 108
522 3300026121 Ga0207683_10054704 Ga0207683_100547042 108
523 3300026121 Ga0207683_10516967 Ga0207683_105169672 108
524 3300026121 Ga0207683_11864906 Ga0207683_118649062 108
525 3300026142 Ga0207698_10034645 Ga0207698_100346453 108
526 3300027471 Ga0209995_1089223 Ga0209995_10892231 108
527 3300027666 Ga0209282_1000250 Ga0209282_10002506 108
528 3300027666 Ga0209282_1288768 Ga0209282_12887682 108
529 3300027907 Ga0207428_10247795 Ga0207428_102477952 108
530 3300028379 Ga0268266_10021518 Ga0268266_100215185 108
531 3300028379 Ga0268266_10877237 Ga0268266_108772372 108
532 3300028786 Ga0307517_10260146 Ga0307517_102601461 108
533 3300028794 Ga0307515_10000472 Ga0307515_1000047291 108
534 3300028794 Ga0307515_10693766 Ga0307515_106937661 108
535 3300030731 Ga0316177_1034408 Ga0316177_10344084 108
536 3300030731 Ga0316177_1080169 Ga0316177_10801691 108
537 3300030733 Ga0314311_1027844 Ga0314311_10278443 108
538 3300030734 Ga0316179_1049987 Ga0316179_10499872 108
539 3300030735 Ga0316178_1145977 Ga0316178_11459773 108
540 3300030742 Ga0316183_1069619 Ga0316183_10696193 108
541 3300030742 Ga0316183_1109757 Ga0316183_11097573 108
542 3300030744 Ga0316181_1020350 Ga0316181_10203503 108
543 3300030745 Ga0316182_1118407 Ga0316182_11184072 108
544 3300031251 Ga0265327_10001288 Ga0265327_1000128831 108
545 3300031456 Ga0307513_10324239 Ga0307513_103242391 108
546 3300031548 Ga0307408_100068273 Ga0307408_1000682734 108
547 3300031548 Ga0307408_100128683 Ga0307408_1001286833 108
548 3300031548 Ga0307408_100177894 Ga0307408_1001778942 108
549 3300031548 Ga0307408_100356005 Ga0307408_1003560051 108
550 3300031548 Ga0307408_100418682 Ga0307408_1004186822 108
551 3300031548 Ga0307408_101693924 Ga0307408_1016939241 108
552 3300031731 Ga0307405_10035253 Ga0307405_100352534 108
553 3300031731 Ga0307405_10110899 Ga0307405_101108992 108
554 3300031731 Ga0307405_10138426 Ga0307405_101384262 108
555 3300031731 Ga0307405_10226574 Ga0307405_102265742 108
556 3300031824 Ga0307413_10032421 Ga0307413_100324213 108
557 3300031824 Ga0307413_10046453 Ga0307413_100464531 108
558 3300031824 Ga0307413_10120537 Ga0307413_101205372 108
559 3300031852 Ga0307410_10365805 Ga0307410_103658052 108
560 3300031852 Ga0307410_10525078 Ga0307410_105250781 108
561 3300031901 Ga0307406_10003957 Ga0307406_100039574 108
562 3300031901 Ga0307406_10704579 Ga0307406_107045791 108
563 3300031901 Ga0307406_11197726 Ga0307406_111977262 108
564 3300031901 Ga0307406_11265560 Ga0307406_112655601 108
565 3300031901 Ga0307406_11558465 Ga0307406_115584652 108
566 3300031903 Ga0307407_10111725 Ga0307407_101117252 108
567 3300031903 Ga0307407_10343576 Ga0307407_103435762 108
568 3300031903 Ga0307407_10892760 Ga0307407_108927602 108
569 3300031911 Ga0307412_10047673 Ga0307412_100476733 108
570 3300031911 Ga0307412_10060086 Ga0307412_100600863 108
571 3300031911 Ga0307412_10066350 Ga0307412_100663504 108
572 3300031911 Ga0307412_10316613 Ga0307412_103166132 108
573 3300031911 Ga0307412_10360466 Ga0307412_103604662 108
574 3300031911 Ga0307412_10738684 Ga0307412_107386842 108
575 3300031911 Ga0307412_11014099 Ga0307412_110140991 108
576 3300031995 Ga0307409_101928884 Ga0307409_1019288842 108
577 3300032002 Ga0307416_100030507 Ga0307416_1000305075 108
578 3300032002 Ga0307416_100201880 Ga0307416_1002018802 108
579 3300032002 Ga0307416_100259942 Ga0307416_1002599423 108
580 3300032002 Ga0307416_101838027 Ga0307416_1018380272 108
581 3300032004 Ga0307414_10026501 Ga0307414_100265013 108
582 3300032004 Ga0307414_10765311 Ga0307414_107653112 108
583 3300032005 Ga0307411_10169978 Ga0307411_101699781 108
584 3300032005 Ga0307411_10570046 Ga0307411_105700461 108
585 3300032005 Ga0307411_11037101 Ga0307411_110371012 108
586 3300032005 Ga0307411_11819561 Ga0307411_118195611 108
587 3300032005 Ga0307411_11956100 Ga0307411_119561001 108
588 3300032005 Ga0307411_11967929 Ga0307411_119679292 108
589 3300037312 Ga0395899_0003383 Ga0395899_0003383_2091_2420 108
590 3300037312 Ga0395899_0294665 Ga0395899_0294665_216_545 108
591 3300037418 Ga0395900_0014177 Ga0395900_0014177_3509_3838 108
592 3300037418 Ga0395900_0217707 Ga0395900_0217707_681_1010 108
593 3300037466 Ga0395898_0010814 Ga0395898_0010814_9191_9520 108
594 3300037471 Ga0395905_0126059 Ga0395905_0126059_1229_1558 108
595 3300037471 Ga0395905_0221292 Ga0395905_0221292_307_636 108
596 3300037471 Ga0395905_0484311 Ga0395905_0484311_120_449 108
597 3300037471 Ga0395905_0758292 Ga0395905_0758292_437_763 108
598 3300038443 Ga0395901_0039778 Ga0395901_0039778_12_347 108
599 3300038443 Ga0395901_0117489 Ga0395901_0117489_16_345 108
600 3300038443 Ga0395901_0452615 Ga0395901_0452615_715_1044 108
601 3300039447 Ga0436361_0101461 Ga0436361_0101461_14852_15178 108
602 3300041404 Ga0439436_0000328 Ga0439436_0000328_2635_2961 108
603 3300041404 Ga0439436_0004062 Ga0439436_0004062_3102_3428 108
604 3300041405 Ga0439438_024290 Ga0439438_024290_934_1260 108
605 3300041406 Ga0439439_0008740 Ga0439439_0008740_966_1292 108
606 3300041406 Ga0439439_0174931 Ga0439439_0174931_102_428 108
607 3300041407 Ga0439447_011668 Ga0439447_011668_2108_2434 108
608 3300041407 Ga0439447_027912 Ga0439447_027912_821_1147 108
609 3300041408 Ga0439453_0009846 Ga0439453_0009846_893_1222 108
610 3300041410 Ga0439461_0083485 Ga0439461_0083485_329_655 108
611 3300041410 Ga0439461_0112290 Ga0439461_0112290_104_430 108
612 3300041410 Ga0439461_0152825 Ga0439461_0152825_59_388 108
613 3300041411 Ga0439466_0003860 Ga0439466_0003860_4126_4452 108
614 3300041411 Ga0439466_0004758 Ga0439466_0004758_4351_4677 108
615 3300041413 Ga0439465_0000335 Ga0439465_0000335_5272_5598 108
616 3300041413 Ga0439465_0021529 Ga0439465_0021529_698_1027 108
617 3300041441 Ga0451787_422576 Ga0451787_422576_65_394 108
618 3300041451 Ga0451791_0144114 Ga0451791_0144114_230_556 108
619 3300041453 Ga0451797_0753891 Ga0451797_0753891_142_468 108
620 3300041486 Ga0451807_0354829 Ga0451807_0354829_93_431 108
621 3300041503 Ga0451847_1003343 Ga0451847_1003343_180_506 108
622 3300041512 Ga0451853_1371493 Ga0451853_1371493_240_566 108
623 3300041997 Ga0439431_0002745 Ga0439431_0002745_802_1128 108
624 3300041999 Ga0439433_0001040 Ga0439433_0001040_4185_4511 108
625 3300042002 Ga0439442_003077 Ga0439442_003077_1208_1537 108
626 3300042002 Ga0439442_003207 Ga0439442_003207_1059_1385 108
627 3300042002 Ga0439442_013480 Ga0439442_013480_1024_1350 108
628 3300042004 Ga0439445_0002157 Ga0439445_0002157_2810_3136 108
629 3300042004 Ga0439445_0020234 Ga0439445_0020234_67_396 108
630 3300042004 Ga0439445_0052016 Ga0439445_0052016_497_823 108
631 3300042006 Ga0439432_001277 Ga0439432_001277_1676_2002 108
632 3300042006 Ga0439432_007245 Ga0439432_007245_3111_3437 108
633 3300042007 Ga0439449_0001202 Ga0439449_0001202_1045_1371 108
634 3300042007 Ga0439449_0003003 Ga0439449_0003003_5194_5520 108
635 3300042007 Ga0439449_0007077 Ga0439449_0007077_1518_1847 108
636 3300042007 Ga0439449_0041944 Ga0439449_0041944_202_528 108
637 3300042010 Ga0439452_003207 Ga0439452_003207_3876_4202 108
638 3300042010 Ga0439452_023010 Ga0439452_023010_1181_1507 108
639 3300042011 Ga0439454_030628 Ga0439454_030628_119_448 108
640 3300042014 Ga0439457_001739 Ga0439457_001739_3344_3670 108
641 3300042014 Ga0439457_024364 Ga0439457_024364_931_1257 108
642 3300042015 Ga0439462_0001618 Ga0439462_0001618_3086_3412 108
643 3300042015 Ga0439462_0014579 Ga0439462_0014579_895_1221 108
644 3300042015 Ga0439462_0068215 Ga0439462_0068215_550_879 108
645 3300042016 Ga0439463_031283 Ga0439463_031283_34_360 108
646 3300042115 Ga0450911_001790 Ga0450911_001790_3267_3593 108
647 3300042116 Ga0450912_006428 Ga0450912_006428_499_825 108
648 3300042122 Ga0450920_053079 Ga0450920_053079_117_446 108
649 3300042123 Ga0450921_007502 Ga0450921_007502_350_679 108
650 3300042123 Ga0450921_029709 Ga0450921_029709_113_439 108
651 3300042125 Ga0450923_003016 Ga0450923_003016_1081_1410 108
652 3300042128 Ga0450897_016804 Ga0450897_016804_267_593 108
653 3300042131 Ga0450894_013319 Ga0450894_013319_66_392 108
654 3300042133 Ga0450896_014494 Ga0450896_014494_558_884 108
655 3300042133 Ga0450896_039304 Ga0450896_039304_145_474 108
656 3300042134 Ga0450898_002224 Ga0450898_002224_1824_2153 108
657 3300042134 Ga0450898_027176 Ga0450898_027176_171_497 108
658 3300042145 Ga0450906_003495 Ga0450906_003495_2640_2969 108
659 3300042146 Ga0450907_008273 Ga0450907_008273_513_842 108
660 3300042147 Ga0450910_006248 Ga0450910_006248_1095_1424 108
661 3300042156 Ga0439446_0001983 Ga0439446_0001983_4181_4507 108
662 3300042156 Ga0439446_0032073 Ga0439446_0032073_367_696 108
663 3300042184 Ga0450908_013209 Ga0450908_013209_724_1053 108
664 3300042184 Ga0450908_053513 Ga0450908_053513_132_458 108
665 3300042185 Ga0450909_009490 Ga0450909_009490_35_361 108
666 3300042185 Ga0450909_013238 Ga0450909_013238_311_637 108
667 3300042435 Ga0439434_0016246 Ga0439434_0016246_1270_1596 108
668 3300042435 Ga0439434_0023986 Ga0439434_0023986_310_639 108
669 3300042435 Ga0439434_0032026 Ga0439434_0032026_408_737 108
670 3300042435 Ga0439434_0036215 Ga0439434_0036215_408_734 108
671 3300042439 Ga0439464_0059805 Ga0439464_0059805_384_713 108
672 3300042530 Ga0450916_071003 Ga0450916_071003_11_337 108
673 3300042531 Ga0450918_000837 Ga0450918_000837_4862_5191 108
674 3300042876 Ga0451577_0000276 Ga0451577_0000276_78908_79270 108
675 3300042876 Ga0451577_1479152 Ga0451577_1479152_144_470 108
676 3300044673 Ga0453683_0012232 Ga0453683_0012232_1092_1418 108
677 3300044683 Ga0466965_0043939 Ga0466965_0043939_1024_1350 108
678 3300044683 Ga0466965_0075588 Ga0466965_0075588_922_1248 108
679 3300044693 Ga0466961_0168159 Ga0466961_0168159_153_479 108
680 3300044712 Ga0453684_0000891 Ga0453684_0000891_20229_20591 108
681 3300044901 Ga0466960_0014488 Ga0466960_0014488_451_777 108
682 3300044901 Ga0466960_0176268 Ga0466960_0176268_500_835 108
683 3300044901 Ga0466960_1024777 Ga0466960_1024777_93_422 108
684 3300045051 Ga0451576_0004706 Ga0451576_0004706_11433_11759 108
685 3300045051 Ga0451576_0605340 Ga0451576_0605340_323_652 108
686 3300046453 Ga0495627_010560 Ga0495627_010560_1865_2191 108
687 3300046454 Ga0495592_0428935 Ga0495592_0428935_174_500 108
688 3300046459 Ga0495629_0185708 Ga0495629_0185708_582_908 108
689 3300046459 Ga0495629_0402427 Ga0495629_0402427_97_423 108
690 3300046463 Ga0495653_0744655 Ga0495653_0744655_122_448 108
691 3300046475 Ga0495639_0012096 Ga0495639_0012096_2902_3228 108
692 3300046512 Ga0495610_0024146 Ga0495610_0024146_2329_2655 108
693 3300046512 Ga0495610_0195897 Ga0495610_0195897_488_814 108
694 3300046513 Ga0495616_0006871 Ga0495616_0006871_6415_6741 108
695 3300046514 Ga0495618_0180871 Ga0495618_0180871_173_499 108
696 3300046515 Ga0495620_0064465 Ga0495620_0064465_302_628 108
697 3300046515 Ga0495620_0140238 Ga0495620_0140238_80_406 108
698 3300046517 Ga0495630_1344912 Ga0495630_1344912_142_468 108
699 3300046518 Ga0495631_0004279 Ga0495631_0004279_4140_4466 108
700 3300046520 Ga0495637_0006661 Ga0495637_0006661_1062_1388 108
701 3300046525 Ga0495663_0024751 Ga0495663_0024751_1364_1699 108
702 3300046525 Ga0495663_0090132 Ga0495663_0090132_146_472 108
703 3300046528 Ga0495642_0035383 Ga0495642_0035383_554_880 108
704 3300046528 Ga0495642_0118454 Ga0495642_0118454_405_740 108
705 3300046529 Ga0495652_0294786 Ga0495652_0294786_250_576 108
706 3300046530 Ga0495654_0043341 Ga0495654_0043341_762_1088 108
707 3300046535 Ga0495586_0332902 Ga0495586_0332902_392_718 108
708 3300046536 Ga0495587_0447736 Ga0495587_0447736_260_586 108
709 3300046538 Ga0495609_0088811 Ga0495609_0088811_720_1046 108
710 3300046539 Ga0495621_0060176 Ga0495621_0060176_723_1049 108
711 3300046539 Ga0495621_0157890 Ga0495621_0157890_456_782 108
712 3300046543 Ga0495645_0431969 Ga0495645_0431969_315_641 108
713 3300046557 Ga0495622_0289819 Ga0495622_0289819_41_367 108
714 3300046558 Ga0495633_0042415 Ga0495633_0042415_1317_1652 108
715 3300046558 Ga0495633_0288542 Ga0495633_0288542_94_420 108
716 3300046615 Ga0495656_0000090 Ga0495656_0000090_26792_27118 108
717 3300046615 Ga0495656_0045688 Ga0495656_0045688_861_1232 108
718 3300046615 Ga0495656_0064024 Ga0495656_0064024_32_367 108
719 3300046615 Ga0495656_0163209 Ga0495656_0163209_192_518 108
720 3300046660 Ga0495625_0001055 Ga0495625_0001055_31095_31424 108
721 3300046660 Ga0495625_0035184 Ga0495625_0035184_2750_3076 108
722 3300046660 Ga0495625_0058131 Ga0495625_0058131_1657_1983 108
723 3300046665 Ga0495661_0149149 Ga0495661_0149149_446_772 108
724 3300046674 Ga0495588_0065501 Ga0495588_0065501_1158_1493 108
725 3300046674 Ga0495588_0134042 Ga0495588_0134042_572_898 108
726 3300046675 Ga0495657_0357776 Ga0495657_0357776_278_604 108
727 3300046684 Ga0495669_0092764 Ga0495669_0092764_153_488 108
728 3300046684 Ga0495669_0451213 Ga0495669_0451213_38_364 108
729 3300046689 Ga0495613_0516400 Ga0495613_0516400_287_613 108
730 3300046690 Ga0495624_0459963 Ga0495624_0459963_185_511 108
731 3300046691 Ga0495670_0156653 Ga0495670_0156653_837_1163 108
732 3300046691 Ga0495670_0370342 Ga0495670_0370342_250_576 108
733 3300046692 Ga0495671_0033400 Ga0495671_0033400_2183_2509 108
734 3300046809 Ga0495600_0673660 Ga0495600_0673660_210_536 108
735 3300047318 Ga0495636_0035291 Ga0495636_0035291_972_1307 108
736 3300047321 Ga0495676_0077660 Ga0495676_0077660_787_1113 108
737 3300047321 Ga0495676_0661797 Ga0495676_0661797_194_520 108
738 3300047321 Ga0495676_0754657 Ga0495676_0754657_212_538 108
739 3300047322 Ga0495680_0649593 Ga0495680_0649593_23_349 108
740 3300047445 Ga0495677_0185109 Ga0495677_0185109_131_466 108
741 3300047447 Ga0495685_020122 Ga0495685_020122_23_358 108
742 3300047472 Ga0495686_0252038 Ga0495686_0252038_491_817 108
743 3300047472 Ga0495686_0289959 Ga0495686_0289959_288_614 108
744 3300048088 Ga0495602_0268765 Ga0495602_0268765_605_931 108
745 3300048089 Ga0495614_0029162 Ga0495614_0029162_754_1080 108
746 3300048089 Ga0495614_0031400 Ga0495614_0031400_488_814 108
747 3300048090 Ga0495615_0036591 Ga0495615_0036591_325_651 108
748 3300048090 Ga0495615_0164403 Ga0495615_0164403_61_387 108
749 3300048903 Ga0496100_0523034 Ga0496100_0523034_540_869 108
750 3300048903 Ga0496100_0758544 Ga0496100_0758544_394_720 108
751 3300048903 Ga0496100_0824716 Ga0496100_0824716_93_419 108
752 3300048903 Ga0496100_1092987 Ga0496100_1092987_128_454 108
753 3300048904 Ga0496101_0051772 Ga0496101_0051772_2117_2446 108
754 3300048905 Ga0496102_0004957 Ga0496102_0004957_7577_7903 108
755 3300048905 Ga0496102_0160011 Ga0496102_0160011_686_1012 108
756 3300048906 Ga0496103_0103764 Ga0496103_0103764_1270_1596 108
757 3300048907 Ga0496104_0008675 Ga0496104_0008675_5546_5872 108
758 3300048908 Ga0496105_0010700 Ga0496105_0010700_5502_5828 108
759 3300048909 Ga0496106_0008933 Ga0496106_0008933_171_497 108
760 3300048911 Ga0496108_0090817 Ga0496108_0090817_1079_1405 108
761 3300048912 Ga0496109_0250036 Ga0496109_0250036_1013_1339 108
762 3300048913 Ga0496110_0450067 Ga0496110_0450067_824_1150 108
763 3300048913 Ga0496110_0681768 Ga0496110_0681768_579_905 108
764 3300048914 Ga0496111_0623212 Ga0496111_0623212_20_346 108
765 3300048915 Ga0496112_0247614 Ga0496112_0247614_554_880 108
766 3300048916 Ga0496113_0209231 Ga0496113_0209231_980_1306 108
767 3300048919 Ga0496116_0026461 Ga0496116_0026461_3025_3354 108
768 3300048920 Ga0496117_0048605 Ga0496117_0048605_1350_1676 108
769 3300048920 Ga0496117_0099448 Ga0496117_0099448_801_1130 108
770 3300048921 Ga0496118_0038816 Ga0496118_0038816_1166_1492 108
771 3300048921 Ga0496118_0100657 Ga0496118_0100657_189_518 108
772 3300048922 Ga0496119_0205620 Ga0496119_0205620_240_566 108
773 3300048924 Ga0496121_0010814 Ga0496121_0010814_8017_8343 108
774 3300048924 Ga0496121_0057522 Ga0496121_0057522_2613_2942 108
775 3300048924 Ga0496121_0325745 Ga0496121_0325745_40_366 108
776 3300048925 Ga0496122_0062562 Ga0496122_0062562_423_749 108
777 3300048925 Ga0496122_0096773 Ga0496122_0096773_471_800 108
778 3300048926 Ga0496123_0045998 Ga0496123_0045998_1676_2002 108
779 3300048926 Ga0496123_0319517 Ga0496123_0319517_263_592 108
780 3300048927 Ga0496124_0037636 Ga0496124_0037636_1004_1330 108
781 3300048927 Ga0496124_0073316 Ga0496124_0073316_1310_1639 108
782 3300048927 Ga0496124_0181661 Ga0496124_0181661_1157_1483 108
783 3300048927 Ga0496124_0602261 Ga0496124_0602261_187_516 108
784 3300048928 Ga0496125_0026721 Ga0496125_0026721_4307_4633 108
785 3300048928 Ga0496125_0030178 Ga0496125_0030178_1115_1441 108
786 3300048928 Ga0496125_0090108 Ga0496125_0090108_746_1072 108
787 3300048928 Ga0496125_0090995 Ga0496125_0090995_1039_1368 108
788 3300048928 Ga0496125_0154906 Ga0496125_0154906_1166_1492 108
789 3300048928 Ga0496125_0334759 Ga0496125_0334759_490_819 108
790 3300048929 Ga0496126_0372416 Ga0496126_0372416_574_900 108
791 3300048929 Ga0496126_0571419 Ga0496126_0571419_521_847 108
792 3300049127 Ga0501306_050789 Ga0501306_050789_10_339 108
793 3300049130 Ga0501310_039787 Ga0501310_039787_184_513 108
794 3300049515 Ga0501292_134997 Ga0501292_134997_151_480 108
795 3300049526 Ga0501303_026821 Ga0501303_026821_104_433 108
796 3300049572 Ga0501036_0484402 Ga0501036_0484402_151_495 108
797 3300049581 Ga0501047_0043447 Ga0501047_0043447_2297_2626 108
798 3300049653 Ga0501206_037287 Ga0501206_037287_248_577 108
799 3300049679 Ga0501249_093532 Ga0501249_093532_38_367 108
800 3300049682 Ga0501252_045450 Ga0501252_045450_86_415 108
801 3300049704 Ga0501221_080328 Ga0501221_080328_333_662 108
802 3300049705 Ga0501225_0077783 Ga0501225_0077783_574_903 108
803 3300049707 Ga0501234_084814 Ga0501234_084814_52_381 108
804 3300049758 Ga0501241_111436 Ga0501241_111436_98_427 108
805 3300049759 Ga0501262_001111 Ga0501262_001111_2513_2842 108
806 3300049760 Ga0501263_046701 Ga0501263_046701_103_435 108
807 3300049760 Ga0501263_080653 Ga0501263_080653_110_439 108
808 3300050489 nmdc:mga03683_10715_c1 nmdc:mga03683_10715_c1_2504_2836 108
809 3300050489 nmdc:mga03683_28534_c1 nmdc:mga03683_28534_c1_903_1232 108
810 3300050489 nmdc:mga03683_47346_c1 nmdc:mga03683_47346_c1_459_788 108
811 3300050489 nmdc:mga03683_50064_c1 nmdc:mga03683_50064_c1_1397_1723 108
812 3300050490 nmdc:mga03n38_119223_c1 nmdc:mga03n38_119223_c1_655_984 108
813 3300050490 nmdc:mga03n38_1785_c1 nmdc:mga03n38_1785_c1_4803_5129 108
814 3300050490 nmdc:mga03n38_9395_c1 nmdc:mga03n38_9395_c1_1936_2265 108
815 3300050491 nmdc:mga00v17_128409_c1 nmdc:mga00v17_128409_c1_1045_1374 108
816 3300050492 nmdc:mga0yw44_27946_c1 nmdc:mga0yw44_27946_c1_2786_3115 108
817 3300050492 nmdc:mga0yw44_392178_c1 nmdc:mga0yw44_392178_c1_571_900 108
818 3300050493 nmdc:mga0k408_11950_c1 nmdc:mga0k408_11950_c1_2812_3141 108
819 3300050493 nmdc:mga0k408_313196_c1 nmdc:mga0k408_313196_c1_212_538 108
820 3300050493 nmdc:mga0k408_6410_c1 nmdc:mga0k408_6410_c1_1812_2138 108
821 3300050494 nmdc:mga06z11_123205_c1 nmdc:mga06z11_123205_c1_340_669 108
822 3300050494 nmdc:mga06z11_391076_c1 nmdc:mga06z11_391076_c1_167_496 108
823 3300050496 nmdc:mga07m45_135590_c1 nmdc:mga07m45_135590_c1_946_1281 108
824 3300050496 nmdc:mga07m45_22136_c1 nmdc:mga07m45_22136_c1_1871_2197 108
825 3300050496 nmdc:mga07m45_32397_c1 nmdc:mga07m45_32397_c1_394_720 108
826 3300050496 nmdc:mga07m45_51559_c1 nmdc:mga07m45_51559_c1_952_1281 108
827 3300050496 nmdc:mga07m45_67562_c1 nmdc:mga07m45_67562_c1_1055_1384 108
828 3300050510 nmdc:mga06r32_853514_c1 nmdc:mga06r32_853514_c1_386_721 108
829 3300050516 nmdc:mga0sz30_64676_c1 nmdc:mga0sz30_64676_c1_580_906 108
830 3300053079 Ga0500610_0000435 Ga0500610_0000435_11951_12277 108
831 3300053087 Ga0500643_006042 Ga0500643_006042_3529_3855 108
832 3300053088 Ga0500644_0107994 Ga0500644_0107994_335_661 108
833 3300053093 Ga0500651_0000400 Ga0500651_0000400_1210_1536 108
834 3300053094 Ga0500566_0527390 Ga0500566_0527390_156_482 108
835 3300053107 Ga0500560_011563 Ga0500560_011563_1003_1329 108
836 3300053109 Ga0500569_095370 Ga0500569_095370_173_499 108
837 3300053110 Ga0500571_000129 Ga0500571_000129_23906_24232 108
838 3300053116 Ga0500592_004711 Ga0500592_004711_536_862 108
839 3300053117 Ga0500593_002479 Ga0500593_002479_5276_5602 108
840 3300053118 Ga0500594_0024273 Ga0500594_0024273_1139_1465 108
841 3300053120 Ga0500597_069253 Ga0500597_069253_1057_1383 108
842 3300053121 Ga0500607_011657 Ga0500607_011657_3630_3956 108
843 3300053122 Ga0500608_019812 Ga0500608_019812_1642_1968 108
844 3300053122 Ga0500608_088279 Ga0500608_088279_77_403 108
845 3300053128 Ga0500626_031523 Ga0500626_031523_1511_1837 108
846 3300053133 Ga0500655_000665 Ga0500655_000665_4284_4610 108
847 3300053134 Ga0500658_0002393 Ga0500658_0002393_2393_2719 108
848 3300053134 Ga0500658_0003299 Ga0500658_0003299_1247_1573 108
849 3300053136 Ga0500559_0026484 Ga0500559_0026484_1206_1532 108
850 3300053138 Ga0500564_014576 Ga0500564_014576_1118_1444 108
851 3300053139 Ga0500568_0000554 Ga0500568_0000554_18926_19252 108
852 3300053153 Ga0500616_0099064 Ga0500616_0099064_945_1271 108
853 3300053157 Ga0500624_024925 Ga0500624_024925_567_893 108
854 3300053158 Ga0500627_0060057 Ga0500627_0060057_145_471 108
855 3300053160 Ga0500633_0122162 Ga0500633_0122162_555_881 108
856 3300053161 Ga0500634_0203894 Ga0500634_0203894_134_460 108
857 3300053162 Ga0500638_028219 Ga0500638_028219_1240_1566 108
858 3300053734 Ga0500565_001007 Ga0500565_001007_436_762 108
859 3300060346 Ga0587111_0125472 Ga0587111_0125472_148_474 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

29

96

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wul-assembly1.cif.gz_D crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster 0.9705 5 104
2wci-assembly1.cif.gz_A structure of e. coli monothiol glutaredoxin grx4 homodimer 0.9572 1 104
2mma-assembly1.cif.gz_A nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9565 1 104
3zyw-assembly1.cif.gz_A crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) 0.9541 3 102
2yan-assembly2.cif.gz_B crystal structure of the second glutaredoxin domain of human txnl2 0.9265 1 106
ID Description Score Start End Superfamily
af_Q555C8_40_141_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9804 8 104 3.40.30.10
af_O97232_76_171_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9739 8 103 3.40.30.10
af_B6TEC7_84_191_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9724 8 104 3.40.30.10
2wemC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9682 8 104 3.40.30.10
af_C6KSR7_119_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.968 7 102 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A562BC22-F1-model_v4 Glutaredoxin 1.001 1 105 GO:0015036
GO:0046872
GO:0051537
AF-A0A431KB48-F1-model_v4 Glutaredoxin 0.9948 1 106 GO:0015036
GO:0046872
GO:0051537
AF-A0A2P7NUZ1-F1-model_v4 Glutaredoxin 0.9917 4 102 GO:0015036
GO:0046872
GO:0051537
AF-A0A2S5LYP8-F1-model_v4 Glutaredoxin 0.9907 3 104 GO:0015036
GO:0046872
GO:0051537
AF-A0A521Y5Y7-F1-model_v4 Glutaredoxin 0.9904 4 104 GO:0015036
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
94.29 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map