F483901

General Info

Members Datasets Scaffolds Average Seq Length
862 512 813 316

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0009287|Ga0501070_0009287_675_1709
Length 344
Sequence MATAAPGIMATGGAARVGMERSEIVAFVLMLAVLIVAPNVVYPLFVMQVLCFAIFACAFNLLIGYVGLLSFGHALYFGWASYVSAHLAKVGAIGIPYWAGGWHWFVIPLPPMPPEIAILGGTLTAAVLGLIAGALAIRRQGIYFAMITLALAQMMYFFAIQAPFTHGEDGIQGVPRGVMFGLFDLRDETTMYAVVLAIFVACFLLIYRIIHSPFGEVIKAIRENETRAISLGYKTDRYKLMTFVLSAALTGVAGSTKAIVFQLASLTDVHWAMSGEVVLMTLIGGLGTIFGPVVGAFVIIAMQNYLSGFDQWVTVIQGAIFVACVMLFRRGVIGEFAHILRIKL

Samples

Sample ID Description Type Environment
1 2511231021 Pseudomonas sp. GM78 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2547132374 Acidovorax radicis N35 Isolate Unclassified
7 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
8 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
9 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
10 2643221570 Acidovorax sp. Root568 Isolate Unclassified
11 2643221609 Acidovorax sp. Root217 Isolate Unclassified
12 2643221611 Acidovorax sp. Root219 Isolate Unclassified
13 2738541307 Variovorax sp. GV008 Isolate Unclassified
14 2738543012 Acidovorax sp. CF301 Isolate Unclassified
15 2816332133 Acidovorax radicis 2721A Isolate Unclassified
16 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
17 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
18 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
19 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
20 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
21 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
22 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
23 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
24 2842733646 Variovorax sp. R-72446 Isolate Unclassified
25 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
26 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
27 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
28 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
29 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
30 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
31 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
32 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
33 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
34 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
35 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
36 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
37 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
38 2929520902 Variovorax beijingensis 502 Isolate Unclassified
39 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
40 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
41 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
42 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
43 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
44 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
45 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
46 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
47 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
48 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
49 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
50 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
51 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
52 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
53 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
54 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
55 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
56 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
57 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
58 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
59 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
60 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
62 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
65 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
68 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
78 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
79 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
80 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
81 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
82 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
83 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
84 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
88 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
89 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
90 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
91 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
92 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
93 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
94 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
95 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
96 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
97 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
98 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
99 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
100 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
103 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
104 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
105 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
106 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
107 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
108 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
109 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
110 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
111 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
112 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
113 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
114 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
115 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
116 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
124 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
125 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
126 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
127 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
128 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
129 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
130 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
131 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
132 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
133 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
134 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
135 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
136 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
137 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
138 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
139 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
140 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
141 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
142 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
143 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
144 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
145 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
146 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
147 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
148 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
149 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
151 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
152 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
153 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
154 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
155 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
156 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
157 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
158 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
159 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
160 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
162 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
165 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
166 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
167 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
168 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
169 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
170 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
171 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
174 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
175 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
176 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
177 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
178 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
179 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
180 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
181 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
182 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
183 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
184 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
185 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
186 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
187 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
188 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
189 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
190 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
193 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
194 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
195 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
196 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
197 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
198 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
201 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
204 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
206 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
207 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
276 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
280 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
281 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
282 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
283 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
284 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
285 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
286 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
287 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
288 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
289 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
290 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
291 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
292 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
293 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
294 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
295 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
296 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
297 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
298 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
299 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
300 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
301 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
302 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
303 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
304 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
305 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
306 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
307 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
308 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
309 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
310 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
311 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
312 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
313 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
314 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
315 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
316 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
318 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
319 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
320 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
323 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
324 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
327 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
328 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
329 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
330 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
331 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
332 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
333 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
334 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
335 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
336 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
337 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
338 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
339 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
340 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
341 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
342 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
343 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
344 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
345 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
346 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
347 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
348 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
349 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
350 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
351 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
352 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
353 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
354 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
355 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
356 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
357 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
358 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
359 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
360 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
365 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
366 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
367 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
368 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
369 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
370 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
371 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
372 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
373 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
374 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
375 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
378 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
379 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
380 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
381 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
382 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
383 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
384 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
385 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
386 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
387 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
388 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
389 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
390 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
391 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
392 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
393 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
394 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
395 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
396 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
397 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
398 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
399 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
400 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
401 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
402 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
403 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
404 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
405 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
406 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
407 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
408 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
409 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
410 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
411 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
412 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
413 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
414 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
415 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
416 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
417 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
426 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
427 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
441 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
442 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
443 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
444 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
445 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
446 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
447 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
448 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
449 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
450 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
451 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
452 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
453 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
454 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
457 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
458 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
459 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
460 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
461 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
462 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
463 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
464 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
465 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
466 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
467 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
468 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
469 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
470 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
471 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
472 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
473 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
474 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
475 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
476 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
477 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
478 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
479 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
480 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
481 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
482 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
483 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
484 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
485 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
486 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
487 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
488 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
489 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
490 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
491 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
492 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
493 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
494 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
495 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
496 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
497 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
498 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
499 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
500 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
501 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
502 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
503 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
504 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
505 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
506 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
507 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
508 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
509 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
510 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
511 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
512 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.32
Metatranscriptomes 0
Isolates 5.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.51
Nodule 1.97
Rhizoplane 6.03
Rhizosphere 76.1
Stem 0
Stem Tuber 0
Unclassified 6.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10012501 3300001979 Bacteria 3198
2 JGI24739J22299_10010613 3300001989 Bacteria 3417
3 JGI24737J22298_10003981 3300001990 Bacteria 5169
4 JGI24750J21931_1000181 3300002070 Bacteria 10568
5 JGI24748J21848_1000571 3300002074 Bacteria 3977
6 JGI24738J21930_10001393 3300002075 Bacteria 6712
7 JGI24749J21850_1001394 3300002076 Bacteria 3429
8 JGI24744J21845_10000700 3300002077 Bacteria 6195
9 JGI24035J26624_1001034 3300002126 Bacteria 2632
10 JGI24033J26618_1000816 3300002155 Bacteria 2982
11 JGI24034J26672_10000836 3300002239 Bacteria 4000
12 JGI24742J22300_10001030 3300002244 Bacteria 4296
13 JGI25404J52841_10002372 3300003659 Bacteria 3553
14 Ga0055529_1009397 3300003763 Bacteria 1284
15 JGI25405J52794_10016871 3300003911 Bacteria 1445
16 Ga0065704_10093664 3300005289 Bacteria 2584
17 Ga0065712_10078399 3300005290 Bacteria 3350
18 Ga0065715_10089022 3300005293 Bacteria 16633
19 Ga0070676_10002898 3300005328 Bacteria 8857
20 Ga0070683_100001166 3300005329 Bacteria 19905
21 Ga0070690_100229444 3300005330 Bacteria 1305
22 Ga0070670_100003635 3300005331 Bacteria 12843
23 Ga0070677_10000126 3300005333 Bacteria 25482
24 Ga0068869_100009659 3300005334 Bacteria 6264
25 Ga0070666_10018143 3300005335 Bacteria 4520
26 Ga0070680_100013378 3300005336 Bacteria 6389
27 Ga0070680_100153986 3300005336 Bacteria 1931
28 Ga0070682_100003724 3300005337 Bacteria 8473
29 Ga0070682_100100059 3300005337 Bacteria 1912
30 Ga0068868_100003027 3300005338 Bacteria 11693
31 Ga0070660_100010060 3300005339 Bacteria 6672
32 Ga0070660_100051659 3300005339 Bacteria 3166
33 Ga0070660_100164105 3300005339 Bacteria 1791
34 Ga0070689_100003384 3300005340 Bacteria 10600
35 Ga0070689_100018800 3300005340 Bacteria 5099
36 Ga0070691_10000994 3300005341 Bacteria 11602
37 Ga0070687_100000085 3300005343 Bacteria 30647
38 Ga0070661_100000307 3300005344 Bacteria 39479
39 Ga0070692_10002518 3300005345 Bacteria 7129
40 Ga0070692_10029229 3300005345 Bacteria 2745
41 Ga0070668_100001248 3300005347 Bacteria 18134
42 Ga0070669_100005868 3300005353 Bacteria 8857
43 Ga0070675_100024482 3300005354 Bacteria 4834
44 Ga0070675_100110171 3300005354 Bacteria 2328
45 Ga0070671_100009899 3300005355 Bacteria 7656
46 Ga0070674_100003469 3300005356 Bacteria 8857
47 Ga0070673_100000152 3300005364 Bacteria 33183
48 Ga0070688_100000558 3300005365 Bacteria 18862
49 Ga0070659_100010268 3300005366 Bacteria 6888
50 Ga0070659_100174159 3300005366 Bacteria 1764
51 Ga0070667_100005640 3300005367 Bacteria 10453
52 Ga0070667_100071738 3300005367 Bacteria 2950
53 Ga0070709_10005546 3300005434 Bacteria 6830
54 Ga0070714_100009084 3300005435 Bacteria 7794
55 Ga0070713_100006662 3300005436 Bacteria 8035
56 Ga0070713_100191199 3300005436 Bacteria 1844
57 Ga0070710_10001257 3300005437 Bacteria 12039
58 Ga0070710_10101024 3300005437 Bacteria 1718
59 Ga0070701_10006397 3300005438 Bacteria 4954
60 Ga0070701_10138846 3300005438 Bacteria 1388
61 Ga0070711_100045845 3300005439 Bacteria 2976
62 Ga0070711_100079531 3300005439 Bacteria 2332
63 Ga0070711_100144734 3300005439 Bacteria 1786
64 Ga0070705_100005321 3300005440 Bacteria 6264
65 Ga0070700_100002863 3300005441 Bacteria 8853
66 Ga0070700_100098089 3300005441 Bacteria 1926
67 Ga0070694_100001507 3300005444 Bacteria 13661
68 Ga0070694_100158080 3300005444 Bacteria 1661
69 Ga0070708_100167806 3300005445 Bacteria 2048
70 Ga0070663_100000522 3300005455 Bacteria 20244
71 Ga0070663_100141534 3300005455 Bacteria 1837
72 Ga0070678_100040107 3300005456 Bacteria 3310
73 Ga0070662_100001666 3300005457 Bacteria 13661
74 Ga0070681_10017661 3300005458 Bacteria 7129
75 Ga0068867_100005662 3300005459 Bacteria 8853
76 Ga0070685_10006948 3300005466 Bacteria 5775
77 Ga0070699_100174889 3300005518 Bacteria 1903
78 Ga0070679_100007489 3300005530 Bacteria 10209
79 Ga0070679_100154571 3300005530 Bacteria 2269
80 Ga0070679_100194254 3300005530 Bacteria 1997
81 Ga0070684_100000894 3300005535 Bacteria 21105
82 Ga0070697_100000168 3300005536 Bacteria 52931
83 Ga0068853_100010158 3300005539 Bacteria 7605
84 Ga0070672_100011122 3300005543 Bacteria 6268
85 Ga0070686_100016131 3300005544 Bacteria 4341
86 Ga0070686_100130355 3300005544 Bacteria 1738
87 Ga0070695_100031469 3300005545 Bacteria 3310
88 Ga0070695_100111168 3300005545 Bacteria 1859
89 Ga0070696_100005009 3300005546 Bacteria 8853
90 Ga0070696_100020495 3300005546 Bacteria 4479
91 Ga0070693_100000134 3300005547 Bacteria 33408
92 Ga0070665_100059697 3300005548 Bacteria 3823
93 Ga0070704_100000428 3300005549 Bacteria 19609
94 Ga0068855_100007545 3300005563 Bacteria 13158
95 Ga0068855_100010956 3300005563 Bacteria 10939
96 Ga0070664_100026882 3300005564 Bacteria 4779
97 Ga0068857_100011473 3300005577 Bacteria 7708
98 Ga0068854_100005312 3300005578 Bacteria 8130
99 Ga0068856_100021406 3300005614 Bacteria 6286
100 Ga0068856_100114383 3300005614 Bacteria 2697
101 Ga0068856_100201154 3300005614 Bacteria 2006
102 Ga0070702_100000638 3300005615 Bacteria 12987
103 Ga0068852_100002115 3300005616 Bacteria 13595
104 Ga0068852_100004876 3300005616 Bacteria 9529
105 Ga0068859_100006242 3300005617 Bacteria 12100
106 Ga0068864_100028055 3300005618 Bacteria 4757
107 Ga0068866_10000301 3300005718 Bacteria 23583
108 Ga0068861_100057538 3300005719 Bacteria 2970
109 Ga0068861_100262545 3300005719 Bacteria 1479
110 Ga0068870_10000354 3300005840 Bacteria 17200
111 Ga0068863_100000340 3300005841 Bacteria 47641
112 Ga0068858_100009915 3300005842 Bacteria 9049
113 Ga0068858_100267039 3300005842 Bacteria 1627
114 Ga0068860_100013035 3300005843 Bacteria 8161
115 Ga0068862_100015630 3300005844 Bacteria 6304
116 Ga0068862_100227314 3300005844 Bacteria 1691
117 Ga0081455_10000982 3300005937 Bacteria 36310
118 Ga0081455_10081734 3300005937 Bacteria 2645
119 Ga0081538_10040168 3300005981 Bacteria 2988
120 Ga0081538_10041578 3300005981 Bacteria 2915
121 Ga0081540_1002120 3300005983 Bacteria 16520
122 Ga0081540_1032154 3300005983 Bacteria 2870
123 Ga0081539_10000140 3300005985 Bacteria 166746
124 Ga0070717_10008461 3300006028 Bacteria 7687
125 Ga0070717_10316573 3300006028 Bacteria 1389
126 Ga0070717_10343363 3300006028 Bacteria 1334
127 Ga0075365_10048318 3300006038 Bacteria 2800
128 Ga0075365_10150789 3300006038 Bacteria 1617
129 Ga0075365_10213019 3300006038 Bacteria 1355
130 Ga0075363_100005844 3300006048 Bacteria 5531
131 Ga0075364_10002167 3300006051 Bacteria 11001
132 Ga0075364_10021617 3300006051 Bacteria 4055
133 Ga0075364_10065465 3300006051 Bacteria 2386
134 Ga0075364_10175131 3300006051 Bacteria 1451
135 Ga0070715_10000384 3300006163 Bacteria 11062
136 Ga0070712_100000213 3300006175 Bacteria 32735
137 Ga0070712_100084293 3300006175 Bacteria 2310
138 Ga0070712_100271797 3300006175 Bacteria 1362
139 Ga0075362_10015262 3300006177 Bacteria 3120
140 Ga0075367_10012900 3300006178 Bacteria 4476
141 Ga0075367_10019691 3300006178 Bacteria 3746
142 Ga0075369_10008188 3300006186 Bacteria 4013
143 Ga0075369_10016682 3300006186 Bacteria 2967
144 Ga0075369_10064502 3300006186 Bacteria 1604
145 Ga0075366_10016883 3300006195 Bacteria 4195
146 Ga0097621_100000040 3300006237 Bacteria 66339
147 Ga0075370_10009628 3300006353 Bacteria 5027
148 Ga0075370_10048586 3300006353 Bacteria 2404
149 Ga0068871_100000301 3300006358 Bacteria 34368
150 Ga0075428_100003180 3300006844 Bacteria 17952
151 Ga0075428_100103893 3300006844 Bacteria 3098
152 Ga0075430_100000201 3300006846 Bacteria 40551
153 Ga0075431_100000260 3300006847 Bacteria 40551
154 Ga0075431_100014864 3300006847 Bacteria 7880
155 Ga0075433_10000007 3300006852 Bacteria 75995
156 Ga0075433_10009124 3300006852 Bacteria 7919
157 Ga0075434_100000091 3300006871 Bacteria 49489
158 Ga0075434_100017859 3300006871 Bacteria 6843
159 Ga0075434_100104601 3300006871 Bacteria 2840
160 Ga0075429_100001824 3300006880 Bacteria 17627
161 Ga0068865_100000275 3300006881 Bacteria 28270
162 Ga0075436_100000192 3300006914 Bacteria 37698
163 Ga0097620_100006242 3300006931 Bacteria 12100
164 Ga0075435_100010439 3300007076 Bacteria 6794
165 Ga0075435_100366660 3300007076 Bacteria 1236
166 Ga0099794_10096984 3300007265 Bacteria 1468
167 Ga0105240_10002078 3300009093 Bacteria 32819
168 Ga0105240_10070766 3300009093 Bacteria 4314
169 Ga0111539_10013469 3300009094 Bacteria 10221
170 Ga0111539_10425447 3300009094 Bacteria 1547
171 Ga0105245_10010701 3300009098 Bacteria 7981
172 Ga0105245_10056957 3300009098 Bacteria 3514
173 Ga0105245_10140599 3300009098 Bacteria 2273
174 Ga0105247_10018307 3300009101 Bacteria 4203
175 Ga0114129_10002772 3300009147 Bacteria 24406
176 Ga0105243_10004388 3300009148 Bacteria 11162
177 Ga0105241_10001943 3300009174 Bacteria 15638
178 Ga0105241_10016563 3300009174 Bacteria 5407
179 Ga0105241_10372184 3300009174 Bacteria 1246
180 Ga0105242_10007706 3300009176 Bacteria 8285
181 Ga0105242_10019682 3300009176 Bacteria 5290
182 Ga0105248_10003102 3300009177 Bacteria 18407
183 Ga0105248_10043504 3300009177 Bacteria 5035
184 Ga0105248_10069324 3300009177 Bacteria 3959
185 Ga0105237_10015521 3300009545 Bacteria 7925
186 Ga0105237_10054424 3300009545 Bacteria 4009
187 Ga0105238_10052558 3300009551 Bacteria 4096
188 Ga0105238_10268966 3300009551 Bacteria 1685
189 Ga0105249_10001599 3300009553 Bacteria 19830
190 Ga0105239_10009271 3300010375 Bacteria 11127
191 Ga0105239_10009752 3300010375 Bacteria 10796
192 Ga0105239_10095136 3300010375 Bacteria 3291
193 Ga0105239_10288768 3300010375 Bacteria 1847
194 Ga0105246_10007217 3300011119 Bacteria 6810
195 Ga0105246_10058939 3300011119 Bacteria 2662
196 Ga0157323_1000404 3300012495 Bacteria 1898
197 Ga0157342_1004325 3300012507 Bacteria 1257
198 Ga0157371_10010606 3300013102 Bacteria 7160
199 Ga0157370_10078491 3300013104 Bacteria 3109
200 Ga0157374_10001695 3300013296 Bacteria 18451
201 Ga0157378_10003374 3300013297 Bacteria 14202
202 Ga0157378_10069939 3300013297 Bacteria 3150
203 Ga0157378_10128094 3300013297 Bacteria 2347
204 Ga0157378_10163081 3300013297 Bacteria 2086
205 Ga0163162_10010828 3300013306 Bacteria 8874
206 Ga0157372_10004321 3300013307 Bacteria 15190
207 Ga0157372_10148826 3300013307 Bacteria 2701
208 Ga0157372_10580702 3300013307 Bacteria 1306
209 Ga0157375_10008254 3300013308 Bacteria 9115
210 Ga0163163_10002228 3300014325 Bacteria 16316
211 Ga0163163_10013922 3300014325 Bacteria 7379
212 Ga0157380_10000891 3300014326 Bacteria 18753
213 Ga0157380_10461852 3300014326 Bacteria 1222
214 Ga0157377_10000517 3300014745 Bacteria 16366
215 Ga0157379_10011995 3300014968 Bacteria 7571
216 Ga0157379_10068978 3300014968 Bacteria 3161
217 Ga0157376_10000088 3300014969 Bacteria 70084
218 Ga0157376_10111465 3300014969 Bacteria 2409
219 Ga0163161_10000144 3300017792 Bacteria 64771
220 Ga0214544_1000002 3300021320 Bacteria 753857
221 Ga0214542_1000001 3300021321 Bacteria 1018696
222 Ga0214545_1000001 3300021324 Bacteria 1092817
223 Ga0214543_1000001 3300021327 Bacteria 776921
224 Ga0213876_10025508 3300021384 Bacteria 3117
225 Ga0213876_10074468 3300021384 Bacteria 1793
226 Ga0213875_10000023 3300021388 Bacteria 213455
227 Ga0209677_103988 3300025253 Bacteria 4473
228 Ga0209148_1000841 3300025254 Bacteria 21793
229 Ga0209233_1025604 3300025261 Bacteria 1456
230 Ga0207666_1000059 3300025271 Bacteria 19909
231 Ga0207666_1002359 3300025271 Bacteria 2271
232 Ga0209455_1003926 3300025272 Bacteria 5064
233 Ga0207673_1000330 3300025290 Bacteria 4761
234 Ga0209564_1009425 3300025295 Bacteria 4648
235 Ga0209758_1003241 3300025297 Bacteria 15100
236 Ga0207426_1002280 3300025302 Bacteria 12650
237 Ga0207697_10005773 3300025315 Bacteria 5706
238 Ga0207653_10002470 3300025885 Bacteria 5874
239 Ga0207682_10000509 3300025893 Bacteria 17874
240 Ga0207692_10000214 3300025898 Bacteria 19493
241 Ga0207642_10006243 3300025899 Bacteria 3952
242 Ga0207710_10006153 3300025900 Bacteria 5135
243 Ga0207688_10000167 3300025901 Bacteria 28809
244 Ga0207680_10042799 3300025903 Bacteria 2652
245 Ga0207680_10106766 3300025903 Bacteria 1809
246 Ga0207647_10006799 3300025904 Bacteria 8296
247 Ga0207685_10012312 3300025905 Bacteria 2606
248 Ga0207699_10015419 3300025906 Bacteria 3969
249 Ga0207645_10000100 3300025907 Bacteria 64057
250 Ga0207645_10071803 3300025907 Bacteria 2216
251 Ga0207643_10000007 3300025908 Bacteria 171706
252 Ga0207705_10018696 3300025909 Bacteria 4958
253 Ga0207705_10120672 3300025909 Bacteria 1945
254 Ga0207654_10053478 3300025911 Bacteria 2331
255 Ga0207707_10005018 3300025912 Bacteria 11624
256 Ga0207707_10013921 3300025912 Bacteria 7014
257 Ga0207707_10398898 3300025912 Bacteria 1181
258 Ga0207695_10000910 3300025913 Bacteria 53286
259 Ga0207671_10002587 3300025914 Bacteria 19123
260 Ga0207671_10097263 3300025914 Bacteria 2225
261 Ga0207693_10000888 3300025915 Bacteria 26823
262 Ga0207693_10026683 3300025915 Bacteria 4570
263 Ga0207693_10244667 3300025915 Bacteria 1408
264 Ga0207663_10000628 3300025916 Bacteria 15643
265 Ga0207663_10109900 3300025916 Bacteria 1869
266 Ga0207660_10000041 3300025917 Bacteria 63485
267 Ga0207662_10000195 3300025918 Bacteria 28315
268 Ga0207657_10002386 3300025919 Bacteria 20326
269 Ga0207657_10009921 3300025919 Bacteria 9530
270 Ga0207657_10027937 3300025919 Bacteria 5157
271 Ga0207649_10001482 3300025920 Bacteria 13783
272 Ga0207652_10002995 3300025921 Bacteria 14105
273 Ga0207652_10022353 3300025921 Bacteria 5231
274 Ga0207681_10001546 3300025923 Bacteria 14821
275 Ga0207694_10030806 3300025924 Bacteria 4095
276 Ga0207694_10171704 3300025924 Bacteria 1756
277 Ga0207650_10001317 3300025925 Bacteria 17984
278 Ga0207659_10003760 3300025926 Bacteria 9152
279 Ga0207687_10000072 3300025927 Bacteria 76222
280 Ga0207687_10032877 3300025927 Bacteria 3516
281 Ga0207700_10006989 3300025928 Bacteria 6868
282 Ga0207644_10001292 3300025931 Bacteria 16118
283 Ga0207644_10044109 3300025931 Bacteria 3167
284 Ga0207690_10004975 3300025932 Bacteria 7849
285 Ga0207706_10010659 3300025933 Bacteria 8395
286 Ga0207706_10123401 3300025933 Bacteria 2278
287 Ga0207686_10001034 3300025934 Bacteria 16473
288 Ga0207686_10096001 3300025934 Bacteria 1968
289 Ga0207709_10001423 3300025935 Bacteria 16760
290 Ga0207670_10007269 3300025936 Bacteria 6170
291 Ga0207669_10000176 3300025937 Bacteria 29979
292 Ga0207704_10013299 3300025938 Bacteria 4114
293 Ga0207665_10001305 3300025939 Bacteria 16794
294 Ga0207691_10008719 3300025940 Bacteria 9727
295 Ga0207711_10001106 3300025941 Bacteria 25759
296 Ga0207711_10054504 3300025941 Bacteria 3432
297 Ga0207689_10000366 3300025942 Bacteria 42711
298 Ga0207689_10037239 3300025942 Bacteria 4035
299 Ga0207689_10266200 3300025942 Bacteria 1418
300 Ga0207661_10000087 3300025944 Bacteria 63263
301 Ga0207679_10000029 3300025945 Bacteria 183002
302 Ga0207679_10339267 3300025945 Bacteria 1306
303 Ga0207667_10009257 3300025949 Bacteria 11628
304 Ga0207667_10186996 3300025949 Bacteria 2126
305 Ga0207651_10001426 3300025960 Bacteria 10879
306 Ga0207712_10001547 3300025961 Bacteria 15511
307 Ga0207712_10140029 3300025961 Bacteria 1855
308 Ga0207668_10007326 3300025972 Bacteria 6556
309 Ga0207640_10001474 3300025981 Bacteria 12692
310 Ga0207640_10288556 3300025981 Bacteria 1293
311 Ga0207640_10378418 3300025981 Bacteria 1146
312 Ga0207658_10005146 3300025986 Bacteria 9004
313 Ga0207703_10003109 3300026035 Bacteria 14015
314 Ga0207703_10117473 3300026035 Bacteria 2279
315 Ga0207639_10009108 3300026041 Bacteria 6840
316 Ga0207678_10007393 3300026067 Bacteria 9727
317 Ga0207678_10039128 3300026067 Bacteria 4116
318 Ga0207678_10077913 3300026067 Bacteria 2839
319 Ga0207708_10007017 3300026075 Bacteria 8325
320 Ga0207708_10012400 3300026075 Bacteria 6353
321 Ga0207708_10088527 3300026075 Bacteria 2385
322 Ga0207702_10015638 3300026078 Bacteria 6281
323 Ga0207702_10056447 3300026078 Bacteria 3334
324 Ga0207702_10348794 3300026078 Bacteria 1416
325 Ga0207641_10011956 3300026088 Bacteria 7121
326 Ga0207648_10008796 3300026089 Bacteria 9727
327 Ga0207676_10004807 3300026095 Bacteria 9584
328 Ga0207674_10000697 3300026116 Bacteria 43729
329 Ga0207674_10116666 3300026116 Bacteria 2640
330 Ga0207675_100005465 3300026118 Bacteria 12176
331 Ga0207675_100220039 3300026118 Bacteria 1829
332 Ga0207683_10000029 3300026121 Bacteria 109665
333 Ga0207683_10312162 3300026121 Bacteria 1439
334 Ga0207698_10018865 3300026142 Bacteria 4711
335 Ga0210002_1001959 3300027617 Bacteria 2956
336 Ga0209971_1003527 3300027682 Bacteria 3701
337 Ga0209966_1001374 3300027695 Bacteria 4257
338 Ga0209966_1003142 3300027695 Bacteria 2771
339 Ga0209998_10001898 3300027717 Bacteria 4926
340 Ga0209998_10005560 3300027717 Bacteria 2635
341 Ga0209974_10002097 3300027876 Bacteria 7300
342 Ga0207428_10000100 3300027907 Bacteria 119495
343 Ga0207428_10000115 3300027907 Bacteria 109072
344 Ga0268266_10040823 3300028379 Bacteria 3956
345 Ga0268265_10024411 3300028380 Bacteria 4276
346 Ga0268264_10002968 3300028381 Bacteria 14738
347 Ga0265337_1000769 3300028556 Bacteria 16920
348 Ga0307515_10056876 3300028794 Bacteria 5673
349 Ga0265330_10004928 3300031235 Bacteria 6724
350 Ga0265340_10000710 3300031247 Bacteria 18813
351 Ga0265340_10022433 3300031247 Bacteria 3227
352 Ga0265331_10017934 3300031250 Bacteria 3680
353 Ga0265327_10045767 3300031251 Bacteria 2323
354 Ga0265327_10056759 3300031251 Bacteria 2016
355 Ga0265316_10107017 3300031344 Bacteria 2121
356 Ga0265313_10049108 3300031595 Bacteria 2032
357 Ga0265313_10056004 3300031595 Bacteria 1866
358 Ga0265314_10098001 3300031711 Bacteria 1892
359 Ga0265342_10000282 3300031712 Bacteria 57360
360 Ga0265342_10000896 3300031712 Bacteria 29642
361 Ga0265342_10045235 3300031712 Bacteria 2650
362 Ga0265342_10080137 3300031712 Bacteria 1887
363 Ga0307412_10102600 3300031911 Bacteria 2026
364 Ga0307412_10113062 3300031911 Bacteria 1942
365 Ga0307510_10138309 3300033180 Bacteria 2087
366 Ga0373950_0002702 3300034818 Bacteria 2466
367 Ga0373958_0000857 3300034819 Bacteria 3912
368 Ga0373959_0003668 3300034820 Bacteria 2456
369 Ga0373938_0003291 3300034957 Bacteria 2638
370 Ga0373926_0002200 3300035083 Bacteria 6148
371 Ga0373928_0003507 3300035084 Bacteria 2988
372 Ga0373929_0008065 3300035085 Bacteria 1937
373 Ga0373934_0021851 3300035086 Bacteria 2467
374 Ga0373940_0003500 3300035088 Bacteria 3212
375 Ga0373949_0001408 3300035090 Bacteria 6875
376 Ga0373951_0003300 3300035091 Bacteria 3944
377 Ga0373952_0001605 3300035092 Bacteria 4113
378 Ga0373952_0003186 3300035092 Bacteria 2958
379 Ga0373939_0001446 3300035114 Bacteria 5745
380 Ga0373939_0021303 3300035114 Bacteria 1772
381 Ga0373941_0001746 3300035115 Bacteria 4669
382 Ga0373941_0068491 3300035115 Bacteria 1172
383 Ga0373945_0055567 3300035116 Bacteria 1466
384 Ga0373953_0005709 3300035117 Bacteria 4057
385 Ga0373954_0002351 3300035118 Bacteria 7904
386 Ga0373956_0006571 3300035119 Bacteria 4660
387 Ga0373960_0001089 3300035121 Bacteria 5876
388 Ga0373946_0005396 3300035171 Bacteria 4609
389 Ga0373946_0083690 3300035171 Bacteria 1401
390 Ga0373946_0125416 3300035171 Bacteria 1176
391 Ga0373955_0000424 3300035172 Bacteria 17800
392 Ga0373942_0010868 3300035207 Bacteria 2148
393 Ga0373961_0001706 3300035241 Bacteria 6116
394 Ga0373962_0006210 3300035242 Bacteria 2890
395 Ga0373931_0001534 3300035691 Bacteria 9955
396 Ga0373931_0044761 3300035691 Bacteria 2335
397 Ga0373935_0006416 3300035692 Bacteria 7020
398 Ga0373935_0053663 3300035692 Bacteria 2564
399 Ga0373927_0013197 3300035695 Bacteria 5494
400 Ga0373933_0001949 3300035724 Bacteria 11918
401 Ga0373947_0001014 3300035725 Bacteria 17141
402 Ga0373937_0001798 3300036401 Bacteria 18015
403 Ga0373925_0001514 3300037068 Bacteria 19868
404 Ga0373925_0010893 3300037068 Bacteria 6596
405 Ga0395899_0214599 3300037312 Bacteria 1336
406 Ga0395900_0126781 3300037418 Bacteria 2618
407 Ga0395898_0177413 3300037466 Bacteria 2036
408 Ga0395905_0095032 3300037471 Bacteria 2797
409 Ga0436364_1416054 3300037853 Bacteria 38310
410 Ga0395901_0044035 3300038443 Bacteria 4629
411 Ga0436365_0088563 3300039437 Bacteria 10412
412 Ga0436365_1273234 3300039437 Bacteria 3331
413 Ga0436365_1356220 3300039437 Bacteria 2096
414 Ga0436360_0306594 3300039438 Bacteria 1107
415 Ga0439447_005815 3300041407 Bacteria 4065
416 Ga0439448_0090805 3300042005 Bacteria 1032
417 Ga0439450_010990 3300042008 Bacteria 1760
418 Ga0450903_001354 3300042138 Bacteria 4584
419 Ga0439464_0017190 3300042439 Bacteria 1960
420 Ga0451577_0142493 3300042876 Bacteria 2154
421 Ga0466972_0000189 3300044658 Bacteria 47501
422 Ga0453683_0002436 3300044673 Bacteria 14413
423 Ga0466965_0018538 3300044683 Bacteria 3337
424 Ga0466966_0100333 3300044684 Bacteria 1790
425 Ga0466963_0013352 3300044694 Bacteria 5043
426 Ga0466963_0030438 3300044694 Bacteria 3483
427 Ga0466970_0133648 3300044765 Bacteria 1364
428 Ga0466957_0333020 3300044842 Bacteria 1026
429 Ga0466959_0030304 3300045049 Bacteria 4006
430 Ga0466959_0089806 3300045049 Bacteria 2207
431 Ga0451576_0025556 3300045051 Bacteria 6362
432 Ga0451576_0034403 3300045051 Bacteria 5382
433 Ga0451576_0184131 3300045051 Bacteria 2181
434 Ga0466967_0024787 3300045976 Bacteria 4937
435 Ga0495592_0001873 3300046454 Bacteria 14799
436 Ga0495592_0005376 3300046454 Bacteria 9453
437 Ga0495592_0091436 3300046454 Bacteria 2182
438 Ga0495603_0000847 3300046455 Bacteria 17534
439 Ga0495603_0085695 3300046455 Bacteria 1844
440 Ga0495629_0002130 3300046459 Bacteria 15353
441 Ga0495629_0052653 3300046459 Bacteria 2848
442 Ga0495638_0002166 3300046460 Bacteria 16488
443 Ga0495638_0002585 3300046460 Bacteria 14627
444 Ga0495651_0001256 3300046462 Bacteria 19642
445 Ga0495651_0270277 3300046462 Bacteria 1153
446 Ga0495653_0001017 3300046463 Bacteria 21626
447 Ga0495653_0013899 3300046463 Bacteria 6562
448 Ga0495582_0005835 3300046473 Bacteria 6858
449 Ga0495639_0033182 3300046475 Bacteria 2305
450 Ga0495662_0012227 3300046476 Bacteria 4191
451 Ga0495662_0044597 3300046476 Bacteria 2141
452 Ga0495664_0005166 3300046477 Bacteria 7163
453 Ga0495664_0009316 3300046477 Bacteria 5491
454 Ga0495664_0013950 3300046477 Bacteria 4553
455 Ga0495594_0010150 3300046499 Bacteria 4882
456 Ga0495607_0123383 3300046501 Bacteria 1357
457 Ga0495583_0070437 3300046506 Bacteria 1538
458 Ga0495606_0002520 3300046507 Bacteria 21082
459 Ga0495606_0147353 3300046507 Bacteria 1384
460 Ga0495608_0000646 3300046511 Bacteria 24033
461 Ga0495618_0000819 3300046514 Bacteria 21634
462 Ga0495618_0001132 3300046514 Bacteria 18019
463 Ga0495618_0011685 3300046514 Bacteria 5328
464 Ga0495620_0031063 3300046515 Bacteria 2451
465 Ga0495630_0005678 3300046517 Bacteria 8818
466 Ga0495630_0011250 3300046517 Bacteria 6472
467 Ga0495630_0231864 3300046517 Bacteria 1410
468 Ga0495631_0087586 3300046518 Bacteria 1341
469 Ga0495632_0113164 3300046519 Bacteria 1273
470 Ga0495637_0043145 3300046520 Bacteria 1927
471 Ga0495648_0013688 3300046524 Bacteria 5982
472 Ga0495666_0006222 3300046526 Bacteria 6010
473 Ga0495652_0011396 3300046529 Bacteria 8039
474 Ga0495665_0022103 3300046531 Bacteria 3420
475 Ga0495640_0002925 3300046533 Bacteria 13746
476 Ga0495640_0017622 3300046533 Bacteria 5317
477 Ga0495640_0144951 3300046533 Bacteria 1528
478 Ga0495587_0000770 3300046536 Bacteria 21359
479 Ga0495645_0004568 3300046543 Bacteria 9444
480 Ga0495645_0007688 3300046543 Bacteria 7499
481 Ga0495622_0059070 3300046557 Bacteria 1776
482 Ga0495622_0079394 3300046557 Bacteria 1510
483 Ga0495667_0009756 3300046559 Bacteria 6506
484 Ga0495667_0060371 3300046559 Bacteria 2487
485 Ga0495634_0003907 3300046642 Bacteria 11834
486 Ga0495634_0041891 3300046642 Bacteria 3109
487 Ga0495634_0064753 3300046642 Bacteria 2423
488 Ga0495634_0077843 3300046642 Bacteria 2173
489 Ga0495625_0062082 3300046660 Bacteria 2642
490 Ga0495635_0000812 3300046663 Bacteria 20468
491 Ga0495635_0003066 3300046663 Bacteria 11493
492 Ga0495635_0008585 3300046663 Bacteria 7132
493 Ga0495635_0076007 3300046663 Bacteria 2301
494 Ga0495661_0082361 3300046665 Bacteria 1852
495 Ga0495588_0008598 3300046674 Bacteria 4691
496 Ga0495657_0005959 3300046675 Bacteria 9575
497 Ga0495657_0197965 3300046675 Bacteria 1225
498 Ga0495599_0008486 3300046678 Bacteria 6247
499 Ga0495623_0001381 3300046679 Bacteria 16475
500 Ga0495646_0015954 3300046680 Bacteria 4767
501 Ga0495646_0018897 3300046680 Bacteria 4365
502 Ga0495647_0003781 3300046681 Bacteria 4870
503 Ga0495658_0012531 3300046683 Bacteria 4298
504 Ga0495669_0050559 3300046684 Bacteria 1864
505 Ga0495669_0053619 3300046684 Bacteria 1814
506 Ga0495613_0045613 3300046689 Bacteria 3241
507 Ga0495624_0025898 3300046690 Bacteria 3848
508 Ga0495649_0023164 3300046694 Bacteria 3469
509 Ga0495600_0009057 3300046809 Bacteria 6137
510 Ga0495581_0013701 3300047315 Bacteria 4701
511 Ga0495604_0019293 3300047317 Bacteria 5457
512 Ga0495604_0050228 3300047317 Bacteria 3238
513 Ga0495604_0116991 3300047317 Bacteria 1934
514 Ga0495674_0003170 3300047319 Bacteria 15972
515 Ga0495674_0028208 3300047319 Bacteria 5123
516 Ga0495674_0070558 3300047319 Bacteria 3018
517 Ga0495676_0008104 3300047321 Bacteria 9642
518 Ga0495676_0148786 3300047321 Bacteria 1669
519 Ga0495676_0174338 3300047321 Bacteria 1511
520 Ga0495680_0006835 3300047322 Bacteria 10539
521 Ga0495680_0066844 3300047322 Bacteria 2750
522 Ga0495680_0149845 3300047322 Bacteria 1702
523 Ga0495675_0001036 3300047444 Bacteria 16879
524 Ga0495673_0128887 3300047469 Bacteria 996
525 Ga0495684_0003187 3300047471 Bacteria 12861
526 Ga0495686_0053940 3300047472 Bacteria 2518
527 Ga0495593_0084324 3300047673 Bacteria 1640
528 Ga0495602_0001368 3300048088 Bacteria 24064
529 Ga0496100_0013020 3300048903 Bacteria 4786
530 Ga0496100_0013817 3300048903 Bacteria 4670
531 Ga0496100_0013989 3300048903 Bacteria 4646
532 Ga0496100_0032375 3300048903 Bacteria 3261
533 Ga0496100_0282258 3300048903 Bacteria 1238
534 Ga0496101_0025517 3300048904 Bacteria 4102
535 Ga0496101_0044816 3300048904 Bacteria 3166
536 Ga0496102_0080615 3300048905 Bacteria 2998
537 Ga0496102_0086626 3300048905 Bacteria 2893
538 Ga0496102_0393579 3300048905 Bacteria 1303
539 Ga0496104_0007573 3300048907 Bacteria 9608
540 Ga0496104_0020552 3300048907 Bacteria 6052
541 Ga0496104_0062099 3300048907 Bacteria 3542
542 Ga0496105_0003408 3300048908 Bacteria 11760
543 Ga0496105_0050528 3300048908 Bacteria 3434
544 Ga0496105_0061537 3300048908 Bacteria 3098
545 Ga0496105_0102107 3300048908 Bacteria 2368
546 Ga0496106_0001779 3300048909 Bacteria 16086
547 Ga0496106_0011982 3300048909 Bacteria 6398
548 Ga0496106_0014078 3300048909 Bacteria 5911
549 Ga0496107_0007359 3300048910 Bacteria 7592
550 Ga0496108_0008415 3300048911 Bacteria 8373
551 Ga0496108_0030618 3300048911 Bacteria 4459
552 Ga0496108_0230064 3300048911 Bacteria 1612
553 Ga0496109_0000488 3300048912 Bacteria 33914
554 Ga0496109_0099287 3300048912 Bacteria 2700
555 Ga0496109_0114624 3300048912 Bacteria 2507
556 Ga0496109_0134485 3300048912 Bacteria 2309
557 Ga0496109_0176780 3300048912 Bacteria 2004
558 Ga0496110_0006503 3300048913 Bacteria 9270
559 Ga0496110_0011628 3300048913 Bacteria 7216
560 Ga0496110_0049042 3300048913 Bacteria 3703
561 Ga0496110_0065261 3300048913 Bacteria 3218
562 Ga0496110_0163962 3300048913 Bacteria 2015
563 Ga0496111_0001887 3300048914 Bacteria 12400
564 Ga0496111_0057088 3300048914 Bacteria 2826
565 Ga0496111_0202114 3300048914 Bacteria 1477
566 Ga0496112_0000004 3300048915 Bacteria 553294
567 Ga0496112_0016876 3300048915 Bacteria 6850
568 Ga0496112_0034410 3300048915 Bacteria 4931
569 Ga0496112_0106733 3300048915 Bacteria 2770
570 Ga0496112_0137244 3300048915 Bacteria 2415
571 Ga0496112_0351932 3300048915 Bacteria 1415
572 Ga0496113_0022983 3300048916 Bacteria 4418
573 Ga0496113_0211452 3300048916 Bacteria 1544
574 Ga0496114_0012742 3300048917 Bacteria 6734
575 Ga0496114_0442260 3300048917 Bacteria 1151
576 Ga0496115_0015693 3300048918 Bacteria 5751
577 Ga0496115_0019198 3300048918 Bacteria 5259
578 Ga0496115_0112676 3300048918 Bacteria 2235
579 Ga0496115_0133833 3300048918 Bacteria 2044
580 Ga0496117_0130566 3300048920 Bacteria 1523
581 Ga0496118_0089002 3300048921 Bacteria 2133
582 Ga0496119_0020237 3300048922 Bacteria 4861
583 Ga0496119_0092778 3300048922 Bacteria 1712
584 Ga0496120_0035672 3300048923 Bacteria 2968
585 Ga0496121_0093522 3300048924 Bacteria 2340
586 Ga0496122_0025741 3300048925 Bacteria 5097
587 Ga0496123_0096119 3300048926 Bacteria 1740
588 Ga0496125_0009864 3300048928 Bacteria 9716
589 Ga0496125_0011221 3300048928 Bacteria 8981
590 Ga0496125_0048499 3300048928 Bacteria 3540
591 Ga0496125_0055066 3300048928 Bacteria 3244
592 Ga0496126_0128788 3300048929 Bacteria 2189
593 Ga0496126_0146150 3300048929 Bacteria 2030
594 Ga0501031_0003015 3300049568 Bacteria 10775
595 Ga0501031_0063714 3300049568 Bacteria 2401
596 Ga0501032_0000129 3300049569 Bacteria 62082
597 Ga0501032_0003564 3300049569 Bacteria 11867
598 Ga0501032_0026642 3300049569 Bacteria 3973
599 Ga0501032_0065403 3300049569 Bacteria 2432
600 Ga0501032_0229033 3300049569 Bacteria 1208
601 Ga0501033_0001179 3300049570 Bacteria 23588
602 Ga0501033_0012740 3300049570 Bacteria 6412
603 Ga0501033_0088361 3300049570 Bacteria 2267
604 Ga0501034_0000423 3300049571 Bacteria 70979
605 Ga0501034_0000503 3300049571 Bacteria 63099
606 Ga0501034_0000850 3300049571 Bacteria 45243
607 Ga0501034_0007739 3300049571 Bacteria 11422
608 Ga0501034_0009264 3300049571 Bacteria 10320
609 Ga0501034_0010273 3300049571 Bacteria 9763
610 Ga0501034_0108327 3300049571 Bacteria 2769
611 Ga0501034_0239053 3300049571 Bacteria 1763
612 Ga0501034_0309201 3300049571 Bacteria 1515
613 Ga0501034_0436204 3300049571 Bacteria 1229
614 Ga0501036_0000547 3300049572 Bacteria 26976
615 Ga0501036_0001453 3300049572 Bacteria 18220
616 Ga0501036_0013517 3300049572 Bacteria 6786
617 Ga0501036_0037643 3300049572 Bacteria 4092
618 Ga0501036_0048905 3300049572 Bacteria 3580
619 Ga0501036_0146126 3300049572 Bacteria 1994
620 Ga0501036_0430649 3300049572 Bacteria 1099
621 Ga0501037_0000106 3300049573 Bacteria 79430
622 Ga0501037_0006363 3300049573 Bacteria 8637
623 Ga0501037_0055821 3300049573 Bacteria 2887
624 Ga0501037_0171377 3300049573 Bacteria 1542
625 Ga0501037_0211733 3300049573 Bacteria 1366
626 Ga0501038_0001655 3300049574 Bacteria 20704
627 Ga0501038_0014086 3300049574 Bacteria 7284
628 Ga0501038_0042460 3300049574 Bacteria 3960
629 Ga0501038_0097648 3300049574 Bacteria 2450
630 Ga0501038_0098590 3300049574 Bacteria 2436
631 Ga0501038_0099490 3300049574 Bacteria 2424
632 Ga0501038_0533644 3300049574 Bacteria 894
633 Ga0501039_0000416 3300049575 Bacteria 30616
634 Ga0501039_0029308 3300049575 Bacteria 4239
635 Ga0501039_0148800 3300049575 Bacteria 1840
636 Ga0501039_0236608 3300049575 Bacteria 1436
637 Ga0501039_0276335 3300049575 Bacteria 1320
638 Ga0501042_0016537 3300049578 Bacteria 5066
639 Ga0501043_0003257 3300049579 Bacteria 13387
640 Ga0501043_0003673 3300049579 Bacteria 12604
641 Ga0501043_0019247 3300049579 Bacteria 5359
642 Ga0501043_0052810 3300049579 Bacteria 3192
643 Ga0501043_0098914 3300049579 Bacteria 2293
644 Ga0501043_0103504 3300049579 Bacteria 2237
645 Ga0501043_0244490 3300049579 Bacteria 1383
646 Ga0501046_0000235 3300049580 Bacteria 57005
647 Ga0501047_0000455 3300049581 Bacteria 45200
648 Ga0501047_0000844 3300049581 Bacteria 31650
649 Ga0501047_0006341 3300049581 Bacteria 11123
650 Ga0501047_0065540 3300049581 Bacteria 3501
651 Ga0501047_0152258 3300049581 Bacteria 2188
652 Ga0501048_0001444 3300049582 Bacteria 18038
653 Ga0501048_0085873 3300049582 Bacteria 2219
654 Ga0501067_0000160 3300049583 Bacteria 37883
655 Ga0501068_0000014 3300049584 Bacteria 62762
656 Ga0501068_0056764 3300049584 Bacteria 2373
657 Ga0501069_0004593 3300049585 Bacteria 7142
658 Ga0501069_0022997 3300049585 Bacteria 3394
659 Ga0501070_0009287 3300049586 Bacteria 8316
660 Ga0501070_0014286 3300049586 Bacteria 6682
661 Ga0501070_0034852 3300049586 Bacteria 4206
662 Ga0501070_0123779 3300049586 Bacteria 2137
663 Ga0501070_0184054 3300049586 Bacteria 1718
664 Ga0501070_0201889 3300049586 Bacteria 1633
665 Ga0501070_0295368 3300049586 Bacteria 1320
666 Ga0501071_0082888 3300049587 Bacteria 2349
667 Ga0501072_0001159 3300049588 Bacteria 19618
668 Ga0501072_0022832 3300049588 Bacteria 4855
669 Ga0501072_0125982 3300049588 Bacteria 2041
670 Ga0501073_0000417 3300049589 Bacteria 29149
671 Ga0501073_0147202 3300049589 Bacteria 1632
672 Ga0501073_0191646 3300049589 Bacteria 1414
673 Ga0501073_0236514 3300049589 Bacteria 1262
674 Ga0501074_0001839 3300049590 Bacteria 14545
675 Ga0501074_0010853 3300049590 Bacteria 6616
676 Ga0501074_0304748 3300049590 Bacteria 1131
677 Ga0501075_0289053 3300049591 Bacteria 1249
678 Ga0501075_0414835 3300049591 Bacteria 1027
679 Ga0501076_0046191 3300049592 Bacteria 3440
680 Ga0501079_0000261 3300049741 Bacteria 32317
681 Ga0501079_0104345 3300049741 Bacteria 2199
682 Ga0501079_0250509 3300049741 Bacteria 1384
683 Ga0501079_0257297 3300049741 Bacteria 1364
684 Ga0501080_0000917 3300049742 Bacteria 24141
685 Ga0501080_0001026 3300049742 Bacteria 22970
686 Ga0501080_0029381 3300049742 Bacteria 5117
687 Ga0501080_0058440 3300049742 Bacteria 3590
688 Ga0501080_0172405 3300049742 Bacteria 1995
689 Ga0501080_0177694 3300049742 Bacteria 1961
690 Ga0501080_0279637 3300049742 Bacteria 1517
691 Ga0501081_0114042 3300049743 Bacteria 1920
692 Ga0501081_0173404 3300049743 Bacteria 1558
693 Ga0501083_0000301 3300049744 Bacteria 31182
694 Ga0501083_0034723 3300049744 Bacteria 3447
695 Ga0501083_0125638 3300049744 Bacteria 1681
696 Ga0501035_0000324 3300049822 Bacteria 55297
697 Ga0501035_0010664 3300049822 Bacteria 8509
698 Ga0501035_0012093 3300049822 Bacteria 7979
699 Ga0501035_0046533 3300049822 Bacteria 3902
700 Ga0501035_0047850 3300049822 Bacteria 3837
701 Ga0501035_0062674 3300049822 Bacteria 3308
702 Ga0501044_0000051 3300049823 Bacteria 143658
703 Ga0501044_0000084 3300049823 Bacteria 114544
704 Ga0501044_0008033 3300049823 Bacteria 11591
705 Ga0501044_0048481 3300049823 Bacteria 4387
706 Ga0501044_0095098 3300049823 Bacteria 3003
707 Ga0501044_0103933 3300049823 Bacteria 2855
708 Ga0501044_0171505 3300049823 Bacteria 2141
709 Ga0501045_0173779 3300049824 Bacteria 1605
710 nmdc:mga03683_10919_c2 3300050489 Bacteria 2958
711 nmdc:mga03n38_32700_c1 3300050490 Bacteria 2206
712 nmdc:mga00v17_117160_c1 3300050491 Bacteria 1694
713 nmdc:mga00v17_263642_c1 3300050491 Bacteria 1118
714 nmdc:mga00v17_48740_c1 3300050491 Bacteria 2568
715 nmdc:mga0yw44_107288_c1 3300050492 Bacteria 1786
716 nmdc:mga0yw44_163388_c1 3300050492 Bacteria 1459
717 nmdc:mga0yw44_315190_c1 3300050492 Bacteria 1050
718 nmdc:mga0k408_41530_c1 3300050493 Bacteria 2648
719 nmdc:mga06z11_58287_c1 3300050494 Bacteria 2003
720 nmdc:mga06z11_6052_c1 3300050494 Bacteria 4894
721 nmdc:mga07m45_60952_c1 3300050496 Bacteria 2136
722 nmdc:mga05p37_159771_c1 3300050507 Bacteria 2753
723 nmdc:mga05p37_2742_c1 3300050507 Bacteria 20456
724 nmdc:mga05p37_314549_c1 3300050507 Bacteria 1855
725 nmdc:mga05p37_505_c1 3300050507 Bacteria 42970
726 nmdc:mga09592_179408_c1 3300050508 Bacteria 1832
727 nmdc:mga09592_772_c1 3300050508 Bacteria 24711
728 nmdc:mga0qj67_165_c1 3300050509 Bacteria 44307
729 nmdc:mga06r32_182481_c1 3300050510 Bacteria 2084
730 nmdc:mga06r32_513_c1 3300050510 Bacteria 33328
731 nmdc:mga06r32_73287_c1 3300050510 Bacteria 3317
732 nmdc:mga08y16_2844_c1 3300050511 Bacteria 17794
733 nmdc:mga08y16_35524_c1 3300050511 Bacteria 5234
734 nmdc:mga08y16_89962_c1 3300050511 Bacteria 3199
735 nmdc:mga0n895_143382_c1 3300050512 Bacteria 2418
736 nmdc:mga0n895_20210_c1 3300050512 Bacteria 6205
737 nmdc:mga0n895_3322_c1 3300050512 Bacteria 12929
738 nmdc:mga0rr50_1278_c1 3300050513 Bacteria 13714
739 nmdc:mga0rr50_242490_c1 3300050513 Bacteria 1494
740 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
741 nmdc:mga0a205_1632_c1 3300050515 Bacteria 19295
742 nmdc:mga0a205_26496_c1 3300050515 Bacteria 5530
743 nmdc:mga0a205_6515_c2 3300050515 Bacteria 10082
744 nmdc:mga0sz30_26045_c1 3300050516 Bacteria 2395
745 nmdc:mga0sz30_5969_c1 3300050516 Bacteria 4494
746 nmdc:mga0sz30_60142_c1 3300050516 Bacteria 1622
747 Ga0495601_0004046 3300053077 Bacteria 8451
748 Ga0495601_0004638 3300053077 Bacteria 7956
749 Ga0495601_0007149 3300053077 Bacteria 6544
750 Ga0495612_0000523 3300053078 Bacteria 15440
751 Ga0495612_0012825 3300053078 Bacteria 3378
752 Ga0495612_0019874 3300053078 Bacteria 2691
753 Ga0500635_0019866 3300053080 Bacteria 2049
754 Ga0495595_0000253 3300053084 Bacteria 21240
755 Ga0495595_0094291 3300053084 Bacteria 1439
756 Ga0495595_0154729 3300053084 Bacteria 1129
757 Ga0495619_0003655 3300053085 Bacteria 9912
758 Ga0495619_0027382 3300053085 Bacteria 3670
759 Ga0495619_0096702 3300053085 Bacteria 2005
760 Ga0495619_0144309 3300053085 Bacteria 1640
761 Ga0495619_0148649 3300053085 Bacteria 1615
762 Ga0495619_0203344 3300053085 Bacteria 1371
763 Ga0495619_0234801 3300053085 Bacteria 1271
764 Ga0500643_010551 3300053087 Bacteria 3426
765 Ga0500581_066267 3300053089 Bacteria 1823
766 Ga0500651_0012814 3300053093 Bacteria 5089
767 Ga0500651_0204075 3300053093 Bacteria 1165
768 Ga0500566_0004691 3300053094 Bacteria 8134
769 Ga0500566_0005587 3300053094 Bacteria 7469
770 Ga0500566_0083560 3300053094 Bacteria 1773
771 Ga0500641_0006277 3300053096 Bacteria 4217
772 Ga0500554_001532 3300053102 Bacteria 4463
773 Ga0500556_0000004 3300053104 Bacteria 666287
774 Ga0500562_052297 3300053108 Bacteria 1093
775 Ga0500569_018758 3300053109 Bacteria 1791
776 Ga0500572_013643 3300053111 Bacteria 2015
777 Ga0500595_000002 3300053119 Bacteria 1074388
778 Ga0500607_025574 3300053121 Bacteria 3284
779 Ga0500608_001229 3300053122 Bacteria 9146
780 Ga0500608_003410 3300053122 Bacteria 5953
781 Ga0500608_022074 3300053122 Bacteria 2948
782 Ga0500618_032142 3300053125 Bacteria 1229
783 Ga0500642_0000186 3300053130 Bacteria 25633
784 Ga0500652_036517 3300053131 Bacteria 1956
785 Ga0500658_0023977 3300053134 Bacteria 2335
786 Ga0500658_0039451 3300053134 Bacteria 1887
787 Ga0500559_0000067 3300053136 Bacteria 83330
788 Ga0500559_0006042 3300053136 Bacteria 5493
789 Ga0500559_0021198 3300053136 Bacteria 2752
790 Ga0500559_0025764 3300053136 Bacteria 2503
791 Ga0500559_0066766 3300053136 Bacteria 1614
792 Ga0500564_035305 3300053138 Bacteria 2307
793 Ga0500568_0001430 3300053139 Bacteria 15482
794 Ga0500568_0024932 3300053139 Bacteria 2528
795 Ga0500586_004477 3300053145 Bacteria 3428
796 Ga0500603_038681 3300053150 Bacteria 1263
797 Ga0500616_0000014 3300053153 Bacteria 637918
798 Ga0500616_0047881 3300053153 Bacteria 2268
799 Ga0500619_001901 3300053154 Bacteria 3866
800 Ga0500622_0000513 3300053156 Bacteria 35999
801 Ga0500624_019353 3300053157 Bacteria 1081
802 Ga0500638_102521 3300053162 Bacteria 1332
803 Ga0500636_0000122 3300053177 Bacteria 40577
804 Ga0500637_0021257 3300053178 Bacteria 3523
805 Ga0501084_0014689 3300054114 Bacteria 6493
806 Ga0501084_0046552 3300054114 Bacteria 3634
807 Ga0501084_0232677 3300054114 Bacteria 1555
808 Ga0501082_0000106 3300060353 Bacteria 65983
809 Ga0501082_0018584 3300060353 Bacteria 5991
810 Ga0501082_0147642 3300060353 Bacteria 2042
811 Ga0501082_0200117 3300060353 Bacteria 1738
812 Ga0501082_0235717 3300060353 Bacteria 1592
813 Ga0530510_0389420 3300061734 Bacteria 1050

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0430649 Ga0501036_0430649_20_910 264
2 3300049744 Ga0501083_0125638 Ga0501083_0125638_764_1654 264
3 3300044673 Ga0453683_0002436 Ga0453683_0002436_4469_5488 269
4 3300045051 Ga0451576_0025556 Ga0451576_0025556_3298_4317 269
5 3300045051 Ga0451576_0184131 Ga0451576_0184131_875_1873 272
6 3300049569 Ga0501032_0003564 Ga0501032_0003564_8953_9921 272
7 3300049571 Ga0501034_0000850 Ga0501034_0000850_27903_28871 272
8 3300049572 Ga0501036_0000547 Ga0501036_0000547_13097_14065 272
9 3300049579 Ga0501043_0003257 Ga0501043_0003257_11822_12790 272
10 3300049581 Ga0501047_0000455 Ga0501047_0000455_16353_17321 272
11 3300049590 Ga0501074_0010853 Ga0501074_0010853_5564_6532 272
12 3300049742 Ga0501080_0001026 Ga0501080_0001026_16366_17334 272
13 3300049744 Ga0501083_0034723 Ga0501083_0034723_1319_2287 272
14 3300049823 Ga0501044_0008033 Ga0501044_0008033_5936_6904 272
15 3300060353 Ga0501082_0200117 Ga0501082_0200117_402_1370 272
16 3300061734 Ga0530510_0389420 Ga0530510_0389420_22_948 272
17 3300042876 Ga0451577_0142493 Ga0451577_0142493_827_1819 274
18 3300049589 Ga0501073_0191646 Ga0501073_0191646_134_1060 276
19 3300049589 Ga0501073_0236514 Ga0501073_0236514_325_1251 276
20 3300053136 Ga0500559_0021198 Ga0500559_0021198_1256_2239 278
21 3300053136 Ga0500559_0066766 Ga0500559_0066766_151_1134 278
22 3300005518 Ga0070699_100174889 Ga0070699_1001748892 279
23 3300035115 Ga0373941_0068491 Ga0373941_0068491_319_1158 279
24 3300042005 Ga0439448_0090805 Ga0439448_0090805_174_1013 279
25 3300044684 Ga0466966_0100333 Ga0466966_0100333_936_1775 279
26 3300046476 Ga0495662_0044597 Ga0495662_0044597_1270_2109 279
27 3300047469 Ga0495673_0128887 Ga0495673_0128887_11_850 279
28 3300049574 Ga0501038_0533644 Ga0501038_0533644_31_870 279
29 3300050492 nmdc:mga0yw44_163388_c1 nmdc:mga0yw44_163388_c1_24_863 279
30 3300050510 nmdc:mga06r32_182481_c1 nmdc:mga06r32_182481_c1_1222_2061 279
31 3300048928 Ga0496125_0011221 Ga0496125_0011221_5331_6314 280
32 3300003659 JGI25404J52841_10002372 JGI25404J52841_100023724 281
33 3300005983 Ga0081540_1002120 Ga0081540_10021209 281
34 3300025942 Ga0207689_10037239 Ga0207689_100372393 281
35 3300006048 Ga0075363_100005844 Ga0075363_1000058442 282
36 3300006051 Ga0075364_10002167 Ga0075364_100021678 282
37 3300006177 Ga0075362_10015262 Ga0075362_100152622 282
38 3300006178 Ga0075367_10019691 Ga0075367_100196913 282
39 3300006195 Ga0075366_10016883 Ga0075366_100168833 282
40 3300025928 Ga0207700_10006989 Ga0207700_100069894 282
41 3300050489 nmdc:mga03683_10919_c2 nmdc:mga03683_10919_c2_945_1910 282
42 3300050490 nmdc:mga03n38_32700_c1 nmdc:mga03n38_32700_c1_542_1507 282
43 3300050493 nmdc:mga0k408_41530_c1 nmdc:mga0k408_41530_c1_448_1413 282
44 3300005616 Ga0068852_100004876 Ga0068852_1000048768 283
45 3300045051 Ga0451576_0034403 Ga0451576_0034403_829_1761 283
46 3300039437 Ga0436365_1273234 Ga0436365_1273234_2429_3319 284
47 3300005439 Ga0070711_100079531 Ga0070711_1000795312 286
48 3300006175 Ga0070712_100000213 Ga0070712_10000021319 286
49 3300025915 Ga0207693_10000888 Ga0207693_1000088821 286
50 3300025916 Ga0207663_10109900 Ga0207663_101099002 286
51 3300049568 Ga0501031_0003015 Ga0501031_0003015_7993_9027 286
52 3300049570 Ga0501033_0012740 Ga0501033_0012740_309_1343 286
53 3300049571 Ga0501034_0010273 Ga0501034_0010273_2252_3286 286
54 3300049573 Ga0501037_0006363 Ga0501037_0006363_709_1743 286
55 3300049574 Ga0501038_0014086 Ga0501038_0014086_1198_2232 286
56 3300049579 Ga0501043_0103504 Ga0501043_0103504_821_1855 286
57 3300049581 Ga0501047_0006341 Ga0501047_0006341_3228_4262 286
58 3300049822 Ga0501035_0047850 Ga0501035_0047850_1472_2506 286
59 3300050494 nmdc:mga06z11_58287_c1 nmdc:mga06z11_58287_c1_279_1310 286
60 3300050492 nmdc:mga0yw44_315190_c1 nmdc:mga0yw44_315190_c1_170_1033 287
61 3300053085 Ga0495619_0096702 Ga0495619_0096702_962_1924 287
62 3300049571 Ga0501034_0009264 Ga0501034_0009264_2593_3546 288
63 3300049579 Ga0501043_0098914 Ga0501043_0098914_1179_2132 288
64 3300049581 Ga0501047_0152258 Ga0501047_0152258_874_1827 288
65 3300049823 Ga0501044_0171505 Ga0501044_0171505_520_1473 288
66 3300035115 Ga0373941_0001746 Ga0373941_0001746_2177_3145 289
67 3300049568 Ga0501031_0063714 Ga0501031_0063714_1154_2122 289
68 3300049569 Ga0501032_0026642 Ga0501032_0026642_1092_2060 289
69 3300049569 Ga0501032_0065403 Ga0501032_0065403_1439_2407 289
70 3300049570 Ga0501033_0088361 Ga0501033_0088361_34_1002 289
71 3300049571 Ga0501034_0007739 Ga0501034_0007739_10298_11266 289
72 3300049571 Ga0501034_0309201 Ga0501034_0309201_218_1186 289
73 3300049572 Ga0501036_0013517 Ga0501036_0013517_5680_6648 289
74 3300049572 Ga0501036_0037643 Ga0501036_0037643_1005_1973 289
75 3300049573 Ga0501037_0171377 Ga0501037_0171377_554_1522 289
76 3300049573 Ga0501037_0211733 Ga0501037_0211733_85_1053 289
77 3300049574 Ga0501038_0042460 Ga0501038_0042460_1958_2926 289
78 3300049574 Ga0501038_0097648 Ga0501038_0097648_946_1914 289
79 3300049574 Ga0501038_0098590 Ga0501038_0098590_1266_2234 289
80 3300049575 Ga0501039_0236608 Ga0501039_0236608_98_1066 289
81 3300049575 Ga0501039_0276335 Ga0501039_0276335_56_1024 289
82 3300049579 Ga0501043_0003673 Ga0501043_0003673_11196_12164 289
83 3300049579 Ga0501043_0244490 Ga0501043_0244490_297_1265 289
84 3300049581 Ga0501047_0065540 Ga0501047_0065540_2410_3378 289
85 3300049582 Ga0501048_0085873 Ga0501048_0085873_91_1059 289
86 3300049584 Ga0501068_0056764 Ga0501068_0056764_946_1911 289
87 3300049585 Ga0501069_0022997 Ga0501069_0022997_1694_2662 289
88 3300049586 Ga0501070_0014286 Ga0501070_0014286_309_1277 289
89 3300049586 Ga0501070_0184054 Ga0501070_0184054_284_1252 289
90 3300049586 Ga0501070_0295368 Ga0501070_0295368_103_1071 289
91 3300049741 Ga0501079_0257297 Ga0501079_0257297_14_982 289
92 3300049742 Ga0501080_0029381 Ga0501080_0029381_266_1234 289
93 3300049742 Ga0501080_0279637 Ga0501080_0279637_418_1386 289
94 3300049743 Ga0501081_0173404 Ga0501081_0173404_365_1333 289
95 3300049822 Ga0501035_0010664 Ga0501035_0010664_22_990 289
96 3300049822 Ga0501035_0012093 Ga0501035_0012093_1261_2229 289
97 3300049822 Ga0501035_0046533 Ga0501035_0046533_1266_2234 289
98 3300049823 Ga0501044_0048481 Ga0501044_0048481_1938_2906 289
99 3300060353 Ga0501082_0235717 Ga0501082_0235717_435_1403 289
100 3300005289 Ga0065704_10093664 Ga0065704_100936642 290
101 3300046462 Ga0495651_0270277 Ga0495651_0270277_226_1137 290
102 3300048924 Ga0496121_0093522 Ga0496121_0093522_384_1361 290
103 3300048928 Ga0496125_0009864 Ga0496125_0009864_811_1788 290
104 3300049569 Ga0501032_0229033 Ga0501032_0229033_20_1060 290
105 3300049571 Ga0501034_0239053 Ga0501034_0239053_174_1142 290
106 3300049572 Ga0501036_0146126 Ga0501036_0146126_354_1394 290
107 3300013297 Ga0157378_10128094 Ga0157378_101280942 294
108 3300026116 Ga0207674_10116666 Ga0207674_101166663 294
109 3300031251 Ga0265327_10056759 Ga0265327_100567591 294
110 3300031251 Ga0265327_10045767 Ga0265327_100457672 295
111 3300009094 Ga0111539_10425447 Ga0111539_104254472 296
112 3300031712 Ga0265342_10045235 Ga0265342_100452353 296
113 3300048913 Ga0496110_0006503 Ga0496110_0006503_4623_5591 296
114 3300049572 Ga0501036_0048905 Ga0501036_0048905_1756_2751 296
115 3300049823 Ga0501044_0095098 Ga0501044_0095098_488_1483 296
116 3300053134 Ga0500658_0039451 Ga0500658_0039451_982_1875 296
117 3300005614 Ga0068856_100201154 Ga0068856_1002011542 299
118 3300005981 Ga0081538_10041578 Ga0081538_100415783 299
119 3300021384 Ga0213876_10025508 Ga0213876_100255083 299
120 3300039438 Ga0436360_0306594 Ga0436360_0306594_24_1052 299
121 3300007265 Ga0099794_10096984 Ga0099794_100969842 300
122 3300033180 Ga0307510_10138309 Ga0307510_101383092 300
123 3300035171 Ga0373946_0125416 Ga0373946_0125416_187_1155 300
124 3300046455 Ga0495603_0085695 Ga0495603_0085695_217_1185 300
125 3300046507 Ga0495606_0002520 Ga0495606_0002520_10389_11357 300
126 3300048913 Ga0496110_0163962 Ga0496110_0163962_964_1932 300
127 3300048915 Ga0496112_0106733 Ga0496112_0106733_425_1393 300
128 3300048918 Ga0496115_0133833 Ga0496115_0133833_758_1726 300
129 3300053102 Ga0500554_001532 Ga0500554_001532_2689_3657 300
130 3300053150 Ga0500603_038681 Ga0500603_038681_206_1174 300
131 3300053178 Ga0500637_0021257 Ga0500637_0021257_1305_2273 300
132 3300005434 Ga0070709_10005546 Ga0070709_100055466 301
133 3300005435 Ga0070714_100009084 Ga0070714_1000090845 301
134 3300005436 Ga0070713_100006662 Ga0070713_1000066622 301
135 3300005437 Ga0070710_10001257 Ga0070710_1000125712 301
136 3300005439 Ga0070711_100045845 Ga0070711_1000458452 301
137 3300006028 Ga0070717_10008461 Ga0070717_100084617 301
138 3300006163 Ga0070715_10000384 Ga0070715_100003849 301
139 3300006175 Ga0070712_100084293 Ga0070712_1000842932 301
140 3300025898 Ga0207692_10000214 Ga0207692_100002148 301
141 3300025905 Ga0207685_10012312 Ga0207685_100123123 301
142 3300025915 Ga0207693_10026683 Ga0207693_100266835 301
143 3300025916 Ga0207663_10000628 Ga0207663_1000062813 301
144 3300025939 Ga0207665_10001305 Ga0207665_100013053 301
145 3300025942 Ga0207689_10266200 Ga0207689_102662002 301
146 3300046559 Ga0495667_0060371 Ga0495667_0060371_878_1846 301
147 3300047322 Ga0495680_0066844 Ga0495680_0066844_264_1232 301
148 3300048903 Ga0496100_0013817 Ga0496100_0013817_2617_3585 301
149 3300048904 Ga0496101_0044816 Ga0496101_0044816_1112_2080 301
150 3300048907 Ga0496104_0007573 Ga0496104_0007573_972_1940 301
151 3300048908 Ga0496105_0050528 Ga0496105_0050528_1158_2126 301
152 3300048909 Ga0496106_0001779 Ga0496106_0001779_12994_13962 301
153 3300048910 Ga0496107_0007359 Ga0496107_0007359_4799_5767 301
154 3300048911 Ga0496108_0030618 Ga0496108_0030618_1022_1990 301
155 3300048912 Ga0496109_0134485 Ga0496109_0134485_326_1294 301
156 3300048914 Ga0496111_0001887 Ga0496111_0001887_9401_10369 301
157 3300048915 Ga0496112_0000004 Ga0496112_0000004_235548_236516 301
158 3300048915 Ga0496112_0016876 Ga0496112_0016876_3624_4592 301
159 3300048918 Ga0496115_0112676 Ga0496115_0112676_1040_2008 301
160 3300027682 Ga0209971_1003527 Ga0209971_10035273 302
161 3300035691 Ga0373931_0044761 Ga0373931_0044761_37_1005 302
162 3300046507 Ga0495606_0147353 Ga0495606_0147353_447_1358 302
163 3300050508 nmdc:mga09592_179408_c1 nmdc:mga09592_179408_c1_755_1717 302
164 3300005937 Ga0081455_10081734 Ga0081455_100817342 303
165 iso_pu_bacteria 2842733646 2842736212 303
166 iso_pu_bacteria 2928115317 2928115317 303
167 iso_pu_bacteria 2929520902 2929525112 303
168 iso_pu_bacteria 2904479285 2904480484 304
169 3300060353 Ga0501082_0000106 Ga0501082_0000106_11312_12280 305
170 iso_pu_bacteria 2547132374 2548500061 305
171 iso_pu_bacteria 2643221570 2643868274 305
172 iso_pu_bacteria 2643221609 2644059847 305
173 iso_pu_bacteria 2643221611 2644074136 305
174 iso_pu_bacteria 2738543012 2739241380 305
175 iso_pu_bacteria 2816332133 2816473545 305
176 iso_pu_bacteria 2974320154 2974324292 305
177 3300028794 Ga0307515_10056876 Ga0307515_100568764 306
178 3300048911 Ga0496108_0230064 Ga0496108_0230064_496_1419 306
179 3300048929 Ga0496126_0128788 Ga0496126_0128788_923_1891 306
180 3300031911 Ga0307412_10102600 Ga0307412_101026002 307
181 3300049571 Ga0501034_0000423 Ga0501034_0000423_68870_69856 307
182 iso_pu_bacteria 2738541307 2738886626 307
183 3300006186 Ga0075369_10064502 Ga0075369_100645022 308
184 3300049571 Ga0501034_0108327 Ga0501034_0108327_411_1379 308
185 3300049573 Ga0501037_0055821 Ga0501037_0055821_882_1850 308
186 3300049574 Ga0501038_0099490 Ga0501038_0099490_1211_2179 308
187 3300049575 Ga0501039_0148800 Ga0501039_0148800_376_1344 308
188 3300050516 nmdc:mga0sz30_60142_c1 nmdc:mga0sz30_60142_c1_252_1217 308
189 3300045049 Ga0466959_0030304 Ga0466959_0030304_1399_2355 309
190 3300049575 Ga0501039_0029308 Ga0501039_0029308_2299_3264 309
191 3300049587 Ga0501071_0082888 Ga0501071_0082888_951_1916 309
192 3300049592 Ga0501076_0046191 Ga0501076_0046191_107_1072 309
193 3300049741 Ga0501079_0104345 Ga0501079_0104345_1060_2025 309
194 3300049742 Ga0501080_0058440 Ga0501080_0058440_703_1668 309
195 3300049743 Ga0501081_0114042 Ga0501081_0114042_95_1060 309
196 3300049824 Ga0501045_0173779 Ga0501045_0173779_412_1377 309
197 3300054114 Ga0501084_0046552 Ga0501084_0046552_1032_1997 309
198 3300003911 JGI25405J52794_10016871 JGI25405J52794_100168712 310
199 3300006038 Ga0075365_10048318 Ga0075365_100483182 310
200 3300006051 Ga0075364_10065465 Ga0075364_100654652 310
201 3300025949 Ga0207667_10186996 Ga0207667_101869962 310
202 3300035086 Ga0373934_0021851 Ga0373934_0021851_750_1718 310
203 3300044658 Ga0466972_0000189 Ga0466972_0000189_14953_15921 310
204 3300044765 Ga0466970_0133648 Ga0466970_0133648_233_1201 310
205 3300046501 Ga0495607_0123383 Ga0495607_0123383_24_956 310
206 3300046680 Ga0495646_0015954 Ga0495646_0015954_1878_2846 310
207 3300048903 Ga0496100_0032375 Ga0496100_0032375_1419_2387 310
208 3300049589 Ga0501073_0147202 Ga0501073_0147202_537_1502 310
209 3300050491 nmdc:mga00v17_263642_c1 nmdc:mga00v17_263642_c1_45_1004 310
210 3300050492 nmdc:mga0yw44_107288_c1 nmdc:mga0yw44_107288_c1_685_1644 310
211 3300009551 Ga0105238_10268966 Ga0105238_102689662 311
212 3300025903 Ga0207680_10106766 Ga0207680_101067662 311
213 3300025912 Ga0207707_10013921 Ga0207707_100139214 311
214 3300025924 Ga0207694_10171704 Ga0207694_101717042 311
215 3300005719 Ga0068861_100262545 Ga0068861_1002625451 312
216 3300009098 Ga0105245_10056957 Ga0105245_100569573 312
217 3300009177 Ga0105248_10043504 Ga0105248_100435043 312
218 3300013297 Ga0157378_10069939 Ga0157378_100699392 312
219 3300025934 Ga0207686_10096001 Ga0207686_100960013 312
220 3300025941 Ga0207711_10054504 Ga0207711_100545041 312
221 3300026118 Ga0207675_100220039 Ga0207675_1002200392 312
222 3300053121 Ga0500607_025574 Ga0500607_025574_1615_2583 313
223 3300053145 Ga0500586_004477 Ga0500586_004477_1548_2516 313
224 3300046557 Ga0495622_0079394 Ga0495622_0079394_255_1223 314
225 3300053093 Ga0500651_0204075 Ga0500651_0204075_118_1086 314
226 3300053094 Ga0500566_0005587 Ga0500566_0005587_6149_7117 314
227 3300053122 Ga0500608_001229 Ga0500608_001229_702_1670 314
228 3300053122 Ga0500608_003410 Ga0500608_003410_1432_2400 314
229 3300053125 Ga0500618_032142 Ga0500618_032142_97_1065 314
230 3300053136 Ga0500559_0000067 Ga0500559_0000067_1530_2498 314
231 3300053136 Ga0500559_0025764 Ga0500559_0025764_1432_2400 314
232 3300053157 Ga0500624_019353 Ga0500624_019353_99_1067 314
233 iso_pu_bacteria 2513237096 2513660880 314
234 iso_pu_bacteria 2513237145 2513919583 314
235 3300006028 Ga0070717_10343363 Ga0070717_103433632 316
236 3300009093 Ga0105240_10070766 Ga0105240_100707664 316
237 3300049586 Ga0501070_0201889 Ga0501070_0201889_333_1298 316
238 3300049590 Ga0501074_0304748 Ga0501074_0304748_133_1098 316
239 iso_pu_bacteria 2511231021 2511358071 316
240 3300007076 Ga0075435_100366660 Ga0075435_1003666602 317
241 3300050511 nmdc:mga08y16_89962_c1 nmdc:mga08y16_89962_c1_2111_3133 317
242 3300050512 nmdc:mga0n895_143382_c1 nmdc:mga0n895_143382_c1_157_1179 317
243 3300050513 nmdc:mga0rr50_242490_c1 nmdc:mga0rr50_242490_c1_292_1314 317
244 iso_pu_bacteria 2511231028 2511400719 317
245 iso_pu_bacteria 2513237094 2513644466 317
246 iso_pu_bacteria 2602042107 2603859616 317
247 iso_pu_bacteria 2617270741 2617375577 317
248 iso_pu_bacteria 2824600985 2824604041 317
249 iso_pu_bacteria 2824609381 2824610310 317
250 iso_pu_bacteria 2824653114 2824658049 317
251 iso_pu_bacteria 2824704595 2824709001 317
252 iso_pu_bacteria 2824732956 2824735282 317
253 iso_pu_bacteria 2824746037 2824746618 317
254 iso_pu_bacteria 2824753945 2824759583 317
255 iso_pu_bacteria 2824763712 2824770014 317
256 iso_pu_bacteria 2844315083 2844319237 317
257 iso_pu_bacteria 2857509624 2857514129 317
258 iso_pu_bacteria 2857524615 2857528977 317
259 iso_pu_bacteria 2888388044 2888393636 317
260 iso_pu_bacteria 2888419890 2888424711 317
261 iso_pu_bacteria 2893066018 2893070434 317
262 iso_pu_bacteria 2903727486 2903731079 317
263 iso_pu_bacteria 2904711408 2904714839 317
264 iso_pu_bacteria 2906602504 2906607414 317
265 iso_pu_bacteria 2908775508 2908780357 317
266 iso_pu_bacteria 2919073203 2919076376 317
267 iso_pu_bacteria 2932794094 2932799779 317
268 iso_pu_bacteria 2932801729 2932806970 317
269 iso_pu_bacteria 2935883170 2935886906 317
270 iso_pu_bacteria 2941531003 2941532993 317
271 iso_pu_bacteria 3005483717 3005484487 317
272 iso_pu_bacteria 3005506211 3005510502 317
273 iso_pu_bacteria 3005594810 3005599407 317
274 iso_pu_bacteria 3005718088 3005722482 317
275 iso_pu_bacteria 8019648815 8019658573 317
276 iso_pu_bacteria 8056967851 8056968198 317
277 3300009174 Ga0105241_10372184 Ga0105241_103721842 318
278 3300021388 Ga0213875_10000023 Ga0213875_1000002336 318
279 3300037853 Ga0436364_1416054 Ga0436364_1416054_362_1387 318
280 3300039437 Ga0436365_1356220 Ga0436365_1356220_12_1040 318
281 3300049586 Ga0501070_0009287 Ga0501070_0009287_675_1709 318
282 iso_pu_bacteria 2643221547 2643757143 318
283 3300005981 Ga0081538_10040168 Ga0081538_100401683 319
284 3300006038 Ga0075365_10150789 Ga0075365_101507891 319
285 3300049588 Ga0501072_0125982 Ga0501072_0125982_270_1286 319
286 3300049591 Ga0501075_0289053 Ga0501075_0289053_10_1026 319
287 3300049591 Ga0501075_0414835 Ga0501075_0414835_44_1003 319
288 3300049741 Ga0501079_0250509 Ga0501079_0250509_95_1111 319
289 3300053096 Ga0500641_0006277 Ga0500641_0006277_741_1724 319
290 3300054114 Ga0501084_0232677 Ga0501084_0232677_398_1414 319
291 3300060353 Ga0501082_0147642 Ga0501082_0147642_337_1296 319
292 3300005937 Ga0081455_10000982 Ga0081455_100009829 320
293 3300006844 Ga0075428_100103893 Ga0075428_1001038932 320
294 3300006847 Ga0075431_100014864 Ga0075431_1000148641 320
295 3300035116 Ga0373945_0055567 Ga0373945_0055567_93_1055 320
296 3300037068 Ga0373925_0001514 Ga0373925_0001514_2712_3674 320
297 3300037312 Ga0395899_0214599 Ga0395899_0214599_230_1192 320
298 3300037418 Ga0395900_0126781 Ga0395900_0126781_1425_2387 320
299 3300037466 Ga0395898_0177413 Ga0395898_0177413_551_1513 320
300 3300037471 Ga0395905_0095032 Ga0395905_0095032_668_1630 320
301 3300038443 Ga0395901_0044035 Ga0395901_0044035_84_1046 320
302 3300041407 Ga0439447_005815 Ga0439447_005815_3062_4045 320
303 3300042138 Ga0450903_001354 Ga0450903_001354_3216_4199 320
304 3300044694 Ga0466963_0013352 Ga0466963_0013352_887_1849 320
305 3300044842 Ga0466957_0333020 Ga0466957_0333020_39_1001 320
306 3300045049 Ga0466959_0089806 Ga0466959_0089806_1221_2183 320
307 3300046454 Ga0495592_0091436 Ga0495592_0091436_431_1393 320
308 3300046459 Ga0495629_0052653 Ga0495629_0052653_481_1443 320
309 3300046460 Ga0495638_0002166 Ga0495638_0002166_4623_5606 320
310 3300046460 Ga0495638_0002585 Ga0495638_0002585_8592_9575 320
311 3300046463 Ga0495653_0013899 Ga0495653_0013899_2058_3020 320
312 3300046477 Ga0495664_0005166 Ga0495664_0005166_3108_4070 320
313 3300046514 Ga0495618_0011685 Ga0495618_0011685_702_1664 320
314 3300046517 Ga0495630_0005678 Ga0495630_0005678_7194_8156 320
315 3300046533 Ga0495640_0002925 Ga0495640_0002925_11219_12181 320
316 3300046543 Ga0495645_0004568 Ga0495645_0004568_3880_4842 320
317 3300046642 Ga0495634_0077843 Ga0495634_0077843_544_1506 320
318 3300046663 Ga0495635_0003066 Ga0495635_0003066_8648_9610 320
319 3300046680 Ga0495646_0018897 Ga0495646_0018897_440_1402 320
320 3300047319 Ga0495674_0028208 Ga0495674_0028208_842_1804 320
321 3300047471 Ga0495684_0003187 Ga0495684_0003187_668_1630 320
322 3300050507 nmdc:mga05p37_159771_c1 nmdc:mga05p37_159771_c1_712_1674 320
323 3300050507 nmdc:mga05p37_314549_c1 nmdc:mga05p37_314549_c1_282_1244 320
324 3300050510 nmdc:mga06r32_73287_c1 nmdc:mga06r32_73287_c1_619_1581 320
325 3300053077 Ga0495601_0004046 Ga0495601_0004046_4396_5358 320
326 3300053078 Ga0495612_0000523 Ga0495612_0000523_11385_12347 320
327 3300053084 Ga0495595_0094291 Ga0495595_0094291_370_1332 320
328 3300053085 Ga0495619_0003655 Ga0495619_0003655_8283_9245 320
329 3300053085 Ga0495619_0203344 Ga0495619_0203344_148_1110 320
330 3300003763 Ga0055529_1009397 Ga0055529_10093971 321
331 3300005366 Ga0070659_100174159 Ga0070659_1001741593 321
332 3300005439 Ga0070711_100144734 Ga0070711_1001447343 321
333 3300005455 Ga0070663_100141534 Ga0070663_1001415342 321
334 3300005536 Ga0070697_100000168 Ga0070697_10000016861 321
335 3300005844 Ga0068862_100227314 Ga0068862_1002273141 321
336 3300005985 Ga0081539_10000140 Ga0081539_1000014095 321
337 3300006028 Ga0070717_10316573 Ga0070717_103165732 321
338 3300006038 Ga0075365_10213019 Ga0075365_102130192 321
339 3300006051 Ga0075364_10021617 Ga0075364_100216173 321
340 3300006051 Ga0075364_10175131 Ga0075364_101751311 321
341 3300006186 Ga0075369_10008188 Ga0075369_100081883 321
342 3300006186 Ga0075369_10016682 Ga0075369_100166823 321
343 3300006353 Ga0075370_10009628 Ga0075370_100096284 321
344 3300006353 Ga0075370_10048586 Ga0075370_100485862 321
345 3300006914 Ga0075436_100000192 Ga0075436_10000019230 321
346 3300009093 Ga0105240_10002078 Ga0105240_1000207827 321
347 3300009098 Ga0105245_10140599 Ga0105245_101405993 321
348 3300009174 Ga0105241_10016563 Ga0105241_100165632 321
349 3300009545 Ga0105237_10015521 Ga0105237_100155212 321
350 3300010375 Ga0105239_10009271 Ga0105239_100092719 321
351 3300010375 Ga0105239_10095136 Ga0105239_100951363 321
352 3300010375 Ga0105239_10288768 Ga0105239_102887682 321
353 3300011119 Ga0105246_10058939 Ga0105246_100589393 321
354 3300014325 Ga0163163_10002228 Ga0163163_1000222815 321
355 3300014326 Ga0157380_10461852 Ga0157380_104618522 321
356 3300014969 Ga0157376_10111465 Ga0157376_101114652 321
357 3300021320 Ga0214544_1000002 Ga0214544_1000002258 321
358 3300021321 Ga0214542_1000001 Ga0214542_1000001608 321
359 3300021324 Ga0214545_1000001 Ga0214545_1000001674 321
360 3300021327 Ga0214543_1000001 Ga0214543_1000001521 321
361 3300025253 Ga0209677_103988 Ga0209677_1039883 321
362 3300025254 Ga0209148_1000841 Ga0209148_10008418 321
363 3300025261 Ga0209233_1025604 Ga0209233_10256042 321
364 3300025272 Ga0209455_1003926 Ga0209455_10039263 321
365 3300025295 Ga0209564_1009425 Ga0209564_10094253 321
366 3300025297 Ga0209758_1003241 Ga0209758_100324111 321
367 3300025302 Ga0207426_1002280 Ga0207426_10022805 321
368 3300025909 Ga0207705_10120672 Ga0207705_101206722 321
369 3300025911 Ga0207654_10053478 Ga0207654_100534782 321
370 3300025913 Ga0207695_10000910 Ga0207695_1000091018 321
371 3300025914 Ga0207671_10002587 Ga0207671_100025872 321
372 3300026067 Ga0207678_10077913 Ga0207678_100779133 321
373 3300026078 Ga0207702_10348794 Ga0207702_103487942 321
374 3300026121 Ga0207683_10312162 Ga0207683_103121622 321
375 3300031235 Ga0265330_10004928 Ga0265330_100049287 321
376 3300031247 Ga0265340_10000710 Ga0265340_1000071016 321
377 3300031911 Ga0307412_10113062 Ga0307412_101130623 321
378 3300044683 Ga0466965_0018538 Ga0466965_0018538_303_1271 321
379 3300044694 Ga0466963_0030438 Ga0466963_0030438_927_1895 321
380 3300045976 Ga0466967_0024787 Ga0466967_0024787_2496_3464 321
381 3300046506 Ga0495583_0070437 Ga0495583_0070437_365_1333 321
382 3300046515 Ga0495620_0031063 Ga0495620_0031063_1130_2098 321
383 3300046518 Ga0495631_0087586 Ga0495631_0087586_275_1243 321
384 3300046519 Ga0495632_0113164 Ga0495632_0113164_108_1076 321
385 3300046524 Ga0495648_0013688 Ga0495648_0013688_3472_4440 321
386 3300046642 Ga0495634_0064753 Ga0495634_0064753_812_1780 321
387 3300046660 Ga0495625_0062082 Ga0495625_0062082_813_1781 321
388 3300046663 Ga0495635_0008585 Ga0495635_0008585_176_1144 321
389 3300046665 Ga0495661_0082361 Ga0495661_0082361_686_1654 321
390 3300046675 Ga0495657_0197965 Ga0495657_0197965_96_1064 321
391 3300046694 Ga0495649_0023164 Ga0495649_0023164_478_1446 321
392 3300047317 Ga0495604_0050228 Ga0495604_0050228_1987_2955 321
393 3300047317 Ga0495604_0116991 Ga0495604_0116991_819_1787 321
394 3300047321 Ga0495676_0174338 Ga0495676_0174338_203_1171 321
395 3300047472 Ga0495686_0053940 Ga0495686_0053940_1455_2423 321
396 3300048903 Ga0496100_0282258 Ga0496100_0282258_180_1148 321
397 3300048905 Ga0496102_0086626 Ga0496102_0086626_953_1921 321
398 3300048907 Ga0496104_0020552 Ga0496104_0020552_1175_2143 321
399 3300048908 Ga0496105_0003408 Ga0496105_0003408_5963_6931 321
400 3300048908 Ga0496105_0061537 Ga0496105_0061537_1999_2967 321
401 3300048909 Ga0496106_0014078 Ga0496106_0014078_4115_5083 321
402 3300048912 Ga0496109_0099287 Ga0496109_0099287_1684_2652 321
403 3300048913 Ga0496110_0065261 Ga0496110_0065261_1168_2136 321
404 3300048914 Ga0496111_0202114 Ga0496111_0202114_409_1377 321
405 3300048915 Ga0496112_0034410 Ga0496112_0034410_3578_4546 321
406 3300048917 Ga0496114_0442260 Ga0496114_0442260_100_1068 321
407 3300048920 Ga0496117_0130566 Ga0496117_0130566_274_1242 321
408 3300048921 Ga0496118_0089002 Ga0496118_0089002_277_1245 321
409 3300048922 Ga0496119_0020237 Ga0496119_0020237_2479_3447 321
410 3300048922 Ga0496119_0092778 Ga0496119_0092778_124_1092 321
411 3300048923 Ga0496120_0035672 Ga0496120_0035672_1462_2430 321
412 3300048925 Ga0496122_0025741 Ga0496122_0025741_2557_3525 321
413 3300048926 Ga0496123_0096119 Ga0496123_0096119_439_1407 321
414 3300048928 Ga0496125_0048499 Ga0496125_0048499_1632_2600 321
415 3300048928 Ga0496125_0055066 Ga0496125_0055066_902_1870 321
416 3300048929 Ga0496126_0146150 Ga0496126_0146150_612_1580 321
417 3300049579 Ga0501043_0052810 Ga0501043_0052810_1381_2346 321
418 3300049742 Ga0501080_0172405 Ga0501080_0172405_92_1057 321
419 3300049822 Ga0501035_0062674 Ga0501035_0062674_1407_2372 321
420 3300050491 nmdc:mga00v17_117160_c1 nmdc:mga00v17_117160_c1_448_1416 321
421 3300050491 nmdc:mga00v17_48740_c1 nmdc:mga00v17_48740_c1_1253_2221 321
422 3300050514 nmdc:mga08x19_14_c1 nmdc:mga08x19_14_c1_106727_107695 321
423 3300050516 nmdc:mga0sz30_26045_c1 nmdc:mga0sz30_26045_c1_234_1202 321
424 3300050516 nmdc:mga0sz30_5969_c1 nmdc:mga0sz30_5969_c1_1442_2410 321
425 3300053080 Ga0500635_0019866 Ga0500635_0019866_110_1078 321
426 3300053085 Ga0495619_0234801 Ga0495619_0234801_103_1071 321
427 3300053087 Ga0500643_010551 Ga0500643_010551_889_1857 321
428 3300053089 Ga0500581_066267 Ga0500581_066267_704_1672 321
429 3300053093 Ga0500651_0012814 Ga0500651_0012814_2029_2997 321
430 3300053094 Ga0500566_0004691 Ga0500566_0004691_11_979 321
431 3300053094 Ga0500566_0083560 Ga0500566_0083560_768_1736 321
432 3300053104 Ga0500556_0000004 Ga0500556_0000004_631639_632607 321
433 3300053108 Ga0500562_052297 Ga0500562_052297_71_1039 321
434 3300053109 Ga0500569_018758 Ga0500569_018758_247_1215 321
435 3300053111 Ga0500572_013643 Ga0500572_013643_146_1114 321
436 3300053122 Ga0500608_022074 Ga0500608_022074_1944_2912 321
437 3300053130 Ga0500642_0000186 Ga0500642_0000186_14159_15127 321
438 3300053131 Ga0500652_036517 Ga0500652_036517_314_1282 321
439 3300053134 Ga0500658_0023977 Ga0500658_0023977_1018_1983 321
440 3300053136 Ga0500559_0006042 Ga0500559_0006042_2467_3435 321
441 3300053138 Ga0500564_035305 Ga0500564_035305_399_1367 321
442 3300053139 Ga0500568_0001430 Ga0500568_0001430_2235_3203 321
443 3300053139 Ga0500568_0024932 Ga0500568_0024932_1410_2378 321
444 3300053153 Ga0500616_0000014 Ga0500616_0000014_603331_604299 321
445 3300053154 Ga0500619_001901 Ga0500619_001901_1930_2898 321
446 3300053156 Ga0500622_0000513 Ga0500622_0000513_26325_27293 321
447 3300053162 Ga0500638_102521 Ga0500638_102521_90_1058 321
448 3300053177 Ga0500636_0000122 Ga0500636_0000122_22654_23622 321
449 3300001979 JGI24740J21852_10012501 JGI24740J21852_100125012 322
450 3300001989 JGI24739J22299_10010613 JGI24739J22299_100106134 322
451 3300001990 JGI24737J22298_10003981 JGI24737J22298_100039815 322
452 3300002070 JGI24750J21931_1000181 JGI24750J21931_10001817 322
453 3300002074 JGI24748J21848_1000571 JGI24748J21848_10005713 322
454 3300002075 JGI24738J21930_10001393 JGI24738J21930_100013935 322
455 3300002076 JGI24749J21850_1001394 JGI24749J21850_10013944 322
456 3300002077 JGI24744J21845_10000700 JGI24744J21845_100007007 322
457 3300002126 JGI24035J26624_1001034 JGI24035J26624_10010343 322
458 3300002155 JGI24033J26618_1000816 JGI24033J26618_10008162 322
459 3300002239 JGI24034J26672_10000836 JGI24034J26672_100008361 322
460 3300002244 JGI24742J22300_10001030 JGI24742J22300_100010302 322
461 3300005290 Ga0065712_10078399 Ga0065712_100783993 322
462 3300005293 Ga0065715_10089022 Ga0065715_1008902215 322
463 3300005328 Ga0070676_10002898 Ga0070676_100028984 322
464 3300005329 Ga0070683_100001166 Ga0070683_1000011668 322
465 3300005330 Ga0070690_100229444 Ga0070690_1002294442 322
466 3300005331 Ga0070670_100003635 Ga0070670_10000363514 322
467 3300005333 Ga0070677_10000126 Ga0070677_1000012620 322
468 3300005334 Ga0068869_100009659 Ga0068869_1000096592 322
469 3300005335 Ga0070666_10018143 Ga0070666_100181435 322
470 3300005336 Ga0070680_100013378 Ga0070680_1000133787 322
471 3300005336 Ga0070680_100153986 Ga0070680_1001539861 322
472 3300005337 Ga0070682_100003724 Ga0070682_1000037243 322
473 3300005337 Ga0070682_100100059 Ga0070682_1001000592 322
474 3300005338 Ga0068868_100003027 Ga0068868_1000030273 322
475 3300005339 Ga0070660_100010060 Ga0070660_1000100604 322
476 3300005339 Ga0070660_100051659 Ga0070660_1000516592 322
477 3300005339 Ga0070660_100164105 Ga0070660_1001641052 322
478 3300005340 Ga0070689_100003384 Ga0070689_1000033848 322
479 3300005340 Ga0070689_100018800 Ga0070689_1000188006 322
480 3300005341 Ga0070691_10000994 Ga0070691_100009947 322
481 3300005343 Ga0070687_100000085 Ga0070687_1000000853 322
482 3300005344 Ga0070661_100000307 Ga0070661_10000030745 322
483 3300005345 Ga0070692_10002518 Ga0070692_100025187 322
484 3300005345 Ga0070692_10029229 Ga0070692_100292293 322
485 3300005347 Ga0070668_100001248 Ga0070668_10000124814 322
486 3300005353 Ga0070669_100005868 Ga0070669_1000058687 322
487 3300005354 Ga0070675_100024482 Ga0070675_1000244822 322
488 3300005354 Ga0070675_100110171 Ga0070675_1001101711 322
489 3300005355 Ga0070671_100009899 Ga0070671_1000098995 322
490 3300005356 Ga0070674_100003469 Ga0070674_1000034697 322
491 3300005364 Ga0070673_100000152 Ga0070673_1000001525 322
492 3300005365 Ga0070688_100000558 Ga0070688_10000055817 322
493 3300005366 Ga0070659_100010268 Ga0070659_1000102682 322
494 3300005367 Ga0070667_100005640 Ga0070667_1000056405 322
495 3300005367 Ga0070667_100071738 Ga0070667_1000717382 322
496 3300005436 Ga0070713_100191199 Ga0070713_1001911992 322
497 3300005437 Ga0070710_10101024 Ga0070710_101010242 322
498 3300005438 Ga0070701_10006397 Ga0070701_100063975 322
499 3300005438 Ga0070701_10138846 Ga0070701_101388462 322
500 3300005440 Ga0070705_100005321 Ga0070705_1000053212 322
501 3300005441 Ga0070700_100002863 Ga0070700_1000028637 322
502 3300005441 Ga0070700_100098089 Ga0070700_1000980892 322
503 3300005444 Ga0070694_100001507 Ga0070694_10000150714 322
504 3300005444 Ga0070694_100158080 Ga0070694_1001580802 322
505 3300005445 Ga0070708_100167806 Ga0070708_1001678062 322
506 3300005455 Ga0070663_100000522 Ga0070663_10000052221 322
507 3300005456 Ga0070678_100040107 Ga0070678_1000401072 322
508 3300005457 Ga0070662_100001666 Ga0070662_10000166614 322
509 3300005458 Ga0070681_10017661 Ga0070681_100176617 322
510 3300005459 Ga0068867_100005662 Ga0068867_1000056627 322
511 3300005466 Ga0070685_10006948 Ga0070685_100069483 322
512 3300005530 Ga0070679_100007489 Ga0070679_1000074894 322
513 3300005530 Ga0070679_100154571 Ga0070679_1001545712 322
514 3300005530 Ga0070679_100194254 Ga0070679_1001942542 322
515 3300005535 Ga0070684_100000894 Ga0070684_10000089421 322
516 3300005539 Ga0068853_100010158 Ga0068853_1000101583 322
517 3300005543 Ga0070672_100011122 Ga0070672_1000111227 322
518 3300005544 Ga0070686_100016131 Ga0070686_1000161311 322
519 3300005544 Ga0070686_100130355 Ga0070686_1001303551 322
520 3300005545 Ga0070695_100031469 Ga0070695_1000314694 322
521 3300005545 Ga0070695_100111168 Ga0070695_1001111681 322
522 3300005546 Ga0070696_100005009 Ga0070696_1000050097 322
523 3300005546 Ga0070696_100020495 Ga0070696_1000204955 322
524 3300005547 Ga0070693_100000134 Ga0070693_1000001342 322
525 3300005548 Ga0070665_100059697 Ga0070665_1000596974 322
526 3300005549 Ga0070704_100000428 Ga0070704_10000042814 322
527 3300005563 Ga0068855_100007545 Ga0068855_10000754513 322
528 3300005563 Ga0068855_100010956 Ga0068855_1000109563 322
529 3300005564 Ga0070664_100026882 Ga0070664_1000268822 322
530 3300005577 Ga0068857_100011473 Ga0068857_1000114732 322
531 3300005578 Ga0068854_100005312 Ga0068854_1000053128 322
532 3300005614 Ga0068856_100021406 Ga0068856_1000214063 322
533 3300005614 Ga0068856_100114383 Ga0068856_1001143834 322
534 3300005615 Ga0070702_100000638 Ga0070702_1000006382 322
535 3300005616 Ga0068852_100002115 Ga0068852_10000211514 322
536 3300005617 Ga0068859_100006242 Ga0068859_1000062428 322
537 3300005618 Ga0068864_100028055 Ga0068864_1000280555 322
538 3300005718 Ga0068866_10000301 Ga0068866_1000030117 322
539 3300005719 Ga0068861_100057538 Ga0068861_1000575383 322
540 3300005840 Ga0068870_10000354 Ga0068870_1000035415 322
541 3300005841 Ga0068863_100000340 Ga0068863_10000034026 322
542 3300005842 Ga0068858_100009915 Ga0068858_1000099154 322
543 3300005842 Ga0068858_100267039 Ga0068858_1002670391 322
544 3300005843 Ga0068860_100013035 Ga0068860_1000130357 322
545 3300005844 Ga0068862_100015630 Ga0068862_1000156304 322
546 3300005983 Ga0081540_1032154 Ga0081540_10321542 322
547 3300006175 Ga0070712_100271797 Ga0070712_1002717972 322
548 3300006178 Ga0075367_10012900 Ga0075367_100129003 322
549 3300006237 Ga0097621_100000040 Ga0097621_10000004074 322
550 3300006358 Ga0068871_100000301 Ga0068871_10000030121 322
551 3300006844 Ga0075428_100003180 Ga0075428_1000031808 322
552 3300006846 Ga0075430_100000201 Ga0075430_10000020134 322
553 3300006847 Ga0075431_100000260 Ga0075431_10000026034 322
554 3300006852 Ga0075433_10000007 Ga0075433_1000000745 322
555 3300006852 Ga0075433_10009124 Ga0075433_100091244 322
556 3300006871 Ga0075434_100000091 Ga0075434_10000009113 322
557 3300006871 Ga0075434_100017859 Ga0075434_1000178593 322
558 3300006871 Ga0075434_100104601 Ga0075434_1001046011 322
559 3300006880 Ga0075429_100001824 Ga0075429_1000018248 322
560 3300006881 Ga0068865_100000275 Ga0068865_1000002752 322
561 3300006931 Ga0097620_100006242 Ga0097620_1000062428 322
562 3300007076 Ga0075435_100010439 Ga0075435_1000104396 322
563 3300009094 Ga0111539_10013469 Ga0111539_100134695 322
564 3300009098 Ga0105245_10010701 Ga0105245_100107012 322
565 3300009101 Ga0105247_10018307 Ga0105247_100183073 322
566 3300009147 Ga0114129_10002772 Ga0114129_100027727 322
567 3300009148 Ga0105243_10004388 Ga0105243_100043889 322
568 3300009174 Ga0105241_10001943 Ga0105241_100019431 322
569 3300009176 Ga0105242_10007706 Ga0105242_100077065 322
570 3300009176 Ga0105242_10019682 Ga0105242_100196824 322
571 3300009177 Ga0105248_10003102 Ga0105248_1000310219 322
572 3300009177 Ga0105248_10069324 Ga0105248_100693243 322
573 3300009545 Ga0105237_10054424 Ga0105237_100544244 322
574 3300009551 Ga0105238_10052558 Ga0105238_100525582 322
575 3300009553 Ga0105249_10001599 Ga0105249_100015997 322
576 3300010375 Ga0105239_10009752 Ga0105239_100097525 322
577 3300011119 Ga0105246_10007217 Ga0105246_100072173 322
578 3300012495 Ga0157323_1000404 Ga0157323_10004041 322
579 3300012507 Ga0157342_1004325 Ga0157342_10043252 322
580 3300013102 Ga0157371_10010606 Ga0157371_100106064 322
581 3300013104 Ga0157370_10078491 Ga0157370_100784911 322
582 3300013296 Ga0157374_10001695 Ga0157374_1000169516 322
583 3300013297 Ga0157378_10003374 Ga0157378_100033747 322
584 3300013297 Ga0157378_10163081 Ga0157378_101630813 322
585 3300013306 Ga0163162_10010828 Ga0163162_100108285 322
586 3300013307 Ga0157372_10004321 Ga0157372_1000432117 322
587 3300013307 Ga0157372_10148826 Ga0157372_101488263 322
588 3300013307 Ga0157372_10580702 Ga0157372_105807022 322
589 3300013308 Ga0157375_10008254 Ga0157375_100082548 322
590 3300014325 Ga0163163_10013922 Ga0163163_100139224 322
591 3300014326 Ga0157380_10000891 Ga0157380_1000089114 322
592 3300014745 Ga0157377_10000517 Ga0157377_100005174 322
593 3300014968 Ga0157379_10011995 Ga0157379_100119957 322
594 3300014968 Ga0157379_10068978 Ga0157379_100689783 322
595 3300014969 Ga0157376_10000088 Ga0157376_1000008868 322
596 3300017792 Ga0163161_10000144 Ga0163161_100001443 322
597 3300021384 Ga0213876_10074468 Ga0213876_100744683 322
598 3300025271 Ga0207666_1000059 Ga0207666_100005919 322
599 3300025271 Ga0207666_1002359 Ga0207666_10023593 322
600 3300025290 Ga0207673_1000330 Ga0207673_10003304 322
601 3300025315 Ga0207697_10005773 Ga0207697_100057735 322
602 3300025885 Ga0207653_10002470 Ga0207653_100024706 322
603 3300025893 Ga0207682_10000509 Ga0207682_100005095 322
604 3300025899 Ga0207642_10006243 Ga0207642_100062432 322
605 3300025900 Ga0207710_10006153 Ga0207710_100061533 322
606 3300025901 Ga0207688_10000167 Ga0207688_1000016729 322
607 3300025903 Ga0207680_10042799 Ga0207680_100427992 322
608 3300025904 Ga0207647_10006799 Ga0207647_100067997 322
609 3300025906 Ga0207699_10015419 Ga0207699_100154193 322
610 3300025907 Ga0207645_10000100 Ga0207645_1000010068 322
611 3300025907 Ga0207645_10071803 Ga0207645_100718032 322
612 3300025908 Ga0207643_10000007 Ga0207643_10000007179 322
613 3300025909 Ga0207705_10018696 Ga0207705_100186962 322
614 3300025912 Ga0207707_10005018 Ga0207707_100050185 322
615 3300025912 Ga0207707_10398898 Ga0207707_103988982 322
616 3300025914 Ga0207671_10097263 Ga0207671_100972632 322
617 3300025915 Ga0207693_10244667 Ga0207693_102446672 322
618 3300025917 Ga0207660_10000041 Ga0207660_100000414 322
619 3300025918 Ga0207662_10000195 Ga0207662_1000019530 322
620 3300025919 Ga0207657_10002386 Ga0207657_1000238619 322
621 3300025919 Ga0207657_10009921 Ga0207657_1000992110 322
622 3300025919 Ga0207657_10027937 Ga0207657_100279373 322
623 3300025920 Ga0207649_10001482 Ga0207649_100014823 322
624 3300025921 Ga0207652_10002995 Ga0207652_100029953 322
625 3300025921 Ga0207652_10022353 Ga0207652_100223532 322
626 3300025923 Ga0207681_10001546 Ga0207681_1000154614 322
627 3300025924 Ga0207694_10030806 Ga0207694_100308065 322
628 3300025925 Ga0207650_10001317 Ga0207650_100013176 322
629 3300025926 Ga0207659_10003760 Ga0207659_100037605 322
630 3300025927 Ga0207687_10000072 Ga0207687_1000007270 322
631 3300025927 Ga0207687_10032877 Ga0207687_100328774 322
632 3300025931 Ga0207644_10001292 Ga0207644_1000129214 322
633 3300025931 Ga0207644_10044109 Ga0207644_100441093 322
634 3300025932 Ga0207690_10004975 Ga0207690_100049753 322
635 3300025933 Ga0207706_10010659 Ga0207706_100106595 322
636 3300025933 Ga0207706_10123401 Ga0207706_101234013 322
637 3300025934 Ga0207686_10001034 Ga0207686_1000103411 322
638 3300025935 Ga0207709_10001423 Ga0207709_1000142314 322
639 3300025936 Ga0207670_10007269 Ga0207670_100072693 322
640 3300025937 Ga0207669_10000176 Ga0207669_1000017628 322
641 3300025938 Ga0207704_10013299 Ga0207704_100132993 322
642 3300025940 Ga0207691_10008719 Ga0207691_100087197 322
643 3300025941 Ga0207711_10001106 Ga0207711_1000110614 322
644 3300025942 Ga0207689_10000366 Ga0207689_1000036618 322
645 3300025944 Ga0207661_10000087 Ga0207661_100000873 322
646 3300025945 Ga0207679_10000029 Ga0207679_1000002918 322
647 3300025945 Ga0207679_10339267 Ga0207679_103392672 322
648 3300025949 Ga0207667_10009257 Ga0207667_100092572 322
649 3300025960 Ga0207651_10001426 Ga0207651_100014267 322
650 3300025961 Ga0207712_10001547 Ga0207712_1000154714 322
651 3300025961 Ga0207712_10140029 Ga0207712_101400292 322
652 3300025972 Ga0207668_10007326 Ga0207668_100073267 322
653 3300025981 Ga0207640_10001474 Ga0207640_100014743 322
654 3300025981 Ga0207640_10288556 Ga0207640_102885562 322
655 3300025981 Ga0207640_10378418 Ga0207640_103784181 322
656 3300025986 Ga0207658_10005146 Ga0207658_100051466 322
657 3300026035 Ga0207703_10003109 Ga0207703_100031092 322
658 3300026035 Ga0207703_10117473 Ga0207703_101174732 322
659 3300026041 Ga0207639_10009108 Ga0207639_100091083 322
660 3300026067 Ga0207678_10007393 Ga0207678_100073937 322
661 3300026067 Ga0207678_10039128 Ga0207678_100391284 322
662 3300026075 Ga0207708_10007017 Ga0207708_100070175 322
663 3300026075 Ga0207708_10012400 Ga0207708_100124005 322
664 3300026075 Ga0207708_10088527 Ga0207708_100885273 322
665 3300026078 Ga0207702_10015638 Ga0207702_100156383 322
666 3300026078 Ga0207702_10056447 Ga0207702_100564473 322
667 3300026088 Ga0207641_10011956 Ga0207641_100119563 322
668 3300026089 Ga0207648_10008796 Ga0207648_100087965 322
669 3300026095 Ga0207676_10004807 Ga0207676_100048077 322
670 3300026116 Ga0207674_10000697 Ga0207674_1000069748 322
671 3300026118 Ga0207675_100005465 Ga0207675_1000054657 322
672 3300026121 Ga0207683_10000029 Ga0207683_100000295 322
673 3300026142 Ga0207698_10018865 Ga0207698_100188653 322
674 3300027617 Ga0210002_1001959 Ga0210002_10019592 322
675 3300027695 Ga0209966_1001374 Ga0209966_10013743 322
676 3300027695 Ga0209966_1003142 Ga0209966_10031422 322
677 3300027717 Ga0209998_10001898 Ga0209998_100018983 322
678 3300027717 Ga0209998_10005560 Ga0209998_100055602 322
679 3300027876 Ga0209974_10002097 Ga0209974_100020977 322
680 3300027907 Ga0207428_10000100 Ga0207428_10000100131 322
681 3300027907 Ga0207428_10000115 Ga0207428_1000011537 322
682 3300028379 Ga0268266_10040823 Ga0268266_100408234 322
683 3300028380 Ga0268265_10024411 Ga0268265_100244114 322
684 3300028381 Ga0268264_10002968 Ga0268264_1000296814 322
685 3300028556 Ga0265337_1000769 Ga0265337_10007693 322
686 3300031247 Ga0265340_10022433 Ga0265340_100224332 322
687 3300031250 Ga0265331_10017934 Ga0265331_100179342 322
688 3300031344 Ga0265316_10107017 Ga0265316_101070172 322
689 3300031595 Ga0265313_10049108 Ga0265313_100491082 322
690 3300031595 Ga0265313_10056004 Ga0265313_100560042 322
691 3300031711 Ga0265314_10098001 Ga0265314_100980012 322
692 3300031712 Ga0265342_10000282 Ga0265342_1000028245 322
693 3300031712 Ga0265342_10000896 Ga0265342_1000089633 322
694 3300031712 Ga0265342_10080137 Ga0265342_100801372 322
695 3300034818 Ga0373950_0002702 Ga0373950_0002702_181_1149 322
696 3300034819 Ga0373958_0000857 Ga0373958_0000857_209_1177 322
697 3300034820 Ga0373959_0003668 Ga0373959_0003668_1406_2374 322
698 3300034957 Ga0373938_0003291 Ga0373938_0003291_1486_2454 322
699 3300035083 Ga0373926_0002200 Ga0373926_0002200_181_1149 322
700 3300035084 Ga0373928_0003507 Ga0373928_0003507_719_1687 322
701 3300035085 Ga0373929_0008065 Ga0373929_0008065_105_1073 322
702 3300035088 Ga0373940_0003500 Ga0373940_0003500_962_1930 322
703 3300035090 Ga0373949_0001408 Ga0373949_0001408_2981_3949 322
704 3300035091 Ga0373951_0003300 Ga0373951_0003300_1349_2317 322
705 3300035092 Ga0373952_0001605 Ga0373952_0001605_2225_3193 322
706 3300035092 Ga0373952_0003186 Ga0373952_0003186_1590_2558 322
707 3300035114 Ga0373939_0001446 Ga0373939_0001446_1469_2437 322
708 3300035114 Ga0373939_0021303 Ga0373939_0021303_540_1508 322
709 3300035117 Ga0373953_0005709 Ga0373953_0005709_1751_2719 322
710 3300035118 Ga0373954_0002351 Ga0373954_0002351_1895_2863 322
711 3300035119 Ga0373956_0006571 Ga0373956_0006571_2049_3017 322
712 3300035121 Ga0373960_0001089 Ga0373960_0001089_124_1092 322
713 3300035171 Ga0373946_0005396 Ga0373946_0005396_2051_3019 322
714 3300035171 Ga0373946_0083690 Ga0373946_0083690_136_1104 322
715 3300035172 Ga0373955_0000424 Ga0373955_0000424_3960_4928 322
716 3300035207 Ga0373942_0010868 Ga0373942_0010868_1025_1993 322
717 3300035241 Ga0373961_0001706 Ga0373961_0001706_1012_1980 322
718 3300035242 Ga0373962_0006210 Ga0373962_0006210_475_1443 322
719 3300035691 Ga0373931_0001534 Ga0373931_0001534_4998_5966 322
720 3300035692 Ga0373935_0006416 Ga0373935_0006416_3782_4750 322
721 3300035692 Ga0373935_0053663 Ga0373935_0053663_606_1574 322
722 3300035695 Ga0373927_0013197 Ga0373927_0013197_1694_2662 322
723 3300035724 Ga0373933_0001949 Ga0373933_0001949_3432_4400 322
724 3300035725 Ga0373947_0001014 Ga0373947_0001014_13373_14341 322
725 3300036401 Ga0373937_0001798 Ga0373937_0001798_751_1719 322
726 3300037068 Ga0373925_0010893 Ga0373925_0010893_3771_4739 322
727 3300039437 Ga0436365_0088563 Ga0436365_0088563_4461_5429 322
728 3300042008 Ga0439450_010990 Ga0439450_010990_574_1542 322
729 3300042439 Ga0439464_0017190 Ga0439464_0017190_126_1094 322
730 3300046454 Ga0495592_0001873 Ga0495592_0001873_7004_7972 322
731 3300046454 Ga0495592_0005376 Ga0495592_0005376_6266_7234 322
732 3300046455 Ga0495603_0000847 Ga0495603_0000847_2781_3749 322
733 3300046459 Ga0495629_0002130 Ga0495629_0002130_10086_11054 322
734 3300046462 Ga0495651_0001256 Ga0495651_0001256_8211_9179 322
735 3300046463 Ga0495653_0001017 Ga0495653_0001017_6792_7760 322
736 3300046473 Ga0495582_0005835 Ga0495582_0005835_439_1407 322
737 3300046475 Ga0495639_0033182 Ga0495639_0033182_101_1069 322
738 3300046476 Ga0495662_0012227 Ga0495662_0012227_2838_3806 322
739 3300046477 Ga0495664_0009316 Ga0495664_0009316_2386_3354 322
740 3300046477 Ga0495664_0013950 Ga0495664_0013950_1227_2195 322
741 3300046499 Ga0495594_0010150 Ga0495594_0010150_480_1448 322
742 3300046511 Ga0495608_0000646 Ga0495608_0000646_16062_17030 322
743 3300046514 Ga0495618_0000819 Ga0495618_0000819_13916_14884 322
744 3300046514 Ga0495618_0001132 Ga0495618_0001132_2831_3799 322
745 3300046517 Ga0495630_0011250 Ga0495630_0011250_1350_2318 322
746 3300046517 Ga0495630_0231864 Ga0495630_0231864_343_1311 322
747 3300046520 Ga0495637_0043145 Ga0495637_0043145_28_996 322
748 3300046526 Ga0495666_0006222 Ga0495666_0006222_2832_3800 322
749 3300046529 Ga0495652_0011396 Ga0495652_0011396_6321_7289 322
750 3300046531 Ga0495665_0022103 Ga0495665_0022103_2249_3217 322
751 3300046533 Ga0495640_0017622 Ga0495640_0017622_2783_3751 322
752 3300046533 Ga0495640_0144951 Ga0495640_0144951_25_993 322
753 3300046536 Ga0495587_0000770 Ga0495587_0000770_12874_13842 322
754 3300046543 Ga0495645_0007688 Ga0495645_0007688_2420_3388 322
755 3300046557 Ga0495622_0059070 Ga0495622_0059070_496_1464 322
756 3300046559 Ga0495667_0009756 Ga0495667_0009756_1922_2890 322
757 3300046642 Ga0495634_0003907 Ga0495634_0003907_3011_3979 322
758 3300046642 Ga0495634_0041891 Ga0495634_0041891_1183_2151 322
759 3300046663 Ga0495635_0000812 Ga0495635_0000812_16694_17662 322
760 3300046663 Ga0495635_0076007 Ga0495635_0076007_430_1398 322
761 3300046674 Ga0495588_0008598 Ga0495588_0008598_2780_3748 322
762 3300046675 Ga0495657_0005959 Ga0495657_0005959_808_1776 322
763 3300046678 Ga0495599_0008486 Ga0495599_0008486_3230_4198 322
764 3300046679 Ga0495623_0001381 Ga0495623_0001381_13172_14140 322
765 3300046681 Ga0495647_0003781 Ga0495647_0003781_2820_3788 322
766 3300046683 Ga0495658_0012531 Ga0495658_0012531_506_1474 322
767 3300046684 Ga0495669_0050559 Ga0495669_0050559_518_1486 322
768 3300046684 Ga0495669_0053619 Ga0495669_0053619_76_1047 322
769 3300046689 Ga0495613_0045613 Ga0495613_0045613_623_1591 322
770 3300046690 Ga0495624_0025898 Ga0495624_0025898_1497_2465 322
771 3300046809 Ga0495600_0009057 Ga0495600_0009057_2507_3475 322
772 3300047315 Ga0495581_0013701 Ga0495581_0013701_2821_3789 322
773 3300047317 Ga0495604_0019293 Ga0495604_0019293_2050_3018 322
774 3300047319 Ga0495674_0003170 Ga0495674_0003170_3709_4677 322
775 3300047319 Ga0495674_0070558 Ga0495674_0070558_406_1374 322
776 3300047321 Ga0495676_0008104 Ga0495676_0008104_4982_5950 322
777 3300047321 Ga0495676_0148786 Ga0495676_0148786_505_1473 322
778 3300047322 Ga0495680_0006835 Ga0495680_0006835_7694_8662 322
779 3300047322 Ga0495680_0149845 Ga0495680_0149845_567_1535 322
780 3300047444 Ga0495675_0001036 Ga0495675_0001036_13990_14958 322
781 3300047673 Ga0495593_0084324 Ga0495593_0084324_81_1049 322
782 3300048088 Ga0495602_0001368 Ga0495602_0001368_17050_18018 322
783 3300048903 Ga0496100_0013020 Ga0496100_0013020_3566_4534 322
784 3300048903 Ga0496100_0013989 Ga0496100_0013989_1801_2769 322
785 3300048904 Ga0496101_0025517 Ga0496101_0025517_85_1053 322
786 3300048905 Ga0496102_0080615 Ga0496102_0080615_508_1476 322
787 3300048905 Ga0496102_0393579 Ga0496102_0393579_113_1081 322
788 3300048907 Ga0496104_0062099 Ga0496104_0062099_1901_2869 322
789 3300048908 Ga0496105_0102107 Ga0496105_0102107_124_1092 322
790 3300048909 Ga0496106_0011982 Ga0496106_0011982_783_1751 322
791 3300048911 Ga0496108_0008415 Ga0496108_0008415_4264_5232 322
792 3300048912 Ga0496109_0000488 Ga0496109_0000488_31558_32526 322
793 3300048912 Ga0496109_0114624 Ga0496109_0114624_1075_2043 322
794 3300048912 Ga0496109_0176780 Ga0496109_0176780_711_1679 322
795 3300048913 Ga0496110_0011628 Ga0496110_0011628_3892_4860 322
796 3300048913 Ga0496110_0049042 Ga0496110_0049042_1387_2355 322
797 3300048914 Ga0496111_0057088 Ga0496111_0057088_880_1848 322
798 3300048915 Ga0496112_0137244 Ga0496112_0137244_389_1357 322
799 3300048915 Ga0496112_0351932 Ga0496112_0351932_403_1371 322
800 3300048916 Ga0496113_0022983 Ga0496113_0022983_1319_2287 322
801 3300048916 Ga0496113_0211452 Ga0496113_0211452_382_1350 322
802 3300048917 Ga0496114_0012742 Ga0496114_0012742_5593_6561 322
803 3300048918 Ga0496115_0015693 Ga0496115_0015693_3082_4050 322
804 3300048918 Ga0496115_0019198 Ga0496115_0019198_2709_3677 322
805 3300049569 Ga0501032_0000129 Ga0501032_0000129_47447_48418 322
806 3300049570 Ga0501033_0001179 Ga0501033_0001179_16792_17763 322
807 3300049571 Ga0501034_0000503 Ga0501034_0000503_22418_23389 322
808 3300049571 Ga0501034_0436204 Ga0501034_0436204_126_1094 322
809 3300049572 Ga0501036_0001453 Ga0501036_0001453_14574_15545 322
810 3300049573 Ga0501037_0000106 Ga0501037_0000106_64106_65077 322
811 3300049574 Ga0501038_0001655 Ga0501038_0001655_14510_15481 322
812 3300049575 Ga0501039_0000416 Ga0501039_0000416_15516_16487 322
813 3300049578 Ga0501042_0016537 Ga0501042_0016537_1708_2679 322
814 3300049579 Ga0501043_0019247 Ga0501043_0019247_1247_2218 322
815 3300049580 Ga0501046_0000235 Ga0501046_0000235_34806_35777 322
816 3300049581 Ga0501047_0000844 Ga0501047_0000844_14404_15375 322
817 3300049582 Ga0501048_0001444 Ga0501048_0001444_2829_3800 322
818 3300049583 Ga0501067_0000160 Ga0501067_0000160_26454_27425 322
819 3300049584 Ga0501068_0000014 Ga0501068_0000014_7674_8645 322
820 3300049585 Ga0501069_0004593 Ga0501069_0004593_3790_4761 322
821 3300049586 Ga0501070_0034852 Ga0501070_0034852_252_1223 322
822 3300049586 Ga0501070_0123779 Ga0501070_0123779_978_1946 322
823 3300049588 Ga0501072_0001159 Ga0501072_0001159_2317_3288 322
824 3300049588 Ga0501072_0022832 Ga0501072_0022832_892_1860 322
825 3300049589 Ga0501073_0000417 Ga0501073_0000417_752_1723 322
826 3300049590 Ga0501074_0001839 Ga0501074_0001839_619_1590 322
827 3300049741 Ga0501079_0000261 Ga0501079_0000261_4029_5000 322
828 3300049742 Ga0501080_0000917 Ga0501080_0000917_10852_11823 322
829 3300049742 Ga0501080_0177694 Ga0501080_0177694_387_1355 322
830 3300049744 Ga0501083_0000301 Ga0501083_0000301_26343_27314 322
831 3300049822 Ga0501035_0000324 Ga0501035_0000324_31909_32880 322
832 3300049823 Ga0501044_0000051 Ga0501044_0000051_128204_129175 322
833 3300049823 Ga0501044_0000084 Ga0501044_0000084_49347_50330 322
834 3300049823 Ga0501044_0103933 Ga0501044_0103933_1038_2006 322
835 3300050494 nmdc:mga06z11_6052_c1 nmdc:mga06z11_6052_c1_1693_2661 322
836 3300050496 nmdc:mga07m45_60952_c1 nmdc:mga07m45_60952_c1_692_1660 322
837 3300050507 nmdc:mga05p37_2742_c1 nmdc:mga05p37_2742_c1_17760_18728 322
838 3300050507 nmdc:mga05p37_505_c1 nmdc:mga05p37_505_c1_39066_40037 322
839 3300050508 nmdc:mga09592_772_c1 nmdc:mga09592_772_c1_977_1948 322
840 3300050509 nmdc:mga0qj67_165_c1 nmdc:mga0qj67_165_c1_29451_30422 322
841 3300050510 nmdc:mga06r32_513_c1 nmdc:mga06r32_513_c1_29378_30349 322
842 3300050511 nmdc:mga08y16_2844_c1 nmdc:mga08y16_2844_c1_3062_4033 322
843 3300050511 nmdc:mga08y16_35524_c1 nmdc:mga08y16_35524_c1_1878_2846 322
844 3300050512 nmdc:mga0n895_20210_c1 nmdc:mga0n895_20210_c1_5091_6059 322
845 3300050512 nmdc:mga0n895_3322_c1 nmdc:mga0n895_3322_c1_6626_7597 322
846 3300050513 nmdc:mga0rr50_1278_c1 nmdc:mga0rr50_1278_c1_7209_8180 322
847 3300050515 nmdc:mga0a205_1632_c1 nmdc:mga0a205_1632_c1_8269_9240 322
848 3300050515 nmdc:mga0a205_26496_c1 nmdc:mga0a205_26496_c1_683_1651 322
849 3300050515 nmdc:mga0a205_6515_c2 nmdc:mga0a205_6515_c2_8352_9320 322
850 3300053077 Ga0495601_0004638 Ga0495601_0004638_5111_6079 322
851 3300053077 Ga0495601_0007149 Ga0495601_0007149_3805_4773 322
852 3300053078 Ga0495612_0012825 Ga0495612_0012825_533_1501 322
853 3300053078 Ga0495612_0019874 Ga0495612_0019874_1700_2668 322
854 3300053084 Ga0495595_0000253 Ga0495595_0000253_1922_2890 322
855 3300053084 Ga0495595_0154729 Ga0495595_0154729_14_982 322
856 3300053085 Ga0495619_0027382 Ga0495619_0027382_876_1844 322
857 3300053085 Ga0495619_0144309 Ga0495619_0144309_460_1428 322
858 3300053085 Ga0495619_0148649 Ga0495619_0148649_115_1083 322
859 3300053119 Ga0500595_000002 Ga0500595_000002_710051_711031 322
860 3300053153 Ga0500616_0047881 Ga0500616_0047881_412_1440 322
861 3300054114 Ga0501084_0014689 Ga0501084_0014689_1964_2935 322
862 3300060353 Ga0501082_0018584 Ga0501082_0018584_2790_3761 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

43

326

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5377 22 306
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5276 37 304
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5157 22 306
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4996 15 281
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.4905 17 303
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8366 40 307 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7935 42 302 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7929 38 302 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7874 38 302 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7852 38 302 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A522JLP9-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9945 21 259 GO:0005886
GO:0015658
AF-A0A519ZAF0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9931 20 249 GO:0005886
GO:0015658
AF-A0A3D3SVL4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9918 45 259 GO:0005886
GO:0015658
AF-A0A1F4HPC3-F1-model_v4 deleted 0.9906 17 262
AF-A0A530R883-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9903 18 281 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
88.99 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map