F483901
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 862 | 512 | 813 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0009287|Ga0501070_0009287_675_1709 |
| Length | 344 |
| Sequence | MATAAPGIMATGGAARVGMERSEIVAFVLMLAVLIVAPNVVYPLFVMQVLCFAIFACAFNLLIGYVGLLSFGHALYFGWASYVSAHLAKVGAIGIPYWAGGWHWFVIPLPPMPPEIAILGGTLTAAVLGLIAGALAIRRQGIYFAMITLALAQMMYFFAIQAPFTHGEDGIQGVPRGVMFGLFDLRDETTMYAVVLAIFVACFLLIYRIIHSPFGEVIKAIRENETRAISLGYKTDRYKLMTFVLSAALTGVAGSTKAIVFQLASLTDVHWAMSGEVVLMTLIGGLGTIFGPVVGAFVIIAMQNYLSGFDQWVTVIQGAIFVACVMLFRRGVIGEFAHILRIKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 2 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 7 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 8 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 9 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 10 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 11 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 12 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 13 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 14 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 15 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 16 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 17 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 18 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 19 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 20 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 21 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 22 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 23 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 24 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 25 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 26 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 27 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 28 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 29 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 30 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 31 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 32 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 33 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 34 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 35 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 36 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 37 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 38 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 39 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 40 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 41 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 42 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 43 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 44 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 45 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 46 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 47 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 48 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 49 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 50 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 51 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 52 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 53 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 54 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 55 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 56 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 57 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 58 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 59 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 60 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 65 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 72 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 76 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 89 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 106 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 112 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 122 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 123 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 124 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 126 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 127 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 128 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 129 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 130 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 131 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 132 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 133 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 134 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 135 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 136 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 137 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 138 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 139 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 141 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 142 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 143 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 144 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 145 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 146 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 147 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 148 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 149 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 151 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 152 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 153 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 154 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 155 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 156 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 157 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 158 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 159 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 160 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 162 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 163 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 178 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 179 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 193 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 194 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 195 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 196 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 197 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 198 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 276 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 280 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 281 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 283 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 284 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 285 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 286 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 287 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 288 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 289 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 290 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 291 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 292 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 293 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 294 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 295 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 296 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 297 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 298 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 299 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 300 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 301 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 302 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 303 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 304 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 305 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 307 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 308 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 310 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 311 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 312 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 314 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 315 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 316 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 317 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 318 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 319 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 320 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 323 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 324 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 325 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 326 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 327 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 328 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 329 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 330 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 331 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 332 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 333 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 334 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 335 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 336 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 337 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 338 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 339 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 340 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 341 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 342 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 343 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 344 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 345 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 346 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 406 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 407 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 408 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 409 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 410 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 413 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 414 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 415 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 416 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 417 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 418 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 419 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 420 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 421 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 422 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 423 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 424 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 425 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 426 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 427 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 458 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 459 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 460 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 461 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 462 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 463 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 464 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 474 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 477 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 480 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 481 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 482 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 483 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 484 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 485 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 486 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 487 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 488 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 489 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 490 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 491 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 492 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 493 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 494 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 495 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 496 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 497 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 499 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 500 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 501 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 502 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 503 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 504 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 505 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 506 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 508 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 511 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 512 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.32 |
| Metatranscriptomes | 0 |
| Isolates | 5.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.51 |
| Nodule | 1.97 |
| Rhizoplane | 6.03 |
| Rhizosphere | 76.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10012501 | 3300001979 | Bacteria | 3198 |
| 2 | JGI24739J22299_10010613 | 3300001989 | Bacteria | 3417 |
| 3 | JGI24737J22298_10003981 | 3300001990 | Bacteria | 5169 |
| 4 | JGI24750J21931_1000181 | 3300002070 | Bacteria | 10568 |
| 5 | JGI24748J21848_1000571 | 3300002074 | Bacteria | 3977 |
| 6 | JGI24738J21930_10001393 | 3300002075 | Bacteria | 6712 |
| 7 | JGI24749J21850_1001394 | 3300002076 | Bacteria | 3429 |
| 8 | JGI24744J21845_10000700 | 3300002077 | Bacteria | 6195 |
| 9 | JGI24035J26624_1001034 | 3300002126 | Bacteria | 2632 |
| 10 | JGI24033J26618_1000816 | 3300002155 | Bacteria | 2982 |
| 11 | JGI24034J26672_10000836 | 3300002239 | Bacteria | 4000 |
| 12 | JGI24742J22300_10001030 | 3300002244 | Bacteria | 4296 |
| 13 | JGI25404J52841_10002372 | 3300003659 | Bacteria | 3553 |
| 14 | Ga0055529_1009397 | 3300003763 | Bacteria | 1284 |
| 15 | JGI25405J52794_10016871 | 3300003911 | Bacteria | 1445 |
| 16 | Ga0065704_10093664 | 3300005289 | Bacteria | 2584 |
| 17 | Ga0065712_10078399 | 3300005290 | Bacteria | 3350 |
| 18 | Ga0065715_10089022 | 3300005293 | Bacteria | 16633 |
| 19 | Ga0070676_10002898 | 3300005328 | Bacteria | 8857 |
| 20 | Ga0070683_100001166 | 3300005329 | Bacteria | 19905 |
| 21 | Ga0070690_100229444 | 3300005330 | Bacteria | 1305 |
| 22 | Ga0070670_100003635 | 3300005331 | Bacteria | 12843 |
| 23 | Ga0070677_10000126 | 3300005333 | Bacteria | 25482 |
| 24 | Ga0068869_100009659 | 3300005334 | Bacteria | 6264 |
| 25 | Ga0070666_10018143 | 3300005335 | Bacteria | 4520 |
| 26 | Ga0070680_100013378 | 3300005336 | Bacteria | 6389 |
| 27 | Ga0070680_100153986 | 3300005336 | Bacteria | 1931 |
| 28 | Ga0070682_100003724 | 3300005337 | Bacteria | 8473 |
| 29 | Ga0070682_100100059 | 3300005337 | Bacteria | 1912 |
| 30 | Ga0068868_100003027 | 3300005338 | Bacteria | 11693 |
| 31 | Ga0070660_100010060 | 3300005339 | Bacteria | 6672 |
| 32 | Ga0070660_100051659 | 3300005339 | Bacteria | 3166 |
| 33 | Ga0070660_100164105 | 3300005339 | Bacteria | 1791 |
| 34 | Ga0070689_100003384 | 3300005340 | Bacteria | 10600 |
| 35 | Ga0070689_100018800 | 3300005340 | Bacteria | 5099 |
| 36 | Ga0070691_10000994 | 3300005341 | Bacteria | 11602 |
| 37 | Ga0070687_100000085 | 3300005343 | Bacteria | 30647 |
| 38 | Ga0070661_100000307 | 3300005344 | Bacteria | 39479 |
| 39 | Ga0070692_10002518 | 3300005345 | Bacteria | 7129 |
| 40 | Ga0070692_10029229 | 3300005345 | Bacteria | 2745 |
| 41 | Ga0070668_100001248 | 3300005347 | Bacteria | 18134 |
| 42 | Ga0070669_100005868 | 3300005353 | Bacteria | 8857 |
| 43 | Ga0070675_100024482 | 3300005354 | Bacteria | 4834 |
| 44 | Ga0070675_100110171 | 3300005354 | Bacteria | 2328 |
| 45 | Ga0070671_100009899 | 3300005355 | Bacteria | 7656 |
| 46 | Ga0070674_100003469 | 3300005356 | Bacteria | 8857 |
| 47 | Ga0070673_100000152 | 3300005364 | Bacteria | 33183 |
| 48 | Ga0070688_100000558 | 3300005365 | Bacteria | 18862 |
| 49 | Ga0070659_100010268 | 3300005366 | Bacteria | 6888 |
| 50 | Ga0070659_100174159 | 3300005366 | Bacteria | 1764 |
| 51 | Ga0070667_100005640 | 3300005367 | Bacteria | 10453 |
| 52 | Ga0070667_100071738 | 3300005367 | Bacteria | 2950 |
| 53 | Ga0070709_10005546 | 3300005434 | Bacteria | 6830 |
| 54 | Ga0070714_100009084 | 3300005435 | Bacteria | 7794 |
| 55 | Ga0070713_100006662 | 3300005436 | Bacteria | 8035 |
| 56 | Ga0070713_100191199 | 3300005436 | Bacteria | 1844 |
| 57 | Ga0070710_10001257 | 3300005437 | Bacteria | 12039 |
| 58 | Ga0070710_10101024 | 3300005437 | Bacteria | 1718 |
| 59 | Ga0070701_10006397 | 3300005438 | Bacteria | 4954 |
| 60 | Ga0070701_10138846 | 3300005438 | Bacteria | 1388 |
| 61 | Ga0070711_100045845 | 3300005439 | Bacteria | 2976 |
| 62 | Ga0070711_100079531 | 3300005439 | Bacteria | 2332 |
| 63 | Ga0070711_100144734 | 3300005439 | Bacteria | 1786 |
| 64 | Ga0070705_100005321 | 3300005440 | Bacteria | 6264 |
| 65 | Ga0070700_100002863 | 3300005441 | Bacteria | 8853 |
| 66 | Ga0070700_100098089 | 3300005441 | Bacteria | 1926 |
| 67 | Ga0070694_100001507 | 3300005444 | Bacteria | 13661 |
| 68 | Ga0070694_100158080 | 3300005444 | Bacteria | 1661 |
| 69 | Ga0070708_100167806 | 3300005445 | Bacteria | 2048 |
| 70 | Ga0070663_100000522 | 3300005455 | Bacteria | 20244 |
| 71 | Ga0070663_100141534 | 3300005455 | Bacteria | 1837 |
| 72 | Ga0070678_100040107 | 3300005456 | Bacteria | 3310 |
| 73 | Ga0070662_100001666 | 3300005457 | Bacteria | 13661 |
| 74 | Ga0070681_10017661 | 3300005458 | Bacteria | 7129 |
| 75 | Ga0068867_100005662 | 3300005459 | Bacteria | 8853 |
| 76 | Ga0070685_10006948 | 3300005466 | Bacteria | 5775 |
| 77 | Ga0070699_100174889 | 3300005518 | Bacteria | 1903 |
| 78 | Ga0070679_100007489 | 3300005530 | Bacteria | 10209 |
| 79 | Ga0070679_100154571 | 3300005530 | Bacteria | 2269 |
| 80 | Ga0070679_100194254 | 3300005530 | Bacteria | 1997 |
| 81 | Ga0070684_100000894 | 3300005535 | Bacteria | 21105 |
| 82 | Ga0070697_100000168 | 3300005536 | Bacteria | 52931 |
| 83 | Ga0068853_100010158 | 3300005539 | Bacteria | 7605 |
| 84 | Ga0070672_100011122 | 3300005543 | Bacteria | 6268 |
| 85 | Ga0070686_100016131 | 3300005544 | Bacteria | 4341 |
| 86 | Ga0070686_100130355 | 3300005544 | Bacteria | 1738 |
| 87 | Ga0070695_100031469 | 3300005545 | Bacteria | 3310 |
| 88 | Ga0070695_100111168 | 3300005545 | Bacteria | 1859 |
| 89 | Ga0070696_100005009 | 3300005546 | Bacteria | 8853 |
| 90 | Ga0070696_100020495 | 3300005546 | Bacteria | 4479 |
| 91 | Ga0070693_100000134 | 3300005547 | Bacteria | 33408 |
| 92 | Ga0070665_100059697 | 3300005548 | Bacteria | 3823 |
| 93 | Ga0070704_100000428 | 3300005549 | Bacteria | 19609 |
| 94 | Ga0068855_100007545 | 3300005563 | Bacteria | 13158 |
| 95 | Ga0068855_100010956 | 3300005563 | Bacteria | 10939 |
| 96 | Ga0070664_100026882 | 3300005564 | Bacteria | 4779 |
| 97 | Ga0068857_100011473 | 3300005577 | Bacteria | 7708 |
| 98 | Ga0068854_100005312 | 3300005578 | Bacteria | 8130 |
| 99 | Ga0068856_100021406 | 3300005614 | Bacteria | 6286 |
| 100 | Ga0068856_100114383 | 3300005614 | Bacteria | 2697 |
| 101 | Ga0068856_100201154 | 3300005614 | Bacteria | 2006 |
| 102 | Ga0070702_100000638 | 3300005615 | Bacteria | 12987 |
| 103 | Ga0068852_100002115 | 3300005616 | Bacteria | 13595 |
| 104 | Ga0068852_100004876 | 3300005616 | Bacteria | 9529 |
| 105 | Ga0068859_100006242 | 3300005617 | Bacteria | 12100 |
| 106 | Ga0068864_100028055 | 3300005618 | Bacteria | 4757 |
| 107 | Ga0068866_10000301 | 3300005718 | Bacteria | 23583 |
| 108 | Ga0068861_100057538 | 3300005719 | Bacteria | 2970 |
| 109 | Ga0068861_100262545 | 3300005719 | Bacteria | 1479 |
| 110 | Ga0068870_10000354 | 3300005840 | Bacteria | 17200 |
| 111 | Ga0068863_100000340 | 3300005841 | Bacteria | 47641 |
| 112 | Ga0068858_100009915 | 3300005842 | Bacteria | 9049 |
| 113 | Ga0068858_100267039 | 3300005842 | Bacteria | 1627 |
| 114 | Ga0068860_100013035 | 3300005843 | Bacteria | 8161 |
| 115 | Ga0068862_100015630 | 3300005844 | Bacteria | 6304 |
| 116 | Ga0068862_100227314 | 3300005844 | Bacteria | 1691 |
| 117 | Ga0081455_10000982 | 3300005937 | Bacteria | 36310 |
| 118 | Ga0081455_10081734 | 3300005937 | Bacteria | 2645 |
| 119 | Ga0081538_10040168 | 3300005981 | Bacteria | 2988 |
| 120 | Ga0081538_10041578 | 3300005981 | Bacteria | 2915 |
| 121 | Ga0081540_1002120 | 3300005983 | Bacteria | 16520 |
| 122 | Ga0081540_1032154 | 3300005983 | Bacteria | 2870 |
| 123 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 124 | Ga0070717_10008461 | 3300006028 | Bacteria | 7687 |
| 125 | Ga0070717_10316573 | 3300006028 | Bacteria | 1389 |
| 126 | Ga0070717_10343363 | 3300006028 | Bacteria | 1334 |
| 127 | Ga0075365_10048318 | 3300006038 | Bacteria | 2800 |
| 128 | Ga0075365_10150789 | 3300006038 | Bacteria | 1617 |
| 129 | Ga0075365_10213019 | 3300006038 | Bacteria | 1355 |
| 130 | Ga0075363_100005844 | 3300006048 | Bacteria | 5531 |
| 131 | Ga0075364_10002167 | 3300006051 | Bacteria | 11001 |
| 132 | Ga0075364_10021617 | 3300006051 | Bacteria | 4055 |
| 133 | Ga0075364_10065465 | 3300006051 | Bacteria | 2386 |
| 134 | Ga0075364_10175131 | 3300006051 | Bacteria | 1451 |
| 135 | Ga0070715_10000384 | 3300006163 | Bacteria | 11062 |
| 136 | Ga0070712_100000213 | 3300006175 | Bacteria | 32735 |
| 137 | Ga0070712_100084293 | 3300006175 | Bacteria | 2310 |
| 138 | Ga0070712_100271797 | 3300006175 | Bacteria | 1362 |
| 139 | Ga0075362_10015262 | 3300006177 | Bacteria | 3120 |
| 140 | Ga0075367_10012900 | 3300006178 | Bacteria | 4476 |
| 141 | Ga0075367_10019691 | 3300006178 | Bacteria | 3746 |
| 142 | Ga0075369_10008188 | 3300006186 | Bacteria | 4013 |
| 143 | Ga0075369_10016682 | 3300006186 | Bacteria | 2967 |
| 144 | Ga0075369_10064502 | 3300006186 | Bacteria | 1604 |
| 145 | Ga0075366_10016883 | 3300006195 | Bacteria | 4195 |
| 146 | Ga0097621_100000040 | 3300006237 | Bacteria | 66339 |
| 147 | Ga0075370_10009628 | 3300006353 | Bacteria | 5027 |
| 148 | Ga0075370_10048586 | 3300006353 | Bacteria | 2404 |
| 149 | Ga0068871_100000301 | 3300006358 | Bacteria | 34368 |
| 150 | Ga0075428_100003180 | 3300006844 | Bacteria | 17952 |
| 151 | Ga0075428_100103893 | 3300006844 | Bacteria | 3098 |
| 152 | Ga0075430_100000201 | 3300006846 | Bacteria | 40551 |
| 153 | Ga0075431_100000260 | 3300006847 | Bacteria | 40551 |
| 154 | Ga0075431_100014864 | 3300006847 | Bacteria | 7880 |
| 155 | Ga0075433_10000007 | 3300006852 | Bacteria | 75995 |
| 156 | Ga0075433_10009124 | 3300006852 | Bacteria | 7919 |
| 157 | Ga0075434_100000091 | 3300006871 | Bacteria | 49489 |
| 158 | Ga0075434_100017859 | 3300006871 | Bacteria | 6843 |
| 159 | Ga0075434_100104601 | 3300006871 | Bacteria | 2840 |
| 160 | Ga0075429_100001824 | 3300006880 | Bacteria | 17627 |
| 161 | Ga0068865_100000275 | 3300006881 | Bacteria | 28270 |
| 162 | Ga0075436_100000192 | 3300006914 | Bacteria | 37698 |
| 163 | Ga0097620_100006242 | 3300006931 | Bacteria | 12100 |
| 164 | Ga0075435_100010439 | 3300007076 | Bacteria | 6794 |
| 165 | Ga0075435_100366660 | 3300007076 | Bacteria | 1236 |
| 166 | Ga0099794_10096984 | 3300007265 | Bacteria | 1468 |
| 167 | Ga0105240_10002078 | 3300009093 | Bacteria | 32819 |
| 168 | Ga0105240_10070766 | 3300009093 | Bacteria | 4314 |
| 169 | Ga0111539_10013469 | 3300009094 | Bacteria | 10221 |
| 170 | Ga0111539_10425447 | 3300009094 | Bacteria | 1547 |
| 171 | Ga0105245_10010701 | 3300009098 | Bacteria | 7981 |
| 172 | Ga0105245_10056957 | 3300009098 | Bacteria | 3514 |
| 173 | Ga0105245_10140599 | 3300009098 | Bacteria | 2273 |
| 174 | Ga0105247_10018307 | 3300009101 | Bacteria | 4203 |
| 175 | Ga0114129_10002772 | 3300009147 | Bacteria | 24406 |
| 176 | Ga0105243_10004388 | 3300009148 | Bacteria | 11162 |
| 177 | Ga0105241_10001943 | 3300009174 | Bacteria | 15638 |
| 178 | Ga0105241_10016563 | 3300009174 | Bacteria | 5407 |
| 179 | Ga0105241_10372184 | 3300009174 | Bacteria | 1246 |
| 180 | Ga0105242_10007706 | 3300009176 | Bacteria | 8285 |
| 181 | Ga0105242_10019682 | 3300009176 | Bacteria | 5290 |
| 182 | Ga0105248_10003102 | 3300009177 | Bacteria | 18407 |
| 183 | Ga0105248_10043504 | 3300009177 | Bacteria | 5035 |
| 184 | Ga0105248_10069324 | 3300009177 | Bacteria | 3959 |
| 185 | Ga0105237_10015521 | 3300009545 | Bacteria | 7925 |
| 186 | Ga0105237_10054424 | 3300009545 | Bacteria | 4009 |
| 187 | Ga0105238_10052558 | 3300009551 | Bacteria | 4096 |
| 188 | Ga0105238_10268966 | 3300009551 | Bacteria | 1685 |
| 189 | Ga0105249_10001599 | 3300009553 | Bacteria | 19830 |
| 190 | Ga0105239_10009271 | 3300010375 | Bacteria | 11127 |
| 191 | Ga0105239_10009752 | 3300010375 | Bacteria | 10796 |
| 192 | Ga0105239_10095136 | 3300010375 | Bacteria | 3291 |
| 193 | Ga0105239_10288768 | 3300010375 | Bacteria | 1847 |
| 194 | Ga0105246_10007217 | 3300011119 | Bacteria | 6810 |
| 195 | Ga0105246_10058939 | 3300011119 | Bacteria | 2662 |
| 196 | Ga0157323_1000404 | 3300012495 | Bacteria | 1898 |
| 197 | Ga0157342_1004325 | 3300012507 | Bacteria | 1257 |
| 198 | Ga0157371_10010606 | 3300013102 | Bacteria | 7160 |
| 199 | Ga0157370_10078491 | 3300013104 | Bacteria | 3109 |
| 200 | Ga0157374_10001695 | 3300013296 | Bacteria | 18451 |
| 201 | Ga0157378_10003374 | 3300013297 | Bacteria | 14202 |
| 202 | Ga0157378_10069939 | 3300013297 | Bacteria | 3150 |
| 203 | Ga0157378_10128094 | 3300013297 | Bacteria | 2347 |
| 204 | Ga0157378_10163081 | 3300013297 | Bacteria | 2086 |
| 205 | Ga0163162_10010828 | 3300013306 | Bacteria | 8874 |
| 206 | Ga0157372_10004321 | 3300013307 | Bacteria | 15190 |
| 207 | Ga0157372_10148826 | 3300013307 | Bacteria | 2701 |
| 208 | Ga0157372_10580702 | 3300013307 | Bacteria | 1306 |
| 209 | Ga0157375_10008254 | 3300013308 | Bacteria | 9115 |
| 210 | Ga0163163_10002228 | 3300014325 | Bacteria | 16316 |
| 211 | Ga0163163_10013922 | 3300014325 | Bacteria | 7379 |
| 212 | Ga0157380_10000891 | 3300014326 | Bacteria | 18753 |
| 213 | Ga0157380_10461852 | 3300014326 | Bacteria | 1222 |
| 214 | Ga0157377_10000517 | 3300014745 | Bacteria | 16366 |
| 215 | Ga0157379_10011995 | 3300014968 | Bacteria | 7571 |
| 216 | Ga0157379_10068978 | 3300014968 | Bacteria | 3161 |
| 217 | Ga0157376_10000088 | 3300014969 | Bacteria | 70084 |
| 218 | Ga0157376_10111465 | 3300014969 | Bacteria | 2409 |
| 219 | Ga0163161_10000144 | 3300017792 | Bacteria | 64771 |
| 220 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 221 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 222 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 223 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 224 | Ga0213876_10025508 | 3300021384 | Bacteria | 3117 |
| 225 | Ga0213876_10074468 | 3300021384 | Bacteria | 1793 |
| 226 | Ga0213875_10000023 | 3300021388 | Bacteria | 213455 |
| 227 | Ga0209677_103988 | 3300025253 | Bacteria | 4473 |
| 228 | Ga0209148_1000841 | 3300025254 | Bacteria | 21793 |
| 229 | Ga0209233_1025604 | 3300025261 | Bacteria | 1456 |
| 230 | Ga0207666_1000059 | 3300025271 | Bacteria | 19909 |
| 231 | Ga0207666_1002359 | 3300025271 | Bacteria | 2271 |
| 232 | Ga0209455_1003926 | 3300025272 | Bacteria | 5064 |
| 233 | Ga0207673_1000330 | 3300025290 | Bacteria | 4761 |
| 234 | Ga0209564_1009425 | 3300025295 | Bacteria | 4648 |
| 235 | Ga0209758_1003241 | 3300025297 | Bacteria | 15100 |
| 236 | Ga0207426_1002280 | 3300025302 | Bacteria | 12650 |
| 237 | Ga0207697_10005773 | 3300025315 | Bacteria | 5706 |
| 238 | Ga0207653_10002470 | 3300025885 | Bacteria | 5874 |
| 239 | Ga0207682_10000509 | 3300025893 | Bacteria | 17874 |
| 240 | Ga0207692_10000214 | 3300025898 | Bacteria | 19493 |
| 241 | Ga0207642_10006243 | 3300025899 | Bacteria | 3952 |
| 242 | Ga0207710_10006153 | 3300025900 | Bacteria | 5135 |
| 243 | Ga0207688_10000167 | 3300025901 | Bacteria | 28809 |
| 244 | Ga0207680_10042799 | 3300025903 | Bacteria | 2652 |
| 245 | Ga0207680_10106766 | 3300025903 | Bacteria | 1809 |
| 246 | Ga0207647_10006799 | 3300025904 | Bacteria | 8296 |
| 247 | Ga0207685_10012312 | 3300025905 | Bacteria | 2606 |
| 248 | Ga0207699_10015419 | 3300025906 | Bacteria | 3969 |
| 249 | Ga0207645_10000100 | 3300025907 | Bacteria | 64057 |
| 250 | Ga0207645_10071803 | 3300025907 | Bacteria | 2216 |
| 251 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 252 | Ga0207705_10018696 | 3300025909 | Bacteria | 4958 |
| 253 | Ga0207705_10120672 | 3300025909 | Bacteria | 1945 |
| 254 | Ga0207654_10053478 | 3300025911 | Bacteria | 2331 |
| 255 | Ga0207707_10005018 | 3300025912 | Bacteria | 11624 |
| 256 | Ga0207707_10013921 | 3300025912 | Bacteria | 7014 |
| 257 | Ga0207707_10398898 | 3300025912 | Bacteria | 1181 |
| 258 | Ga0207695_10000910 | 3300025913 | Bacteria | 53286 |
| 259 | Ga0207671_10002587 | 3300025914 | Bacteria | 19123 |
| 260 | Ga0207671_10097263 | 3300025914 | Bacteria | 2225 |
| 261 | Ga0207693_10000888 | 3300025915 | Bacteria | 26823 |
| 262 | Ga0207693_10026683 | 3300025915 | Bacteria | 4570 |
| 263 | Ga0207693_10244667 | 3300025915 | Bacteria | 1408 |
| 264 | Ga0207663_10000628 | 3300025916 | Bacteria | 15643 |
| 265 | Ga0207663_10109900 | 3300025916 | Bacteria | 1869 |
| 266 | Ga0207660_10000041 | 3300025917 | Bacteria | 63485 |
| 267 | Ga0207662_10000195 | 3300025918 | Bacteria | 28315 |
| 268 | Ga0207657_10002386 | 3300025919 | Bacteria | 20326 |
| 269 | Ga0207657_10009921 | 3300025919 | Bacteria | 9530 |
| 270 | Ga0207657_10027937 | 3300025919 | Bacteria | 5157 |
| 271 | Ga0207649_10001482 | 3300025920 | Bacteria | 13783 |
| 272 | Ga0207652_10002995 | 3300025921 | Bacteria | 14105 |
| 273 | Ga0207652_10022353 | 3300025921 | Bacteria | 5231 |
| 274 | Ga0207681_10001546 | 3300025923 | Bacteria | 14821 |
| 275 | Ga0207694_10030806 | 3300025924 | Bacteria | 4095 |
| 276 | Ga0207694_10171704 | 3300025924 | Bacteria | 1756 |
| 277 | Ga0207650_10001317 | 3300025925 | Bacteria | 17984 |
| 278 | Ga0207659_10003760 | 3300025926 | Bacteria | 9152 |
| 279 | Ga0207687_10000072 | 3300025927 | Bacteria | 76222 |
| 280 | Ga0207687_10032877 | 3300025927 | Bacteria | 3516 |
| 281 | Ga0207700_10006989 | 3300025928 | Bacteria | 6868 |
| 282 | Ga0207644_10001292 | 3300025931 | Bacteria | 16118 |
| 283 | Ga0207644_10044109 | 3300025931 | Bacteria | 3167 |
| 284 | Ga0207690_10004975 | 3300025932 | Bacteria | 7849 |
| 285 | Ga0207706_10010659 | 3300025933 | Bacteria | 8395 |
| 286 | Ga0207706_10123401 | 3300025933 | Bacteria | 2278 |
| 287 | Ga0207686_10001034 | 3300025934 | Bacteria | 16473 |
| 288 | Ga0207686_10096001 | 3300025934 | Bacteria | 1968 |
| 289 | Ga0207709_10001423 | 3300025935 | Bacteria | 16760 |
| 290 | Ga0207670_10007269 | 3300025936 | Bacteria | 6170 |
| 291 | Ga0207669_10000176 | 3300025937 | Bacteria | 29979 |
| 292 | Ga0207704_10013299 | 3300025938 | Bacteria | 4114 |
| 293 | Ga0207665_10001305 | 3300025939 | Bacteria | 16794 |
| 294 | Ga0207691_10008719 | 3300025940 | Bacteria | 9727 |
| 295 | Ga0207711_10001106 | 3300025941 | Bacteria | 25759 |
| 296 | Ga0207711_10054504 | 3300025941 | Bacteria | 3432 |
| 297 | Ga0207689_10000366 | 3300025942 | Bacteria | 42711 |
| 298 | Ga0207689_10037239 | 3300025942 | Bacteria | 4035 |
| 299 | Ga0207689_10266200 | 3300025942 | Bacteria | 1418 |
| 300 | Ga0207661_10000087 | 3300025944 | Bacteria | 63263 |
| 301 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 302 | Ga0207679_10339267 | 3300025945 | Bacteria | 1306 |
| 303 | Ga0207667_10009257 | 3300025949 | Bacteria | 11628 |
| 304 | Ga0207667_10186996 | 3300025949 | Bacteria | 2126 |
| 305 | Ga0207651_10001426 | 3300025960 | Bacteria | 10879 |
| 306 | Ga0207712_10001547 | 3300025961 | Bacteria | 15511 |
| 307 | Ga0207712_10140029 | 3300025961 | Bacteria | 1855 |
| 308 | Ga0207668_10007326 | 3300025972 | Bacteria | 6556 |
| 309 | Ga0207640_10001474 | 3300025981 | Bacteria | 12692 |
| 310 | Ga0207640_10288556 | 3300025981 | Bacteria | 1293 |
| 311 | Ga0207640_10378418 | 3300025981 | Bacteria | 1146 |
| 312 | Ga0207658_10005146 | 3300025986 | Bacteria | 9004 |
| 313 | Ga0207703_10003109 | 3300026035 | Bacteria | 14015 |
| 314 | Ga0207703_10117473 | 3300026035 | Bacteria | 2279 |
| 315 | Ga0207639_10009108 | 3300026041 | Bacteria | 6840 |
| 316 | Ga0207678_10007393 | 3300026067 | Bacteria | 9727 |
| 317 | Ga0207678_10039128 | 3300026067 | Bacteria | 4116 |
| 318 | Ga0207678_10077913 | 3300026067 | Bacteria | 2839 |
| 319 | Ga0207708_10007017 | 3300026075 | Bacteria | 8325 |
| 320 | Ga0207708_10012400 | 3300026075 | Bacteria | 6353 |
| 321 | Ga0207708_10088527 | 3300026075 | Bacteria | 2385 |
| 322 | Ga0207702_10015638 | 3300026078 | Bacteria | 6281 |
| 323 | Ga0207702_10056447 | 3300026078 | Bacteria | 3334 |
| 324 | Ga0207702_10348794 | 3300026078 | Bacteria | 1416 |
| 325 | Ga0207641_10011956 | 3300026088 | Bacteria | 7121 |
| 326 | Ga0207648_10008796 | 3300026089 | Bacteria | 9727 |
| 327 | Ga0207676_10004807 | 3300026095 | Bacteria | 9584 |
| 328 | Ga0207674_10000697 | 3300026116 | Bacteria | 43729 |
| 329 | Ga0207674_10116666 | 3300026116 | Bacteria | 2640 |
| 330 | Ga0207675_100005465 | 3300026118 | Bacteria | 12176 |
| 331 | Ga0207675_100220039 | 3300026118 | Bacteria | 1829 |
| 332 | Ga0207683_10000029 | 3300026121 | Bacteria | 109665 |
| 333 | Ga0207683_10312162 | 3300026121 | Bacteria | 1439 |
| 334 | Ga0207698_10018865 | 3300026142 | Bacteria | 4711 |
| 335 | Ga0210002_1001959 | 3300027617 | Bacteria | 2956 |
| 336 | Ga0209971_1003527 | 3300027682 | Bacteria | 3701 |
| 337 | Ga0209966_1001374 | 3300027695 | Bacteria | 4257 |
| 338 | Ga0209966_1003142 | 3300027695 | Bacteria | 2771 |
| 339 | Ga0209998_10001898 | 3300027717 | Bacteria | 4926 |
| 340 | Ga0209998_10005560 | 3300027717 | Bacteria | 2635 |
| 341 | Ga0209974_10002097 | 3300027876 | Bacteria | 7300 |
| 342 | Ga0207428_10000100 | 3300027907 | Bacteria | 119495 |
| 343 | Ga0207428_10000115 | 3300027907 | Bacteria | 109072 |
| 344 | Ga0268266_10040823 | 3300028379 | Bacteria | 3956 |
| 345 | Ga0268265_10024411 | 3300028380 | Bacteria | 4276 |
| 346 | Ga0268264_10002968 | 3300028381 | Bacteria | 14738 |
| 347 | Ga0265337_1000769 | 3300028556 | Bacteria | 16920 |
| 348 | Ga0307515_10056876 | 3300028794 | Bacteria | 5673 |
| 349 | Ga0265330_10004928 | 3300031235 | Bacteria | 6724 |
| 350 | Ga0265340_10000710 | 3300031247 | Bacteria | 18813 |
| 351 | Ga0265340_10022433 | 3300031247 | Bacteria | 3227 |
| 352 | Ga0265331_10017934 | 3300031250 | Bacteria | 3680 |
| 353 | Ga0265327_10045767 | 3300031251 | Bacteria | 2323 |
| 354 | Ga0265327_10056759 | 3300031251 | Bacteria | 2016 |
| 355 | Ga0265316_10107017 | 3300031344 | Bacteria | 2121 |
| 356 | Ga0265313_10049108 | 3300031595 | Bacteria | 2032 |
| 357 | Ga0265313_10056004 | 3300031595 | Bacteria | 1866 |
| 358 | Ga0265314_10098001 | 3300031711 | Bacteria | 1892 |
| 359 | Ga0265342_10000282 | 3300031712 | Bacteria | 57360 |
| 360 | Ga0265342_10000896 | 3300031712 | Bacteria | 29642 |
| 361 | Ga0265342_10045235 | 3300031712 | Bacteria | 2650 |
| 362 | Ga0265342_10080137 | 3300031712 | Bacteria | 1887 |
| 363 | Ga0307412_10102600 | 3300031911 | Bacteria | 2026 |
| 364 | Ga0307412_10113062 | 3300031911 | Bacteria | 1942 |
| 365 | Ga0307510_10138309 | 3300033180 | Bacteria | 2087 |
| 366 | Ga0373950_0002702 | 3300034818 | Bacteria | 2466 |
| 367 | Ga0373958_0000857 | 3300034819 | Bacteria | 3912 |
| 368 | Ga0373959_0003668 | 3300034820 | Bacteria | 2456 |
| 369 | Ga0373938_0003291 | 3300034957 | Bacteria | 2638 |
| 370 | Ga0373926_0002200 | 3300035083 | Bacteria | 6148 |
| 371 | Ga0373928_0003507 | 3300035084 | Bacteria | 2988 |
| 372 | Ga0373929_0008065 | 3300035085 | Bacteria | 1937 |
| 373 | Ga0373934_0021851 | 3300035086 | Bacteria | 2467 |
| 374 | Ga0373940_0003500 | 3300035088 | Bacteria | 3212 |
| 375 | Ga0373949_0001408 | 3300035090 | Bacteria | 6875 |
| 376 | Ga0373951_0003300 | 3300035091 | Bacteria | 3944 |
| 377 | Ga0373952_0001605 | 3300035092 | Bacteria | 4113 |
| 378 | Ga0373952_0003186 | 3300035092 | Bacteria | 2958 |
| 379 | Ga0373939_0001446 | 3300035114 | Bacteria | 5745 |
| 380 | Ga0373939_0021303 | 3300035114 | Bacteria | 1772 |
| 381 | Ga0373941_0001746 | 3300035115 | Bacteria | 4669 |
| 382 | Ga0373941_0068491 | 3300035115 | Bacteria | 1172 |
| 383 | Ga0373945_0055567 | 3300035116 | Bacteria | 1466 |
| 384 | Ga0373953_0005709 | 3300035117 | Bacteria | 4057 |
| 385 | Ga0373954_0002351 | 3300035118 | Bacteria | 7904 |
| 386 | Ga0373956_0006571 | 3300035119 | Bacteria | 4660 |
| 387 | Ga0373960_0001089 | 3300035121 | Bacteria | 5876 |
| 388 | Ga0373946_0005396 | 3300035171 | Bacteria | 4609 |
| 389 | Ga0373946_0083690 | 3300035171 | Bacteria | 1401 |
| 390 | Ga0373946_0125416 | 3300035171 | Bacteria | 1176 |
| 391 | Ga0373955_0000424 | 3300035172 | Bacteria | 17800 |
| 392 | Ga0373942_0010868 | 3300035207 | Bacteria | 2148 |
| 393 | Ga0373961_0001706 | 3300035241 | Bacteria | 6116 |
| 394 | Ga0373962_0006210 | 3300035242 | Bacteria | 2890 |
| 395 | Ga0373931_0001534 | 3300035691 | Bacteria | 9955 |
| 396 | Ga0373931_0044761 | 3300035691 | Bacteria | 2335 |
| 397 | Ga0373935_0006416 | 3300035692 | Bacteria | 7020 |
| 398 | Ga0373935_0053663 | 3300035692 | Bacteria | 2564 |
| 399 | Ga0373927_0013197 | 3300035695 | Bacteria | 5494 |
| 400 | Ga0373933_0001949 | 3300035724 | Bacteria | 11918 |
| 401 | Ga0373947_0001014 | 3300035725 | Bacteria | 17141 |
| 402 | Ga0373937_0001798 | 3300036401 | Bacteria | 18015 |
| 403 | Ga0373925_0001514 | 3300037068 | Bacteria | 19868 |
| 404 | Ga0373925_0010893 | 3300037068 | Bacteria | 6596 |
| 405 | Ga0395899_0214599 | 3300037312 | Bacteria | 1336 |
| 406 | Ga0395900_0126781 | 3300037418 | Bacteria | 2618 |
| 407 | Ga0395898_0177413 | 3300037466 | Bacteria | 2036 |
| 408 | Ga0395905_0095032 | 3300037471 | Bacteria | 2797 |
| 409 | Ga0436364_1416054 | 3300037853 | Bacteria | 38310 |
| 410 | Ga0395901_0044035 | 3300038443 | Bacteria | 4629 |
| 411 | Ga0436365_0088563 | 3300039437 | Bacteria | 10412 |
| 412 | Ga0436365_1273234 | 3300039437 | Bacteria | 3331 |
| 413 | Ga0436365_1356220 | 3300039437 | Bacteria | 2096 |
| 414 | Ga0436360_0306594 | 3300039438 | Bacteria | 1107 |
| 415 | Ga0439447_005815 | 3300041407 | Bacteria | 4065 |
| 416 | Ga0439448_0090805 | 3300042005 | Bacteria | 1032 |
| 417 | Ga0439450_010990 | 3300042008 | Bacteria | 1760 |
| 418 | Ga0450903_001354 | 3300042138 | Bacteria | 4584 |
| 419 | Ga0439464_0017190 | 3300042439 | Bacteria | 1960 |
| 420 | Ga0451577_0142493 | 3300042876 | Bacteria | 2154 |
| 421 | Ga0466972_0000189 | 3300044658 | Bacteria | 47501 |
| 422 | Ga0453683_0002436 | 3300044673 | Bacteria | 14413 |
| 423 | Ga0466965_0018538 | 3300044683 | Bacteria | 3337 |
| 424 | Ga0466966_0100333 | 3300044684 | Bacteria | 1790 |
| 425 | Ga0466963_0013352 | 3300044694 | Bacteria | 5043 |
| 426 | Ga0466963_0030438 | 3300044694 | Bacteria | 3483 |
| 427 | Ga0466970_0133648 | 3300044765 | Bacteria | 1364 |
| 428 | Ga0466957_0333020 | 3300044842 | Bacteria | 1026 |
| 429 | Ga0466959_0030304 | 3300045049 | Bacteria | 4006 |
| 430 | Ga0466959_0089806 | 3300045049 | Bacteria | 2207 |
| 431 | Ga0451576_0025556 | 3300045051 | Bacteria | 6362 |
| 432 | Ga0451576_0034403 | 3300045051 | Bacteria | 5382 |
| 433 | Ga0451576_0184131 | 3300045051 | Bacteria | 2181 |
| 434 | Ga0466967_0024787 | 3300045976 | Bacteria | 4937 |
| 435 | Ga0495592_0001873 | 3300046454 | Bacteria | 14799 |
| 436 | Ga0495592_0005376 | 3300046454 | Bacteria | 9453 |
| 437 | Ga0495592_0091436 | 3300046454 | Bacteria | 2182 |
| 438 | Ga0495603_0000847 | 3300046455 | Bacteria | 17534 |
| 439 | Ga0495603_0085695 | 3300046455 | Bacteria | 1844 |
| 440 | Ga0495629_0002130 | 3300046459 | Bacteria | 15353 |
| 441 | Ga0495629_0052653 | 3300046459 | Bacteria | 2848 |
| 442 | Ga0495638_0002166 | 3300046460 | Bacteria | 16488 |
| 443 | Ga0495638_0002585 | 3300046460 | Bacteria | 14627 |
| 444 | Ga0495651_0001256 | 3300046462 | Bacteria | 19642 |
| 445 | Ga0495651_0270277 | 3300046462 | Bacteria | 1153 |
| 446 | Ga0495653_0001017 | 3300046463 | Bacteria | 21626 |
| 447 | Ga0495653_0013899 | 3300046463 | Bacteria | 6562 |
| 448 | Ga0495582_0005835 | 3300046473 | Bacteria | 6858 |
| 449 | Ga0495639_0033182 | 3300046475 | Bacteria | 2305 |
| 450 | Ga0495662_0012227 | 3300046476 | Bacteria | 4191 |
| 451 | Ga0495662_0044597 | 3300046476 | Bacteria | 2141 |
| 452 | Ga0495664_0005166 | 3300046477 | Bacteria | 7163 |
| 453 | Ga0495664_0009316 | 3300046477 | Bacteria | 5491 |
| 454 | Ga0495664_0013950 | 3300046477 | Bacteria | 4553 |
| 455 | Ga0495594_0010150 | 3300046499 | Bacteria | 4882 |
| 456 | Ga0495607_0123383 | 3300046501 | Bacteria | 1357 |
| 457 | Ga0495583_0070437 | 3300046506 | Bacteria | 1538 |
| 458 | Ga0495606_0002520 | 3300046507 | Bacteria | 21082 |
| 459 | Ga0495606_0147353 | 3300046507 | Bacteria | 1384 |
| 460 | Ga0495608_0000646 | 3300046511 | Bacteria | 24033 |
| 461 | Ga0495618_0000819 | 3300046514 | Bacteria | 21634 |
| 462 | Ga0495618_0001132 | 3300046514 | Bacteria | 18019 |
| 463 | Ga0495618_0011685 | 3300046514 | Bacteria | 5328 |
| 464 | Ga0495620_0031063 | 3300046515 | Bacteria | 2451 |
| 465 | Ga0495630_0005678 | 3300046517 | Bacteria | 8818 |
| 466 | Ga0495630_0011250 | 3300046517 | Bacteria | 6472 |
| 467 | Ga0495630_0231864 | 3300046517 | Bacteria | 1410 |
| 468 | Ga0495631_0087586 | 3300046518 | Bacteria | 1341 |
| 469 | Ga0495632_0113164 | 3300046519 | Bacteria | 1273 |
| 470 | Ga0495637_0043145 | 3300046520 | Bacteria | 1927 |
| 471 | Ga0495648_0013688 | 3300046524 | Bacteria | 5982 |
| 472 | Ga0495666_0006222 | 3300046526 | Bacteria | 6010 |
| 473 | Ga0495652_0011396 | 3300046529 | Bacteria | 8039 |
| 474 | Ga0495665_0022103 | 3300046531 | Bacteria | 3420 |
| 475 | Ga0495640_0002925 | 3300046533 | Bacteria | 13746 |
| 476 | Ga0495640_0017622 | 3300046533 | Bacteria | 5317 |
| 477 | Ga0495640_0144951 | 3300046533 | Bacteria | 1528 |
| 478 | Ga0495587_0000770 | 3300046536 | Bacteria | 21359 |
| 479 | Ga0495645_0004568 | 3300046543 | Bacteria | 9444 |
| 480 | Ga0495645_0007688 | 3300046543 | Bacteria | 7499 |
| 481 | Ga0495622_0059070 | 3300046557 | Bacteria | 1776 |
| 482 | Ga0495622_0079394 | 3300046557 | Bacteria | 1510 |
| 483 | Ga0495667_0009756 | 3300046559 | Bacteria | 6506 |
| 484 | Ga0495667_0060371 | 3300046559 | Bacteria | 2487 |
| 485 | Ga0495634_0003907 | 3300046642 | Bacteria | 11834 |
| 486 | Ga0495634_0041891 | 3300046642 | Bacteria | 3109 |
| 487 | Ga0495634_0064753 | 3300046642 | Bacteria | 2423 |
| 488 | Ga0495634_0077843 | 3300046642 | Bacteria | 2173 |
| 489 | Ga0495625_0062082 | 3300046660 | Bacteria | 2642 |
| 490 | Ga0495635_0000812 | 3300046663 | Bacteria | 20468 |
| 491 | Ga0495635_0003066 | 3300046663 | Bacteria | 11493 |
| 492 | Ga0495635_0008585 | 3300046663 | Bacteria | 7132 |
| 493 | Ga0495635_0076007 | 3300046663 | Bacteria | 2301 |
| 494 | Ga0495661_0082361 | 3300046665 | Bacteria | 1852 |
| 495 | Ga0495588_0008598 | 3300046674 | Bacteria | 4691 |
| 496 | Ga0495657_0005959 | 3300046675 | Bacteria | 9575 |
| 497 | Ga0495657_0197965 | 3300046675 | Bacteria | 1225 |
| 498 | Ga0495599_0008486 | 3300046678 | Bacteria | 6247 |
| 499 | Ga0495623_0001381 | 3300046679 | Bacteria | 16475 |
| 500 | Ga0495646_0015954 | 3300046680 | Bacteria | 4767 |
| 501 | Ga0495646_0018897 | 3300046680 | Bacteria | 4365 |
| 502 | Ga0495647_0003781 | 3300046681 | Bacteria | 4870 |
| 503 | Ga0495658_0012531 | 3300046683 | Bacteria | 4298 |
| 504 | Ga0495669_0050559 | 3300046684 | Bacteria | 1864 |
| 505 | Ga0495669_0053619 | 3300046684 | Bacteria | 1814 |
| 506 | Ga0495613_0045613 | 3300046689 | Bacteria | 3241 |
| 507 | Ga0495624_0025898 | 3300046690 | Bacteria | 3848 |
| 508 | Ga0495649_0023164 | 3300046694 | Bacteria | 3469 |
| 509 | Ga0495600_0009057 | 3300046809 | Bacteria | 6137 |
| 510 | Ga0495581_0013701 | 3300047315 | Bacteria | 4701 |
| 511 | Ga0495604_0019293 | 3300047317 | Bacteria | 5457 |
| 512 | Ga0495604_0050228 | 3300047317 | Bacteria | 3238 |
| 513 | Ga0495604_0116991 | 3300047317 | Bacteria | 1934 |
| 514 | Ga0495674_0003170 | 3300047319 | Bacteria | 15972 |
| 515 | Ga0495674_0028208 | 3300047319 | Bacteria | 5123 |
| 516 | Ga0495674_0070558 | 3300047319 | Bacteria | 3018 |
| 517 | Ga0495676_0008104 | 3300047321 | Bacteria | 9642 |
| 518 | Ga0495676_0148786 | 3300047321 | Bacteria | 1669 |
| 519 | Ga0495676_0174338 | 3300047321 | Bacteria | 1511 |
| 520 | Ga0495680_0006835 | 3300047322 | Bacteria | 10539 |
| 521 | Ga0495680_0066844 | 3300047322 | Bacteria | 2750 |
| 522 | Ga0495680_0149845 | 3300047322 | Bacteria | 1702 |
| 523 | Ga0495675_0001036 | 3300047444 | Bacteria | 16879 |
| 524 | Ga0495673_0128887 | 3300047469 | Bacteria | 996 |
| 525 | Ga0495684_0003187 | 3300047471 | Bacteria | 12861 |
| 526 | Ga0495686_0053940 | 3300047472 | Bacteria | 2518 |
| 527 | Ga0495593_0084324 | 3300047673 | Bacteria | 1640 |
| 528 | Ga0495602_0001368 | 3300048088 | Bacteria | 24064 |
| 529 | Ga0496100_0013020 | 3300048903 | Bacteria | 4786 |
| 530 | Ga0496100_0013817 | 3300048903 | Bacteria | 4670 |
| 531 | Ga0496100_0013989 | 3300048903 | Bacteria | 4646 |
| 532 | Ga0496100_0032375 | 3300048903 | Bacteria | 3261 |
| 533 | Ga0496100_0282258 | 3300048903 | Bacteria | 1238 |
| 534 | Ga0496101_0025517 | 3300048904 | Bacteria | 4102 |
| 535 | Ga0496101_0044816 | 3300048904 | Bacteria | 3166 |
| 536 | Ga0496102_0080615 | 3300048905 | Bacteria | 2998 |
| 537 | Ga0496102_0086626 | 3300048905 | Bacteria | 2893 |
| 538 | Ga0496102_0393579 | 3300048905 | Bacteria | 1303 |
| 539 | Ga0496104_0007573 | 3300048907 | Bacteria | 9608 |
| 540 | Ga0496104_0020552 | 3300048907 | Bacteria | 6052 |
| 541 | Ga0496104_0062099 | 3300048907 | Bacteria | 3542 |
| 542 | Ga0496105_0003408 | 3300048908 | Bacteria | 11760 |
| 543 | Ga0496105_0050528 | 3300048908 | Bacteria | 3434 |
| 544 | Ga0496105_0061537 | 3300048908 | Bacteria | 3098 |
| 545 | Ga0496105_0102107 | 3300048908 | Bacteria | 2368 |
| 546 | Ga0496106_0001779 | 3300048909 | Bacteria | 16086 |
| 547 | Ga0496106_0011982 | 3300048909 | Bacteria | 6398 |
| 548 | Ga0496106_0014078 | 3300048909 | Bacteria | 5911 |
| 549 | Ga0496107_0007359 | 3300048910 | Bacteria | 7592 |
| 550 | Ga0496108_0008415 | 3300048911 | Bacteria | 8373 |
| 551 | Ga0496108_0030618 | 3300048911 | Bacteria | 4459 |
| 552 | Ga0496108_0230064 | 3300048911 | Bacteria | 1612 |
| 553 | Ga0496109_0000488 | 3300048912 | Bacteria | 33914 |
| 554 | Ga0496109_0099287 | 3300048912 | Bacteria | 2700 |
| 555 | Ga0496109_0114624 | 3300048912 | Bacteria | 2507 |
| 556 | Ga0496109_0134485 | 3300048912 | Bacteria | 2309 |
| 557 | Ga0496109_0176780 | 3300048912 | Bacteria | 2004 |
| 558 | Ga0496110_0006503 | 3300048913 | Bacteria | 9270 |
| 559 | Ga0496110_0011628 | 3300048913 | Bacteria | 7216 |
| 560 | Ga0496110_0049042 | 3300048913 | Bacteria | 3703 |
| 561 | Ga0496110_0065261 | 3300048913 | Bacteria | 3218 |
| 562 | Ga0496110_0163962 | 3300048913 | Bacteria | 2015 |
| 563 | Ga0496111_0001887 | 3300048914 | Bacteria | 12400 |
| 564 | Ga0496111_0057088 | 3300048914 | Bacteria | 2826 |
| 565 | Ga0496111_0202114 | 3300048914 | Bacteria | 1477 |
| 566 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 567 | Ga0496112_0016876 | 3300048915 | Bacteria | 6850 |
| 568 | Ga0496112_0034410 | 3300048915 | Bacteria | 4931 |
| 569 | Ga0496112_0106733 | 3300048915 | Bacteria | 2770 |
| 570 | Ga0496112_0137244 | 3300048915 | Bacteria | 2415 |
| 571 | Ga0496112_0351932 | 3300048915 | Bacteria | 1415 |
| 572 | Ga0496113_0022983 | 3300048916 | Bacteria | 4418 |
| 573 | Ga0496113_0211452 | 3300048916 | Bacteria | 1544 |
| 574 | Ga0496114_0012742 | 3300048917 | Bacteria | 6734 |
| 575 | Ga0496114_0442260 | 3300048917 | Bacteria | 1151 |
| 576 | Ga0496115_0015693 | 3300048918 | Bacteria | 5751 |
| 577 | Ga0496115_0019198 | 3300048918 | Bacteria | 5259 |
| 578 | Ga0496115_0112676 | 3300048918 | Bacteria | 2235 |
| 579 | Ga0496115_0133833 | 3300048918 | Bacteria | 2044 |
| 580 | Ga0496117_0130566 | 3300048920 | Bacteria | 1523 |
| 581 | Ga0496118_0089002 | 3300048921 | Bacteria | 2133 |
| 582 | Ga0496119_0020237 | 3300048922 | Bacteria | 4861 |
| 583 | Ga0496119_0092778 | 3300048922 | Bacteria | 1712 |
| 584 | Ga0496120_0035672 | 3300048923 | Bacteria | 2968 |
| 585 | Ga0496121_0093522 | 3300048924 | Bacteria | 2340 |
| 586 | Ga0496122_0025741 | 3300048925 | Bacteria | 5097 |
| 587 | Ga0496123_0096119 | 3300048926 | Bacteria | 1740 |
| 588 | Ga0496125_0009864 | 3300048928 | Bacteria | 9716 |
| 589 | Ga0496125_0011221 | 3300048928 | Bacteria | 8981 |
| 590 | Ga0496125_0048499 | 3300048928 | Bacteria | 3540 |
| 591 | Ga0496125_0055066 | 3300048928 | Bacteria | 3244 |
| 592 | Ga0496126_0128788 | 3300048929 | Bacteria | 2189 |
| 593 | Ga0496126_0146150 | 3300048929 | Bacteria | 2030 |
| 594 | Ga0501031_0003015 | 3300049568 | Bacteria | 10775 |
| 595 | Ga0501031_0063714 | 3300049568 | Bacteria | 2401 |
| 596 | Ga0501032_0000129 | 3300049569 | Bacteria | 62082 |
| 597 | Ga0501032_0003564 | 3300049569 | Bacteria | 11867 |
| 598 | Ga0501032_0026642 | 3300049569 | Bacteria | 3973 |
| 599 | Ga0501032_0065403 | 3300049569 | Bacteria | 2432 |
| 600 | Ga0501032_0229033 | 3300049569 | Bacteria | 1208 |
| 601 | Ga0501033_0001179 | 3300049570 | Bacteria | 23588 |
| 602 | Ga0501033_0012740 | 3300049570 | Bacteria | 6412 |
| 603 | Ga0501033_0088361 | 3300049570 | Bacteria | 2267 |
| 604 | Ga0501034_0000423 | 3300049571 | Bacteria | 70979 |
| 605 | Ga0501034_0000503 | 3300049571 | Bacteria | 63099 |
| 606 | Ga0501034_0000850 | 3300049571 | Bacteria | 45243 |
| 607 | Ga0501034_0007739 | 3300049571 | Bacteria | 11422 |
| 608 | Ga0501034_0009264 | 3300049571 | Bacteria | 10320 |
| 609 | Ga0501034_0010273 | 3300049571 | Bacteria | 9763 |
| 610 | Ga0501034_0108327 | 3300049571 | Bacteria | 2769 |
| 611 | Ga0501034_0239053 | 3300049571 | Bacteria | 1763 |
| 612 | Ga0501034_0309201 | 3300049571 | Bacteria | 1515 |
| 613 | Ga0501034_0436204 | 3300049571 | Bacteria | 1229 |
| 614 | Ga0501036_0000547 | 3300049572 | Bacteria | 26976 |
| 615 | Ga0501036_0001453 | 3300049572 | Bacteria | 18220 |
| 616 | Ga0501036_0013517 | 3300049572 | Bacteria | 6786 |
| 617 | Ga0501036_0037643 | 3300049572 | Bacteria | 4092 |
| 618 | Ga0501036_0048905 | 3300049572 | Bacteria | 3580 |
| 619 | Ga0501036_0146126 | 3300049572 | Bacteria | 1994 |
| 620 | Ga0501036_0430649 | 3300049572 | Bacteria | 1099 |
| 621 | Ga0501037_0000106 | 3300049573 | Bacteria | 79430 |
| 622 | Ga0501037_0006363 | 3300049573 | Bacteria | 8637 |
| 623 | Ga0501037_0055821 | 3300049573 | Bacteria | 2887 |
| 624 | Ga0501037_0171377 | 3300049573 | Bacteria | 1542 |
| 625 | Ga0501037_0211733 | 3300049573 | Bacteria | 1366 |
| 626 | Ga0501038_0001655 | 3300049574 | Bacteria | 20704 |
| 627 | Ga0501038_0014086 | 3300049574 | Bacteria | 7284 |
| 628 | Ga0501038_0042460 | 3300049574 | Bacteria | 3960 |
| 629 | Ga0501038_0097648 | 3300049574 | Bacteria | 2450 |
| 630 | Ga0501038_0098590 | 3300049574 | Bacteria | 2436 |
| 631 | Ga0501038_0099490 | 3300049574 | Bacteria | 2424 |
| 632 | Ga0501038_0533644 | 3300049574 | Bacteria | 894 |
| 633 | Ga0501039_0000416 | 3300049575 | Bacteria | 30616 |
| 634 | Ga0501039_0029308 | 3300049575 | Bacteria | 4239 |
| 635 | Ga0501039_0148800 | 3300049575 | Bacteria | 1840 |
| 636 | Ga0501039_0236608 | 3300049575 | Bacteria | 1436 |
| 637 | Ga0501039_0276335 | 3300049575 | Bacteria | 1320 |
| 638 | Ga0501042_0016537 | 3300049578 | Bacteria | 5066 |
| 639 | Ga0501043_0003257 | 3300049579 | Bacteria | 13387 |
| 640 | Ga0501043_0003673 | 3300049579 | Bacteria | 12604 |
| 641 | Ga0501043_0019247 | 3300049579 | Bacteria | 5359 |
| 642 | Ga0501043_0052810 | 3300049579 | Bacteria | 3192 |
| 643 | Ga0501043_0098914 | 3300049579 | Bacteria | 2293 |
| 644 | Ga0501043_0103504 | 3300049579 | Bacteria | 2237 |
| 645 | Ga0501043_0244490 | 3300049579 | Bacteria | 1383 |
| 646 | Ga0501046_0000235 | 3300049580 | Bacteria | 57005 |
| 647 | Ga0501047_0000455 | 3300049581 | Bacteria | 45200 |
| 648 | Ga0501047_0000844 | 3300049581 | Bacteria | 31650 |
| 649 | Ga0501047_0006341 | 3300049581 | Bacteria | 11123 |
| 650 | Ga0501047_0065540 | 3300049581 | Bacteria | 3501 |
| 651 | Ga0501047_0152258 | 3300049581 | Bacteria | 2188 |
| 652 | Ga0501048_0001444 | 3300049582 | Bacteria | 18038 |
| 653 | Ga0501048_0085873 | 3300049582 | Bacteria | 2219 |
| 654 | Ga0501067_0000160 | 3300049583 | Bacteria | 37883 |
| 655 | Ga0501068_0000014 | 3300049584 | Bacteria | 62762 |
| 656 | Ga0501068_0056764 | 3300049584 | Bacteria | 2373 |
| 657 | Ga0501069_0004593 | 3300049585 | Bacteria | 7142 |
| 658 | Ga0501069_0022997 | 3300049585 | Bacteria | 3394 |
| 659 | Ga0501070_0009287 | 3300049586 | Bacteria | 8316 |
| 660 | Ga0501070_0014286 | 3300049586 | Bacteria | 6682 |
| 661 | Ga0501070_0034852 | 3300049586 | Bacteria | 4206 |
| 662 | Ga0501070_0123779 | 3300049586 | Bacteria | 2137 |
| 663 | Ga0501070_0184054 | 3300049586 | Bacteria | 1718 |
| 664 | Ga0501070_0201889 | 3300049586 | Bacteria | 1633 |
| 665 | Ga0501070_0295368 | 3300049586 | Bacteria | 1320 |
| 666 | Ga0501071_0082888 | 3300049587 | Bacteria | 2349 |
| 667 | Ga0501072_0001159 | 3300049588 | Bacteria | 19618 |
| 668 | Ga0501072_0022832 | 3300049588 | Bacteria | 4855 |
| 669 | Ga0501072_0125982 | 3300049588 | Bacteria | 2041 |
| 670 | Ga0501073_0000417 | 3300049589 | Bacteria | 29149 |
| 671 | Ga0501073_0147202 | 3300049589 | Bacteria | 1632 |
| 672 | Ga0501073_0191646 | 3300049589 | Bacteria | 1414 |
| 673 | Ga0501073_0236514 | 3300049589 | Bacteria | 1262 |
| 674 | Ga0501074_0001839 | 3300049590 | Bacteria | 14545 |
| 675 | Ga0501074_0010853 | 3300049590 | Bacteria | 6616 |
| 676 | Ga0501074_0304748 | 3300049590 | Bacteria | 1131 |
| 677 | Ga0501075_0289053 | 3300049591 | Bacteria | 1249 |
| 678 | Ga0501075_0414835 | 3300049591 | Bacteria | 1027 |
| 679 | Ga0501076_0046191 | 3300049592 | Bacteria | 3440 |
| 680 | Ga0501079_0000261 | 3300049741 | Bacteria | 32317 |
| 681 | Ga0501079_0104345 | 3300049741 | Bacteria | 2199 |
| 682 | Ga0501079_0250509 | 3300049741 | Bacteria | 1384 |
| 683 | Ga0501079_0257297 | 3300049741 | Bacteria | 1364 |
| 684 | Ga0501080_0000917 | 3300049742 | Bacteria | 24141 |
| 685 | Ga0501080_0001026 | 3300049742 | Bacteria | 22970 |
| 686 | Ga0501080_0029381 | 3300049742 | Bacteria | 5117 |
| 687 | Ga0501080_0058440 | 3300049742 | Bacteria | 3590 |
| 688 | Ga0501080_0172405 | 3300049742 | Bacteria | 1995 |
| 689 | Ga0501080_0177694 | 3300049742 | Bacteria | 1961 |
| 690 | Ga0501080_0279637 | 3300049742 | Bacteria | 1517 |
| 691 | Ga0501081_0114042 | 3300049743 | Bacteria | 1920 |
| 692 | Ga0501081_0173404 | 3300049743 | Bacteria | 1558 |
| 693 | Ga0501083_0000301 | 3300049744 | Bacteria | 31182 |
| 694 | Ga0501083_0034723 | 3300049744 | Bacteria | 3447 |
| 695 | Ga0501083_0125638 | 3300049744 | Bacteria | 1681 |
| 696 | Ga0501035_0000324 | 3300049822 | Bacteria | 55297 |
| 697 | Ga0501035_0010664 | 3300049822 | Bacteria | 8509 |
| 698 | Ga0501035_0012093 | 3300049822 | Bacteria | 7979 |
| 699 | Ga0501035_0046533 | 3300049822 | Bacteria | 3902 |
| 700 | Ga0501035_0047850 | 3300049822 | Bacteria | 3837 |
| 701 | Ga0501035_0062674 | 3300049822 | Bacteria | 3308 |
| 702 | Ga0501044_0000051 | 3300049823 | Bacteria | 143658 |
| 703 | Ga0501044_0000084 | 3300049823 | Bacteria | 114544 |
| 704 | Ga0501044_0008033 | 3300049823 | Bacteria | 11591 |
| 705 | Ga0501044_0048481 | 3300049823 | Bacteria | 4387 |
| 706 | Ga0501044_0095098 | 3300049823 | Bacteria | 3003 |
| 707 | Ga0501044_0103933 | 3300049823 | Bacteria | 2855 |
| 708 | Ga0501044_0171505 | 3300049823 | Bacteria | 2141 |
| 709 | Ga0501045_0173779 | 3300049824 | Bacteria | 1605 |
| 710 | nmdc:mga03683_10919_c2 | 3300050489 | Bacteria | 2958 |
| 711 | nmdc:mga03n38_32700_c1 | 3300050490 | Bacteria | 2206 |
| 712 | nmdc:mga00v17_117160_c1 | 3300050491 | Bacteria | 1694 |
| 713 | nmdc:mga00v17_263642_c1 | 3300050491 | Bacteria | 1118 |
| 714 | nmdc:mga00v17_48740_c1 | 3300050491 | Bacteria | 2568 |
| 715 | nmdc:mga0yw44_107288_c1 | 3300050492 | Bacteria | 1786 |
| 716 | nmdc:mga0yw44_163388_c1 | 3300050492 | Bacteria | 1459 |
| 717 | nmdc:mga0yw44_315190_c1 | 3300050492 | Bacteria | 1050 |
| 718 | nmdc:mga0k408_41530_c1 | 3300050493 | Bacteria | 2648 |
| 719 | nmdc:mga06z11_58287_c1 | 3300050494 | Bacteria | 2003 |
| 720 | nmdc:mga06z11_6052_c1 | 3300050494 | Bacteria | 4894 |
| 721 | nmdc:mga07m45_60952_c1 | 3300050496 | Bacteria | 2136 |
| 722 | nmdc:mga05p37_159771_c1 | 3300050507 | Bacteria | 2753 |
| 723 | nmdc:mga05p37_2742_c1 | 3300050507 | Bacteria | 20456 |
| 724 | nmdc:mga05p37_314549_c1 | 3300050507 | Bacteria | 1855 |
| 725 | nmdc:mga05p37_505_c1 | 3300050507 | Bacteria | 42970 |
| 726 | nmdc:mga09592_179408_c1 | 3300050508 | Bacteria | 1832 |
| 727 | nmdc:mga09592_772_c1 | 3300050508 | Bacteria | 24711 |
| 728 | nmdc:mga0qj67_165_c1 | 3300050509 | Bacteria | 44307 |
| 729 | nmdc:mga06r32_182481_c1 | 3300050510 | Bacteria | 2084 |
| 730 | nmdc:mga06r32_513_c1 | 3300050510 | Bacteria | 33328 |
| 731 | nmdc:mga06r32_73287_c1 | 3300050510 | Bacteria | 3317 |
| 732 | nmdc:mga08y16_2844_c1 | 3300050511 | Bacteria | 17794 |
| 733 | nmdc:mga08y16_35524_c1 | 3300050511 | Bacteria | 5234 |
| 734 | nmdc:mga08y16_89962_c1 | 3300050511 | Bacteria | 3199 |
| 735 | nmdc:mga0n895_143382_c1 | 3300050512 | Bacteria | 2418 |
| 736 | nmdc:mga0n895_20210_c1 | 3300050512 | Bacteria | 6205 |
| 737 | nmdc:mga0n895_3322_c1 | 3300050512 | Bacteria | 12929 |
| 738 | nmdc:mga0rr50_1278_c1 | 3300050513 | Bacteria | 13714 |
| 739 | nmdc:mga0rr50_242490_c1 | 3300050513 | Bacteria | 1494 |
| 740 | nmdc:mga08x19_14_c1 | 3300050514 | Bacteria | 365567 |
| 741 | nmdc:mga0a205_1632_c1 | 3300050515 | Bacteria | 19295 |
| 742 | nmdc:mga0a205_26496_c1 | 3300050515 | Bacteria | 5530 |
| 743 | nmdc:mga0a205_6515_c2 | 3300050515 | Bacteria | 10082 |
| 744 | nmdc:mga0sz30_26045_c1 | 3300050516 | Bacteria | 2395 |
| 745 | nmdc:mga0sz30_5969_c1 | 3300050516 | Bacteria | 4494 |
| 746 | nmdc:mga0sz30_60142_c1 | 3300050516 | Bacteria | 1622 |
| 747 | Ga0495601_0004046 | 3300053077 | Bacteria | 8451 |
| 748 | Ga0495601_0004638 | 3300053077 | Bacteria | 7956 |
| 749 | Ga0495601_0007149 | 3300053077 | Bacteria | 6544 |
| 750 | Ga0495612_0000523 | 3300053078 | Bacteria | 15440 |
| 751 | Ga0495612_0012825 | 3300053078 | Bacteria | 3378 |
| 752 | Ga0495612_0019874 | 3300053078 | Bacteria | 2691 |
| 753 | Ga0500635_0019866 | 3300053080 | Bacteria | 2049 |
| 754 | Ga0495595_0000253 | 3300053084 | Bacteria | 21240 |
| 755 | Ga0495595_0094291 | 3300053084 | Bacteria | 1439 |
| 756 | Ga0495595_0154729 | 3300053084 | Bacteria | 1129 |
| 757 | Ga0495619_0003655 | 3300053085 | Bacteria | 9912 |
| 758 | Ga0495619_0027382 | 3300053085 | Bacteria | 3670 |
| 759 | Ga0495619_0096702 | 3300053085 | Bacteria | 2005 |
| 760 | Ga0495619_0144309 | 3300053085 | Bacteria | 1640 |
| 761 | Ga0495619_0148649 | 3300053085 | Bacteria | 1615 |
| 762 | Ga0495619_0203344 | 3300053085 | Bacteria | 1371 |
| 763 | Ga0495619_0234801 | 3300053085 | Bacteria | 1271 |
| 764 | Ga0500643_010551 | 3300053087 | Bacteria | 3426 |
| 765 | Ga0500581_066267 | 3300053089 | Bacteria | 1823 |
| 766 | Ga0500651_0012814 | 3300053093 | Bacteria | 5089 |
| 767 | Ga0500651_0204075 | 3300053093 | Bacteria | 1165 |
| 768 | Ga0500566_0004691 | 3300053094 | Bacteria | 8134 |
| 769 | Ga0500566_0005587 | 3300053094 | Bacteria | 7469 |
| 770 | Ga0500566_0083560 | 3300053094 | Bacteria | 1773 |
| 771 | Ga0500641_0006277 | 3300053096 | Bacteria | 4217 |
| 772 | Ga0500554_001532 | 3300053102 | Bacteria | 4463 |
| 773 | Ga0500556_0000004 | 3300053104 | Bacteria | 666287 |
| 774 | Ga0500562_052297 | 3300053108 | Bacteria | 1093 |
| 775 | Ga0500569_018758 | 3300053109 | Bacteria | 1791 |
| 776 | Ga0500572_013643 | 3300053111 | Bacteria | 2015 |
| 777 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 778 | Ga0500607_025574 | 3300053121 | Bacteria | 3284 |
| 779 | Ga0500608_001229 | 3300053122 | Bacteria | 9146 |
| 780 | Ga0500608_003410 | 3300053122 | Bacteria | 5953 |
| 781 | Ga0500608_022074 | 3300053122 | Bacteria | 2948 |
| 782 | Ga0500618_032142 | 3300053125 | Bacteria | 1229 |
| 783 | Ga0500642_0000186 | 3300053130 | Bacteria | 25633 |
| 784 | Ga0500652_036517 | 3300053131 | Bacteria | 1956 |
| 785 | Ga0500658_0023977 | 3300053134 | Bacteria | 2335 |
| 786 | Ga0500658_0039451 | 3300053134 | Bacteria | 1887 |
| 787 | Ga0500559_0000067 | 3300053136 | Bacteria | 83330 |
| 788 | Ga0500559_0006042 | 3300053136 | Bacteria | 5493 |
| 789 | Ga0500559_0021198 | 3300053136 | Bacteria | 2752 |
| 790 | Ga0500559_0025764 | 3300053136 | Bacteria | 2503 |
| 791 | Ga0500559_0066766 | 3300053136 | Bacteria | 1614 |
| 792 | Ga0500564_035305 | 3300053138 | Bacteria | 2307 |
| 793 | Ga0500568_0001430 | 3300053139 | Bacteria | 15482 |
| 794 | Ga0500568_0024932 | 3300053139 | Bacteria | 2528 |
| 795 | Ga0500586_004477 | 3300053145 | Bacteria | 3428 |
| 796 | Ga0500603_038681 | 3300053150 | Bacteria | 1263 |
| 797 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 798 | Ga0500616_0047881 | 3300053153 | Bacteria | 2268 |
| 799 | Ga0500619_001901 | 3300053154 | Bacteria | 3866 |
| 800 | Ga0500622_0000513 | 3300053156 | Bacteria | 35999 |
| 801 | Ga0500624_019353 | 3300053157 | Bacteria | 1081 |
| 802 | Ga0500638_102521 | 3300053162 | Bacteria | 1332 |
| 803 | Ga0500636_0000122 | 3300053177 | Bacteria | 40577 |
| 804 | Ga0500637_0021257 | 3300053178 | Bacteria | 3523 |
| 805 | Ga0501084_0014689 | 3300054114 | Bacteria | 6493 |
| 806 | Ga0501084_0046552 | 3300054114 | Bacteria | 3634 |
| 807 | Ga0501084_0232677 | 3300054114 | Bacteria | 1555 |
| 808 | Ga0501082_0000106 | 3300060353 | Bacteria | 65983 |
| 809 | Ga0501082_0018584 | 3300060353 | Bacteria | 5991 |
| 810 | Ga0501082_0147642 | 3300060353 | Bacteria | 2042 |
| 811 | Ga0501082_0200117 | 3300060353 | Bacteria | 1738 |
| 812 | Ga0501082_0235717 | 3300060353 | Bacteria | 1592 |
| 813 | Ga0530510_0389420 | 3300061734 | Bacteria | 1050 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049572 | Ga0501036_0430649 | Ga0501036_0430649_20_910 | 264 |
| 2 | 3300049744 | Ga0501083_0125638 | Ga0501083_0125638_764_1654 | 264 |
| 3 | 3300044673 | Ga0453683_0002436 | Ga0453683_0002436_4469_5488 | 269 |
| 4 | 3300045051 | Ga0451576_0025556 | Ga0451576_0025556_3298_4317 | 269 |
| 5 | 3300045051 | Ga0451576_0184131 | Ga0451576_0184131_875_1873 | 272 |
| 6 | 3300049569 | Ga0501032_0003564 | Ga0501032_0003564_8953_9921 | 272 |
| 7 | 3300049571 | Ga0501034_0000850 | Ga0501034_0000850_27903_28871 | 272 |
| 8 | 3300049572 | Ga0501036_0000547 | Ga0501036_0000547_13097_14065 | 272 |
| 9 | 3300049579 | Ga0501043_0003257 | Ga0501043_0003257_11822_12790 | 272 |
| 10 | 3300049581 | Ga0501047_0000455 | Ga0501047_0000455_16353_17321 | 272 |
| 11 | 3300049590 | Ga0501074_0010853 | Ga0501074_0010853_5564_6532 | 272 |
| 12 | 3300049742 | Ga0501080_0001026 | Ga0501080_0001026_16366_17334 | 272 |
| 13 | 3300049744 | Ga0501083_0034723 | Ga0501083_0034723_1319_2287 | 272 |
| 14 | 3300049823 | Ga0501044_0008033 | Ga0501044_0008033_5936_6904 | 272 |
| 15 | 3300060353 | Ga0501082_0200117 | Ga0501082_0200117_402_1370 | 272 |
| 16 | 3300061734 | Ga0530510_0389420 | Ga0530510_0389420_22_948 | 272 |
| 17 | 3300042876 | Ga0451577_0142493 | Ga0451577_0142493_827_1819 | 274 |
| 18 | 3300049589 | Ga0501073_0191646 | Ga0501073_0191646_134_1060 | 276 |
| 19 | 3300049589 | Ga0501073_0236514 | Ga0501073_0236514_325_1251 | 276 |
| 20 | 3300053136 | Ga0500559_0021198 | Ga0500559_0021198_1256_2239 | 278 |
| 21 | 3300053136 | Ga0500559_0066766 | Ga0500559_0066766_151_1134 | 278 |
| 22 | 3300005518 | Ga0070699_100174889 | Ga0070699_1001748892 | 279 |
| 23 | 3300035115 | Ga0373941_0068491 | Ga0373941_0068491_319_1158 | 279 |
| 24 | 3300042005 | Ga0439448_0090805 | Ga0439448_0090805_174_1013 | 279 |
| 25 | 3300044684 | Ga0466966_0100333 | Ga0466966_0100333_936_1775 | 279 |
| 26 | 3300046476 | Ga0495662_0044597 | Ga0495662_0044597_1270_2109 | 279 |
| 27 | 3300047469 | Ga0495673_0128887 | Ga0495673_0128887_11_850 | 279 |
| 28 | 3300049574 | Ga0501038_0533644 | Ga0501038_0533644_31_870 | 279 |
| 29 | 3300050492 | nmdc:mga0yw44_163388_c1 | nmdc:mga0yw44_163388_c1_24_863 | 279 |
| 30 | 3300050510 | nmdc:mga06r32_182481_c1 | nmdc:mga06r32_182481_c1_1222_2061 | 279 |
| 31 | 3300048928 | Ga0496125_0011221 | Ga0496125_0011221_5331_6314 | 280 |
| 32 | 3300003659 | JGI25404J52841_10002372 | JGI25404J52841_100023724 | 281 |
| 33 | 3300005983 | Ga0081540_1002120 | Ga0081540_10021209 | 281 |
| 34 | 3300025942 | Ga0207689_10037239 | Ga0207689_100372393 | 281 |
| 35 | 3300006048 | Ga0075363_100005844 | Ga0075363_1000058442 | 282 |
| 36 | 3300006051 | Ga0075364_10002167 | Ga0075364_100021678 | 282 |
| 37 | 3300006177 | Ga0075362_10015262 | Ga0075362_100152622 | 282 |
| 38 | 3300006178 | Ga0075367_10019691 | Ga0075367_100196913 | 282 |
| 39 | 3300006195 | Ga0075366_10016883 | Ga0075366_100168833 | 282 |
| 40 | 3300025928 | Ga0207700_10006989 | Ga0207700_100069894 | 282 |
| 41 | 3300050489 | nmdc:mga03683_10919_c2 | nmdc:mga03683_10919_c2_945_1910 | 282 |
| 42 | 3300050490 | nmdc:mga03n38_32700_c1 | nmdc:mga03n38_32700_c1_542_1507 | 282 |
| 43 | 3300050493 | nmdc:mga0k408_41530_c1 | nmdc:mga0k408_41530_c1_448_1413 | 282 |
| 44 | 3300005616 | Ga0068852_100004876 | Ga0068852_1000048768 | 283 |
| 45 | 3300045051 | Ga0451576_0034403 | Ga0451576_0034403_829_1761 | 283 |
| 46 | 3300039437 | Ga0436365_1273234 | Ga0436365_1273234_2429_3319 | 284 |
| 47 | 3300005439 | Ga0070711_100079531 | Ga0070711_1000795312 | 286 |
| 48 | 3300006175 | Ga0070712_100000213 | Ga0070712_10000021319 | 286 |
| 49 | 3300025915 | Ga0207693_10000888 | Ga0207693_1000088821 | 286 |
| 50 | 3300025916 | Ga0207663_10109900 | Ga0207663_101099002 | 286 |
| 51 | 3300049568 | Ga0501031_0003015 | Ga0501031_0003015_7993_9027 | 286 |
| 52 | 3300049570 | Ga0501033_0012740 | Ga0501033_0012740_309_1343 | 286 |
| 53 | 3300049571 | Ga0501034_0010273 | Ga0501034_0010273_2252_3286 | 286 |
| 54 | 3300049573 | Ga0501037_0006363 | Ga0501037_0006363_709_1743 | 286 |
| 55 | 3300049574 | Ga0501038_0014086 | Ga0501038_0014086_1198_2232 | 286 |
| 56 | 3300049579 | Ga0501043_0103504 | Ga0501043_0103504_821_1855 | 286 |
| 57 | 3300049581 | Ga0501047_0006341 | Ga0501047_0006341_3228_4262 | 286 |
| 58 | 3300049822 | Ga0501035_0047850 | Ga0501035_0047850_1472_2506 | 286 |
| 59 | 3300050494 | nmdc:mga06z11_58287_c1 | nmdc:mga06z11_58287_c1_279_1310 | 286 |
| 60 | 3300050492 | nmdc:mga0yw44_315190_c1 | nmdc:mga0yw44_315190_c1_170_1033 | 287 |
| 61 | 3300053085 | Ga0495619_0096702 | Ga0495619_0096702_962_1924 | 287 |
| 62 | 3300049571 | Ga0501034_0009264 | Ga0501034_0009264_2593_3546 | 288 |
| 63 | 3300049579 | Ga0501043_0098914 | Ga0501043_0098914_1179_2132 | 288 |
| 64 | 3300049581 | Ga0501047_0152258 | Ga0501047_0152258_874_1827 | 288 |
| 65 | 3300049823 | Ga0501044_0171505 | Ga0501044_0171505_520_1473 | 288 |
| 66 | 3300035115 | Ga0373941_0001746 | Ga0373941_0001746_2177_3145 | 289 |
| 67 | 3300049568 | Ga0501031_0063714 | Ga0501031_0063714_1154_2122 | 289 |
| 68 | 3300049569 | Ga0501032_0026642 | Ga0501032_0026642_1092_2060 | 289 |
| 69 | 3300049569 | Ga0501032_0065403 | Ga0501032_0065403_1439_2407 | 289 |
| 70 | 3300049570 | Ga0501033_0088361 | Ga0501033_0088361_34_1002 | 289 |
| 71 | 3300049571 | Ga0501034_0007739 | Ga0501034_0007739_10298_11266 | 289 |
| 72 | 3300049571 | Ga0501034_0309201 | Ga0501034_0309201_218_1186 | 289 |
| 73 | 3300049572 | Ga0501036_0013517 | Ga0501036_0013517_5680_6648 | 289 |
| 74 | 3300049572 | Ga0501036_0037643 | Ga0501036_0037643_1005_1973 | 289 |
| 75 | 3300049573 | Ga0501037_0171377 | Ga0501037_0171377_554_1522 | 289 |
| 76 | 3300049573 | Ga0501037_0211733 | Ga0501037_0211733_85_1053 | 289 |
| 77 | 3300049574 | Ga0501038_0042460 | Ga0501038_0042460_1958_2926 | 289 |
| 78 | 3300049574 | Ga0501038_0097648 | Ga0501038_0097648_946_1914 | 289 |
| 79 | 3300049574 | Ga0501038_0098590 | Ga0501038_0098590_1266_2234 | 289 |
| 80 | 3300049575 | Ga0501039_0236608 | Ga0501039_0236608_98_1066 | 289 |
| 81 | 3300049575 | Ga0501039_0276335 | Ga0501039_0276335_56_1024 | 289 |
| 82 | 3300049579 | Ga0501043_0003673 | Ga0501043_0003673_11196_12164 | 289 |
| 83 | 3300049579 | Ga0501043_0244490 | Ga0501043_0244490_297_1265 | 289 |
| 84 | 3300049581 | Ga0501047_0065540 | Ga0501047_0065540_2410_3378 | 289 |
| 85 | 3300049582 | Ga0501048_0085873 | Ga0501048_0085873_91_1059 | 289 |
| 86 | 3300049584 | Ga0501068_0056764 | Ga0501068_0056764_946_1911 | 289 |
| 87 | 3300049585 | Ga0501069_0022997 | Ga0501069_0022997_1694_2662 | 289 |
| 88 | 3300049586 | Ga0501070_0014286 | Ga0501070_0014286_309_1277 | 289 |
| 89 | 3300049586 | Ga0501070_0184054 | Ga0501070_0184054_284_1252 | 289 |
| 90 | 3300049586 | Ga0501070_0295368 | Ga0501070_0295368_103_1071 | 289 |
| 91 | 3300049741 | Ga0501079_0257297 | Ga0501079_0257297_14_982 | 289 |
| 92 | 3300049742 | Ga0501080_0029381 | Ga0501080_0029381_266_1234 | 289 |
| 93 | 3300049742 | Ga0501080_0279637 | Ga0501080_0279637_418_1386 | 289 |
| 94 | 3300049743 | Ga0501081_0173404 | Ga0501081_0173404_365_1333 | 289 |
| 95 | 3300049822 | Ga0501035_0010664 | Ga0501035_0010664_22_990 | 289 |
| 96 | 3300049822 | Ga0501035_0012093 | Ga0501035_0012093_1261_2229 | 289 |
| 97 | 3300049822 | Ga0501035_0046533 | Ga0501035_0046533_1266_2234 | 289 |
| 98 | 3300049823 | Ga0501044_0048481 | Ga0501044_0048481_1938_2906 | 289 |
| 99 | 3300060353 | Ga0501082_0235717 | Ga0501082_0235717_435_1403 | 289 |
| 100 | 3300005289 | Ga0065704_10093664 | Ga0065704_100936642 | 290 |
| 101 | 3300046462 | Ga0495651_0270277 | Ga0495651_0270277_226_1137 | 290 |
| 102 | 3300048924 | Ga0496121_0093522 | Ga0496121_0093522_384_1361 | 290 |
| 103 | 3300048928 | Ga0496125_0009864 | Ga0496125_0009864_811_1788 | 290 |
| 104 | 3300049569 | Ga0501032_0229033 | Ga0501032_0229033_20_1060 | 290 |
| 105 | 3300049571 | Ga0501034_0239053 | Ga0501034_0239053_174_1142 | 290 |
| 106 | 3300049572 | Ga0501036_0146126 | Ga0501036_0146126_354_1394 | 290 |
| 107 | 3300013297 | Ga0157378_10128094 | Ga0157378_101280942 | 294 |
| 108 | 3300026116 | Ga0207674_10116666 | Ga0207674_101166663 | 294 |
| 109 | 3300031251 | Ga0265327_10056759 | Ga0265327_100567591 | 294 |
| 110 | 3300031251 | Ga0265327_10045767 | Ga0265327_100457672 | 295 |
| 111 | 3300009094 | Ga0111539_10425447 | Ga0111539_104254472 | 296 |
| 112 | 3300031712 | Ga0265342_10045235 | Ga0265342_100452353 | 296 |
| 113 | 3300048913 | Ga0496110_0006503 | Ga0496110_0006503_4623_5591 | 296 |
| 114 | 3300049572 | Ga0501036_0048905 | Ga0501036_0048905_1756_2751 | 296 |
| 115 | 3300049823 | Ga0501044_0095098 | Ga0501044_0095098_488_1483 | 296 |
| 116 | 3300053134 | Ga0500658_0039451 | Ga0500658_0039451_982_1875 | 296 |
| 117 | 3300005614 | Ga0068856_100201154 | Ga0068856_1002011542 | 299 |
| 118 | 3300005981 | Ga0081538_10041578 | Ga0081538_100415783 | 299 |
| 119 | 3300021384 | Ga0213876_10025508 | Ga0213876_100255083 | 299 |
| 120 | 3300039438 | Ga0436360_0306594 | Ga0436360_0306594_24_1052 | 299 |
| 121 | 3300007265 | Ga0099794_10096984 | Ga0099794_100969842 | 300 |
| 122 | 3300033180 | Ga0307510_10138309 | Ga0307510_101383092 | 300 |
| 123 | 3300035171 | Ga0373946_0125416 | Ga0373946_0125416_187_1155 | 300 |
| 124 | 3300046455 | Ga0495603_0085695 | Ga0495603_0085695_217_1185 | 300 |
| 125 | 3300046507 | Ga0495606_0002520 | Ga0495606_0002520_10389_11357 | 300 |
| 126 | 3300048913 | Ga0496110_0163962 | Ga0496110_0163962_964_1932 | 300 |
| 127 | 3300048915 | Ga0496112_0106733 | Ga0496112_0106733_425_1393 | 300 |
| 128 | 3300048918 | Ga0496115_0133833 | Ga0496115_0133833_758_1726 | 300 |
| 129 | 3300053102 | Ga0500554_001532 | Ga0500554_001532_2689_3657 | 300 |
| 130 | 3300053150 | Ga0500603_038681 | Ga0500603_038681_206_1174 | 300 |
| 131 | 3300053178 | Ga0500637_0021257 | Ga0500637_0021257_1305_2273 | 300 |
| 132 | 3300005434 | Ga0070709_10005546 | Ga0070709_100055466 | 301 |
| 133 | 3300005435 | Ga0070714_100009084 | Ga0070714_1000090845 | 301 |
| 134 | 3300005436 | Ga0070713_100006662 | Ga0070713_1000066622 | 301 |
| 135 | 3300005437 | Ga0070710_10001257 | Ga0070710_1000125712 | 301 |
| 136 | 3300005439 | Ga0070711_100045845 | Ga0070711_1000458452 | 301 |
| 137 | 3300006028 | Ga0070717_10008461 | Ga0070717_100084617 | 301 |
| 138 | 3300006163 | Ga0070715_10000384 | Ga0070715_100003849 | 301 |
| 139 | 3300006175 | Ga0070712_100084293 | Ga0070712_1000842932 | 301 |
| 140 | 3300025898 | Ga0207692_10000214 | Ga0207692_100002148 | 301 |
| 141 | 3300025905 | Ga0207685_10012312 | Ga0207685_100123123 | 301 |
| 142 | 3300025915 | Ga0207693_10026683 | Ga0207693_100266835 | 301 |
| 143 | 3300025916 | Ga0207663_10000628 | Ga0207663_1000062813 | 301 |
| 144 | 3300025939 | Ga0207665_10001305 | Ga0207665_100013053 | 301 |
| 145 | 3300025942 | Ga0207689_10266200 | Ga0207689_102662002 | 301 |
| 146 | 3300046559 | Ga0495667_0060371 | Ga0495667_0060371_878_1846 | 301 |
| 147 | 3300047322 | Ga0495680_0066844 | Ga0495680_0066844_264_1232 | 301 |
| 148 | 3300048903 | Ga0496100_0013817 | Ga0496100_0013817_2617_3585 | 301 |
| 149 | 3300048904 | Ga0496101_0044816 | Ga0496101_0044816_1112_2080 | 301 |
| 150 | 3300048907 | Ga0496104_0007573 | Ga0496104_0007573_972_1940 | 301 |
| 151 | 3300048908 | Ga0496105_0050528 | Ga0496105_0050528_1158_2126 | 301 |
| 152 | 3300048909 | Ga0496106_0001779 | Ga0496106_0001779_12994_13962 | 301 |
| 153 | 3300048910 | Ga0496107_0007359 | Ga0496107_0007359_4799_5767 | 301 |
| 154 | 3300048911 | Ga0496108_0030618 | Ga0496108_0030618_1022_1990 | 301 |
| 155 | 3300048912 | Ga0496109_0134485 | Ga0496109_0134485_326_1294 | 301 |
| 156 | 3300048914 | Ga0496111_0001887 | Ga0496111_0001887_9401_10369 | 301 |
| 157 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_235548_236516 | 301 |
| 158 | 3300048915 | Ga0496112_0016876 | Ga0496112_0016876_3624_4592 | 301 |
| 159 | 3300048918 | Ga0496115_0112676 | Ga0496115_0112676_1040_2008 | 301 |
| 160 | 3300027682 | Ga0209971_1003527 | Ga0209971_10035273 | 302 |
| 161 | 3300035691 | Ga0373931_0044761 | Ga0373931_0044761_37_1005 | 302 |
| 162 | 3300046507 | Ga0495606_0147353 | Ga0495606_0147353_447_1358 | 302 |
| 163 | 3300050508 | nmdc:mga09592_179408_c1 | nmdc:mga09592_179408_c1_755_1717 | 302 |
| 164 | 3300005937 | Ga0081455_10081734 | Ga0081455_100817342 | 303 |
| 165 | iso_pu_bacteria | 2842733646 | 2842736212 | 303 |
| 166 | iso_pu_bacteria | 2928115317 | 2928115317 | 303 |
| 167 | iso_pu_bacteria | 2929520902 | 2929525112 | 303 |
| 168 | iso_pu_bacteria | 2904479285 | 2904480484 | 304 |
| 169 | 3300060353 | Ga0501082_0000106 | Ga0501082_0000106_11312_12280 | 305 |
| 170 | iso_pu_bacteria | 2547132374 | 2548500061 | 305 |
| 171 | iso_pu_bacteria | 2643221570 | 2643868274 | 305 |
| 172 | iso_pu_bacteria | 2643221609 | 2644059847 | 305 |
| 173 | iso_pu_bacteria | 2643221611 | 2644074136 | 305 |
| 174 | iso_pu_bacteria | 2738543012 | 2739241380 | 305 |
| 175 | iso_pu_bacteria | 2816332133 | 2816473545 | 305 |
| 176 | iso_pu_bacteria | 2974320154 | 2974324292 | 305 |
| 177 | 3300028794 | Ga0307515_10056876 | Ga0307515_100568764 | 306 |
| 178 | 3300048911 | Ga0496108_0230064 | Ga0496108_0230064_496_1419 | 306 |
| 179 | 3300048929 | Ga0496126_0128788 | Ga0496126_0128788_923_1891 | 306 |
| 180 | 3300031911 | Ga0307412_10102600 | Ga0307412_101026002 | 307 |
| 181 | 3300049571 | Ga0501034_0000423 | Ga0501034_0000423_68870_69856 | 307 |
| 182 | iso_pu_bacteria | 2738541307 | 2738886626 | 307 |
| 183 | 3300006186 | Ga0075369_10064502 | Ga0075369_100645022 | 308 |
| 184 | 3300049571 | Ga0501034_0108327 | Ga0501034_0108327_411_1379 | 308 |
| 185 | 3300049573 | Ga0501037_0055821 | Ga0501037_0055821_882_1850 | 308 |
| 186 | 3300049574 | Ga0501038_0099490 | Ga0501038_0099490_1211_2179 | 308 |
| 187 | 3300049575 | Ga0501039_0148800 | Ga0501039_0148800_376_1344 | 308 |
| 188 | 3300050516 | nmdc:mga0sz30_60142_c1 | nmdc:mga0sz30_60142_c1_252_1217 | 308 |
| 189 | 3300045049 | Ga0466959_0030304 | Ga0466959_0030304_1399_2355 | 309 |
| 190 | 3300049575 | Ga0501039_0029308 | Ga0501039_0029308_2299_3264 | 309 |
| 191 | 3300049587 | Ga0501071_0082888 | Ga0501071_0082888_951_1916 | 309 |
| 192 | 3300049592 | Ga0501076_0046191 | Ga0501076_0046191_107_1072 | 309 |
| 193 | 3300049741 | Ga0501079_0104345 | Ga0501079_0104345_1060_2025 | 309 |
| 194 | 3300049742 | Ga0501080_0058440 | Ga0501080_0058440_703_1668 | 309 |
| 195 | 3300049743 | Ga0501081_0114042 | Ga0501081_0114042_95_1060 | 309 |
| 196 | 3300049824 | Ga0501045_0173779 | Ga0501045_0173779_412_1377 | 309 |
| 197 | 3300054114 | Ga0501084_0046552 | Ga0501084_0046552_1032_1997 | 309 |
| 198 | 3300003911 | JGI25405J52794_10016871 | JGI25405J52794_100168712 | 310 |
| 199 | 3300006038 | Ga0075365_10048318 | Ga0075365_100483182 | 310 |
| 200 | 3300006051 | Ga0075364_10065465 | Ga0075364_100654652 | 310 |
| 201 | 3300025949 | Ga0207667_10186996 | Ga0207667_101869962 | 310 |
| 202 | 3300035086 | Ga0373934_0021851 | Ga0373934_0021851_750_1718 | 310 |
| 203 | 3300044658 | Ga0466972_0000189 | Ga0466972_0000189_14953_15921 | 310 |
| 204 | 3300044765 | Ga0466970_0133648 | Ga0466970_0133648_233_1201 | 310 |
| 205 | 3300046501 | Ga0495607_0123383 | Ga0495607_0123383_24_956 | 310 |
| 206 | 3300046680 | Ga0495646_0015954 | Ga0495646_0015954_1878_2846 | 310 |
| 207 | 3300048903 | Ga0496100_0032375 | Ga0496100_0032375_1419_2387 | 310 |
| 208 | 3300049589 | Ga0501073_0147202 | Ga0501073_0147202_537_1502 | 310 |
| 209 | 3300050491 | nmdc:mga00v17_263642_c1 | nmdc:mga00v17_263642_c1_45_1004 | 310 |
| 210 | 3300050492 | nmdc:mga0yw44_107288_c1 | nmdc:mga0yw44_107288_c1_685_1644 | 310 |
| 211 | 3300009551 | Ga0105238_10268966 | Ga0105238_102689662 | 311 |
| 212 | 3300025903 | Ga0207680_10106766 | Ga0207680_101067662 | 311 |
| 213 | 3300025912 | Ga0207707_10013921 | Ga0207707_100139214 | 311 |
| 214 | 3300025924 | Ga0207694_10171704 | Ga0207694_101717042 | 311 |
| 215 | 3300005719 | Ga0068861_100262545 | Ga0068861_1002625451 | 312 |
| 216 | 3300009098 | Ga0105245_10056957 | Ga0105245_100569573 | 312 |
| 217 | 3300009177 | Ga0105248_10043504 | Ga0105248_100435043 | 312 |
| 218 | 3300013297 | Ga0157378_10069939 | Ga0157378_100699392 | 312 |
| 219 | 3300025934 | Ga0207686_10096001 | Ga0207686_100960013 | 312 |
| 220 | 3300025941 | Ga0207711_10054504 | Ga0207711_100545041 | 312 |
| 221 | 3300026118 | Ga0207675_100220039 | Ga0207675_1002200392 | 312 |
| 222 | 3300053121 | Ga0500607_025574 | Ga0500607_025574_1615_2583 | 313 |
| 223 | 3300053145 | Ga0500586_004477 | Ga0500586_004477_1548_2516 | 313 |
| 224 | 3300046557 | Ga0495622_0079394 | Ga0495622_0079394_255_1223 | 314 |
| 225 | 3300053093 | Ga0500651_0204075 | Ga0500651_0204075_118_1086 | 314 |
| 226 | 3300053094 | Ga0500566_0005587 | Ga0500566_0005587_6149_7117 | 314 |
| 227 | 3300053122 | Ga0500608_001229 | Ga0500608_001229_702_1670 | 314 |
| 228 | 3300053122 | Ga0500608_003410 | Ga0500608_003410_1432_2400 | 314 |
| 229 | 3300053125 | Ga0500618_032142 | Ga0500618_032142_97_1065 | 314 |
| 230 | 3300053136 | Ga0500559_0000067 | Ga0500559_0000067_1530_2498 | 314 |
| 231 | 3300053136 | Ga0500559_0025764 | Ga0500559_0025764_1432_2400 | 314 |
| 232 | 3300053157 | Ga0500624_019353 | Ga0500624_019353_99_1067 | 314 |
| 233 | iso_pu_bacteria | 2513237096 | 2513660880 | 314 |
| 234 | iso_pu_bacteria | 2513237145 | 2513919583 | 314 |
| 235 | 3300006028 | Ga0070717_10343363 | Ga0070717_103433632 | 316 |
| 236 | 3300009093 | Ga0105240_10070766 | Ga0105240_100707664 | 316 |
| 237 | 3300049586 | Ga0501070_0201889 | Ga0501070_0201889_333_1298 | 316 |
| 238 | 3300049590 | Ga0501074_0304748 | Ga0501074_0304748_133_1098 | 316 |
| 239 | iso_pu_bacteria | 2511231021 | 2511358071 | 316 |
| 240 | 3300007076 | Ga0075435_100366660 | Ga0075435_1003666602 | 317 |
| 241 | 3300050511 | nmdc:mga08y16_89962_c1 | nmdc:mga08y16_89962_c1_2111_3133 | 317 |
| 242 | 3300050512 | nmdc:mga0n895_143382_c1 | nmdc:mga0n895_143382_c1_157_1179 | 317 |
| 243 | 3300050513 | nmdc:mga0rr50_242490_c1 | nmdc:mga0rr50_242490_c1_292_1314 | 317 |
| 244 | iso_pu_bacteria | 2511231028 | 2511400719 | 317 |
| 245 | iso_pu_bacteria | 2513237094 | 2513644466 | 317 |
| 246 | iso_pu_bacteria | 2602042107 | 2603859616 | 317 |
| 247 | iso_pu_bacteria | 2617270741 | 2617375577 | 317 |
| 248 | iso_pu_bacteria | 2824600985 | 2824604041 | 317 |
| 249 | iso_pu_bacteria | 2824609381 | 2824610310 | 317 |
| 250 | iso_pu_bacteria | 2824653114 | 2824658049 | 317 |
| 251 | iso_pu_bacteria | 2824704595 | 2824709001 | 317 |
| 252 | iso_pu_bacteria | 2824732956 | 2824735282 | 317 |
| 253 | iso_pu_bacteria | 2824746037 | 2824746618 | 317 |
| 254 | iso_pu_bacteria | 2824753945 | 2824759583 | 317 |
| 255 | iso_pu_bacteria | 2824763712 | 2824770014 | 317 |
| 256 | iso_pu_bacteria | 2844315083 | 2844319237 | 317 |
| 257 | iso_pu_bacteria | 2857509624 | 2857514129 | 317 |
| 258 | iso_pu_bacteria | 2857524615 | 2857528977 | 317 |
| 259 | iso_pu_bacteria | 2888388044 | 2888393636 | 317 |
| 260 | iso_pu_bacteria | 2888419890 | 2888424711 | 317 |
| 261 | iso_pu_bacteria | 2893066018 | 2893070434 | 317 |
| 262 | iso_pu_bacteria | 2903727486 | 2903731079 | 317 |
| 263 | iso_pu_bacteria | 2904711408 | 2904714839 | 317 |
| 264 | iso_pu_bacteria | 2906602504 | 2906607414 | 317 |
| 265 | iso_pu_bacteria | 2908775508 | 2908780357 | 317 |
| 266 | iso_pu_bacteria | 2919073203 | 2919076376 | 317 |
| 267 | iso_pu_bacteria | 2932794094 | 2932799779 | 317 |
| 268 | iso_pu_bacteria | 2932801729 | 2932806970 | 317 |
| 269 | iso_pu_bacteria | 2935883170 | 2935886906 | 317 |
| 270 | iso_pu_bacteria | 2941531003 | 2941532993 | 317 |
| 271 | iso_pu_bacteria | 3005483717 | 3005484487 | 317 |
| 272 | iso_pu_bacteria | 3005506211 | 3005510502 | 317 |
| 273 | iso_pu_bacteria | 3005594810 | 3005599407 | 317 |
| 274 | iso_pu_bacteria | 3005718088 | 3005722482 | 317 |
| 275 | iso_pu_bacteria | 8019648815 | 8019658573 | 317 |
| 276 | iso_pu_bacteria | 8056967851 | 8056968198 | 317 |
| 277 | 3300009174 | Ga0105241_10372184 | Ga0105241_103721842 | 318 |
| 278 | 3300021388 | Ga0213875_10000023 | Ga0213875_1000002336 | 318 |
| 279 | 3300037853 | Ga0436364_1416054 | Ga0436364_1416054_362_1387 | 318 |
| 280 | 3300039437 | Ga0436365_1356220 | Ga0436365_1356220_12_1040 | 318 |
| 281 | 3300049586 | Ga0501070_0009287 | Ga0501070_0009287_675_1709 | 318 |
| 282 | iso_pu_bacteria | 2643221547 | 2643757143 | 318 |
| 283 | 3300005981 | Ga0081538_10040168 | Ga0081538_100401683 | 319 |
| 284 | 3300006038 | Ga0075365_10150789 | Ga0075365_101507891 | 319 |
| 285 | 3300049588 | Ga0501072_0125982 | Ga0501072_0125982_270_1286 | 319 |
| 286 | 3300049591 | Ga0501075_0289053 | Ga0501075_0289053_10_1026 | 319 |
| 287 | 3300049591 | Ga0501075_0414835 | Ga0501075_0414835_44_1003 | 319 |
| 288 | 3300049741 | Ga0501079_0250509 | Ga0501079_0250509_95_1111 | 319 |
| 289 | 3300053096 | Ga0500641_0006277 | Ga0500641_0006277_741_1724 | 319 |
| 290 | 3300054114 | Ga0501084_0232677 | Ga0501084_0232677_398_1414 | 319 |
| 291 | 3300060353 | Ga0501082_0147642 | Ga0501082_0147642_337_1296 | 319 |
| 292 | 3300005937 | Ga0081455_10000982 | Ga0081455_100009829 | 320 |
| 293 | 3300006844 | Ga0075428_100103893 | Ga0075428_1001038932 | 320 |
| 294 | 3300006847 | Ga0075431_100014864 | Ga0075431_1000148641 | 320 |
| 295 | 3300035116 | Ga0373945_0055567 | Ga0373945_0055567_93_1055 | 320 |
| 296 | 3300037068 | Ga0373925_0001514 | Ga0373925_0001514_2712_3674 | 320 |
| 297 | 3300037312 | Ga0395899_0214599 | Ga0395899_0214599_230_1192 | 320 |
| 298 | 3300037418 | Ga0395900_0126781 | Ga0395900_0126781_1425_2387 | 320 |
| 299 | 3300037466 | Ga0395898_0177413 | Ga0395898_0177413_551_1513 | 320 |
| 300 | 3300037471 | Ga0395905_0095032 | Ga0395905_0095032_668_1630 | 320 |
| 301 | 3300038443 | Ga0395901_0044035 | Ga0395901_0044035_84_1046 | 320 |
| 302 | 3300041407 | Ga0439447_005815 | Ga0439447_005815_3062_4045 | 320 |
| 303 | 3300042138 | Ga0450903_001354 | Ga0450903_001354_3216_4199 | 320 |
| 304 | 3300044694 | Ga0466963_0013352 | Ga0466963_0013352_887_1849 | 320 |
| 305 | 3300044842 | Ga0466957_0333020 | Ga0466957_0333020_39_1001 | 320 |
| 306 | 3300045049 | Ga0466959_0089806 | Ga0466959_0089806_1221_2183 | 320 |
| 307 | 3300046454 | Ga0495592_0091436 | Ga0495592_0091436_431_1393 | 320 |
| 308 | 3300046459 | Ga0495629_0052653 | Ga0495629_0052653_481_1443 | 320 |
| 309 | 3300046460 | Ga0495638_0002166 | Ga0495638_0002166_4623_5606 | 320 |
| 310 | 3300046460 | Ga0495638_0002585 | Ga0495638_0002585_8592_9575 | 320 |
| 311 | 3300046463 | Ga0495653_0013899 | Ga0495653_0013899_2058_3020 | 320 |
| 312 | 3300046477 | Ga0495664_0005166 | Ga0495664_0005166_3108_4070 | 320 |
| 313 | 3300046514 | Ga0495618_0011685 | Ga0495618_0011685_702_1664 | 320 |
| 314 | 3300046517 | Ga0495630_0005678 | Ga0495630_0005678_7194_8156 | 320 |
| 315 | 3300046533 | Ga0495640_0002925 | Ga0495640_0002925_11219_12181 | 320 |
| 316 | 3300046543 | Ga0495645_0004568 | Ga0495645_0004568_3880_4842 | 320 |
| 317 | 3300046642 | Ga0495634_0077843 | Ga0495634_0077843_544_1506 | 320 |
| 318 | 3300046663 | Ga0495635_0003066 | Ga0495635_0003066_8648_9610 | 320 |
| 319 | 3300046680 | Ga0495646_0018897 | Ga0495646_0018897_440_1402 | 320 |
| 320 | 3300047319 | Ga0495674_0028208 | Ga0495674_0028208_842_1804 | 320 |
| 321 | 3300047471 | Ga0495684_0003187 | Ga0495684_0003187_668_1630 | 320 |
| 322 | 3300050507 | nmdc:mga05p37_159771_c1 | nmdc:mga05p37_159771_c1_712_1674 | 320 |
| 323 | 3300050507 | nmdc:mga05p37_314549_c1 | nmdc:mga05p37_314549_c1_282_1244 | 320 |
| 324 | 3300050510 | nmdc:mga06r32_73287_c1 | nmdc:mga06r32_73287_c1_619_1581 | 320 |
| 325 | 3300053077 | Ga0495601_0004046 | Ga0495601_0004046_4396_5358 | 320 |
| 326 | 3300053078 | Ga0495612_0000523 | Ga0495612_0000523_11385_12347 | 320 |
| 327 | 3300053084 | Ga0495595_0094291 | Ga0495595_0094291_370_1332 | 320 |
| 328 | 3300053085 | Ga0495619_0003655 | Ga0495619_0003655_8283_9245 | 320 |
| 329 | 3300053085 | Ga0495619_0203344 | Ga0495619_0203344_148_1110 | 320 |
| 330 | 3300003763 | Ga0055529_1009397 | Ga0055529_10093971 | 321 |
| 331 | 3300005366 | Ga0070659_100174159 | Ga0070659_1001741593 | 321 |
| 332 | 3300005439 | Ga0070711_100144734 | Ga0070711_1001447343 | 321 |
| 333 | 3300005455 | Ga0070663_100141534 | Ga0070663_1001415342 | 321 |
| 334 | 3300005536 | Ga0070697_100000168 | Ga0070697_10000016861 | 321 |
| 335 | 3300005844 | Ga0068862_100227314 | Ga0068862_1002273141 | 321 |
| 336 | 3300005985 | Ga0081539_10000140 | Ga0081539_1000014095 | 321 |
| 337 | 3300006028 | Ga0070717_10316573 | Ga0070717_103165732 | 321 |
| 338 | 3300006038 | Ga0075365_10213019 | Ga0075365_102130192 | 321 |
| 339 | 3300006051 | Ga0075364_10021617 | Ga0075364_100216173 | 321 |
| 340 | 3300006051 | Ga0075364_10175131 | Ga0075364_101751311 | 321 |
| 341 | 3300006186 | Ga0075369_10008188 | Ga0075369_100081883 | 321 |
| 342 | 3300006186 | Ga0075369_10016682 | Ga0075369_100166823 | 321 |
| 343 | 3300006353 | Ga0075370_10009628 | Ga0075370_100096284 | 321 |
| 344 | 3300006353 | Ga0075370_10048586 | Ga0075370_100485862 | 321 |
| 345 | 3300006914 | Ga0075436_100000192 | Ga0075436_10000019230 | 321 |
| 346 | 3300009093 | Ga0105240_10002078 | Ga0105240_1000207827 | 321 |
| 347 | 3300009098 | Ga0105245_10140599 | Ga0105245_101405993 | 321 |
| 348 | 3300009174 | Ga0105241_10016563 | Ga0105241_100165632 | 321 |
| 349 | 3300009545 | Ga0105237_10015521 | Ga0105237_100155212 | 321 |
| 350 | 3300010375 | Ga0105239_10009271 | Ga0105239_100092719 | 321 |
| 351 | 3300010375 | Ga0105239_10095136 | Ga0105239_100951363 | 321 |
| 352 | 3300010375 | Ga0105239_10288768 | Ga0105239_102887682 | 321 |
| 353 | 3300011119 | Ga0105246_10058939 | Ga0105246_100589393 | 321 |
| 354 | 3300014325 | Ga0163163_10002228 | Ga0163163_1000222815 | 321 |
| 355 | 3300014326 | Ga0157380_10461852 | Ga0157380_104618522 | 321 |
| 356 | 3300014969 | Ga0157376_10111465 | Ga0157376_101114652 | 321 |
| 357 | 3300021320 | Ga0214544_1000002 | Ga0214544_1000002258 | 321 |
| 358 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001608 | 321 |
| 359 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001674 | 321 |
| 360 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001521 | 321 |
| 361 | 3300025253 | Ga0209677_103988 | Ga0209677_1039883 | 321 |
| 362 | 3300025254 | Ga0209148_1000841 | Ga0209148_10008418 | 321 |
| 363 | 3300025261 | Ga0209233_1025604 | Ga0209233_10256042 | 321 |
| 364 | 3300025272 | Ga0209455_1003926 | Ga0209455_10039263 | 321 |
| 365 | 3300025295 | Ga0209564_1009425 | Ga0209564_10094253 | 321 |
| 366 | 3300025297 | Ga0209758_1003241 | Ga0209758_100324111 | 321 |
| 367 | 3300025302 | Ga0207426_1002280 | Ga0207426_10022805 | 321 |
| 368 | 3300025909 | Ga0207705_10120672 | Ga0207705_101206722 | 321 |
| 369 | 3300025911 | Ga0207654_10053478 | Ga0207654_100534782 | 321 |
| 370 | 3300025913 | Ga0207695_10000910 | Ga0207695_1000091018 | 321 |
| 371 | 3300025914 | Ga0207671_10002587 | Ga0207671_100025872 | 321 |
| 372 | 3300026067 | Ga0207678_10077913 | Ga0207678_100779133 | 321 |
| 373 | 3300026078 | Ga0207702_10348794 | Ga0207702_103487942 | 321 |
| 374 | 3300026121 | Ga0207683_10312162 | Ga0207683_103121622 | 321 |
| 375 | 3300031235 | Ga0265330_10004928 | Ga0265330_100049287 | 321 |
| 376 | 3300031247 | Ga0265340_10000710 | Ga0265340_1000071016 | 321 |
| 377 | 3300031911 | Ga0307412_10113062 | Ga0307412_101130623 | 321 |
| 378 | 3300044683 | Ga0466965_0018538 | Ga0466965_0018538_303_1271 | 321 |
| 379 | 3300044694 | Ga0466963_0030438 | Ga0466963_0030438_927_1895 | 321 |
| 380 | 3300045976 | Ga0466967_0024787 | Ga0466967_0024787_2496_3464 | 321 |
| 381 | 3300046506 | Ga0495583_0070437 | Ga0495583_0070437_365_1333 | 321 |
| 382 | 3300046515 | Ga0495620_0031063 | Ga0495620_0031063_1130_2098 | 321 |
| 383 | 3300046518 | Ga0495631_0087586 | Ga0495631_0087586_275_1243 | 321 |
| 384 | 3300046519 | Ga0495632_0113164 | Ga0495632_0113164_108_1076 | 321 |
| 385 | 3300046524 | Ga0495648_0013688 | Ga0495648_0013688_3472_4440 | 321 |
| 386 | 3300046642 | Ga0495634_0064753 | Ga0495634_0064753_812_1780 | 321 |
| 387 | 3300046660 | Ga0495625_0062082 | Ga0495625_0062082_813_1781 | 321 |
| 388 | 3300046663 | Ga0495635_0008585 | Ga0495635_0008585_176_1144 | 321 |
| 389 | 3300046665 | Ga0495661_0082361 | Ga0495661_0082361_686_1654 | 321 |
| 390 | 3300046675 | Ga0495657_0197965 | Ga0495657_0197965_96_1064 | 321 |
| 391 | 3300046694 | Ga0495649_0023164 | Ga0495649_0023164_478_1446 | 321 |
| 392 | 3300047317 | Ga0495604_0050228 | Ga0495604_0050228_1987_2955 | 321 |
| 393 | 3300047317 | Ga0495604_0116991 | Ga0495604_0116991_819_1787 | 321 |
| 394 | 3300047321 | Ga0495676_0174338 | Ga0495676_0174338_203_1171 | 321 |
| 395 | 3300047472 | Ga0495686_0053940 | Ga0495686_0053940_1455_2423 | 321 |
| 396 | 3300048903 | Ga0496100_0282258 | Ga0496100_0282258_180_1148 | 321 |
| 397 | 3300048905 | Ga0496102_0086626 | Ga0496102_0086626_953_1921 | 321 |
| 398 | 3300048907 | Ga0496104_0020552 | Ga0496104_0020552_1175_2143 | 321 |
| 399 | 3300048908 | Ga0496105_0003408 | Ga0496105_0003408_5963_6931 | 321 |
| 400 | 3300048908 | Ga0496105_0061537 | Ga0496105_0061537_1999_2967 | 321 |
| 401 | 3300048909 | Ga0496106_0014078 | Ga0496106_0014078_4115_5083 | 321 |
| 402 | 3300048912 | Ga0496109_0099287 | Ga0496109_0099287_1684_2652 | 321 |
| 403 | 3300048913 | Ga0496110_0065261 | Ga0496110_0065261_1168_2136 | 321 |
| 404 | 3300048914 | Ga0496111_0202114 | Ga0496111_0202114_409_1377 | 321 |
| 405 | 3300048915 | Ga0496112_0034410 | Ga0496112_0034410_3578_4546 | 321 |
| 406 | 3300048917 | Ga0496114_0442260 | Ga0496114_0442260_100_1068 | 321 |
| 407 | 3300048920 | Ga0496117_0130566 | Ga0496117_0130566_274_1242 | 321 |
| 408 | 3300048921 | Ga0496118_0089002 | Ga0496118_0089002_277_1245 | 321 |
| 409 | 3300048922 | Ga0496119_0020237 | Ga0496119_0020237_2479_3447 | 321 |
| 410 | 3300048922 | Ga0496119_0092778 | Ga0496119_0092778_124_1092 | 321 |
| 411 | 3300048923 | Ga0496120_0035672 | Ga0496120_0035672_1462_2430 | 321 |
| 412 | 3300048925 | Ga0496122_0025741 | Ga0496122_0025741_2557_3525 | 321 |
| 413 | 3300048926 | Ga0496123_0096119 | Ga0496123_0096119_439_1407 | 321 |
| 414 | 3300048928 | Ga0496125_0048499 | Ga0496125_0048499_1632_2600 | 321 |
| 415 | 3300048928 | Ga0496125_0055066 | Ga0496125_0055066_902_1870 | 321 |
| 416 | 3300048929 | Ga0496126_0146150 | Ga0496126_0146150_612_1580 | 321 |
| 417 | 3300049579 | Ga0501043_0052810 | Ga0501043_0052810_1381_2346 | 321 |
| 418 | 3300049742 | Ga0501080_0172405 | Ga0501080_0172405_92_1057 | 321 |
| 419 | 3300049822 | Ga0501035_0062674 | Ga0501035_0062674_1407_2372 | 321 |
| 420 | 3300050491 | nmdc:mga00v17_117160_c1 | nmdc:mga00v17_117160_c1_448_1416 | 321 |
| 421 | 3300050491 | nmdc:mga00v17_48740_c1 | nmdc:mga00v17_48740_c1_1253_2221 | 321 |
| 422 | 3300050514 | nmdc:mga08x19_14_c1 | nmdc:mga08x19_14_c1_106727_107695 | 321 |
| 423 | 3300050516 | nmdc:mga0sz30_26045_c1 | nmdc:mga0sz30_26045_c1_234_1202 | 321 |
| 424 | 3300050516 | nmdc:mga0sz30_5969_c1 | nmdc:mga0sz30_5969_c1_1442_2410 | 321 |
| 425 | 3300053080 | Ga0500635_0019866 | Ga0500635_0019866_110_1078 | 321 |
| 426 | 3300053085 | Ga0495619_0234801 | Ga0495619_0234801_103_1071 | 321 |
| 427 | 3300053087 | Ga0500643_010551 | Ga0500643_010551_889_1857 | 321 |
| 428 | 3300053089 | Ga0500581_066267 | Ga0500581_066267_704_1672 | 321 |
| 429 | 3300053093 | Ga0500651_0012814 | Ga0500651_0012814_2029_2997 | 321 |
| 430 | 3300053094 | Ga0500566_0004691 | Ga0500566_0004691_11_979 | 321 |
| 431 | 3300053094 | Ga0500566_0083560 | Ga0500566_0083560_768_1736 | 321 |
| 432 | 3300053104 | Ga0500556_0000004 | Ga0500556_0000004_631639_632607 | 321 |
| 433 | 3300053108 | Ga0500562_052297 | Ga0500562_052297_71_1039 | 321 |
| 434 | 3300053109 | Ga0500569_018758 | Ga0500569_018758_247_1215 | 321 |
| 435 | 3300053111 | Ga0500572_013643 | Ga0500572_013643_146_1114 | 321 |
| 436 | 3300053122 | Ga0500608_022074 | Ga0500608_022074_1944_2912 | 321 |
| 437 | 3300053130 | Ga0500642_0000186 | Ga0500642_0000186_14159_15127 | 321 |
| 438 | 3300053131 | Ga0500652_036517 | Ga0500652_036517_314_1282 | 321 |
| 439 | 3300053134 | Ga0500658_0023977 | Ga0500658_0023977_1018_1983 | 321 |
| 440 | 3300053136 | Ga0500559_0006042 | Ga0500559_0006042_2467_3435 | 321 |
| 441 | 3300053138 | Ga0500564_035305 | Ga0500564_035305_399_1367 | 321 |
| 442 | 3300053139 | Ga0500568_0001430 | Ga0500568_0001430_2235_3203 | 321 |
| 443 | 3300053139 | Ga0500568_0024932 | Ga0500568_0024932_1410_2378 | 321 |
| 444 | 3300053153 | Ga0500616_0000014 | Ga0500616_0000014_603331_604299 | 321 |
| 445 | 3300053154 | Ga0500619_001901 | Ga0500619_001901_1930_2898 | 321 |
| 446 | 3300053156 | Ga0500622_0000513 | Ga0500622_0000513_26325_27293 | 321 |
| 447 | 3300053162 | Ga0500638_102521 | Ga0500638_102521_90_1058 | 321 |
| 448 | 3300053177 | Ga0500636_0000122 | Ga0500636_0000122_22654_23622 | 321 |
| 449 | 3300001979 | JGI24740J21852_10012501 | JGI24740J21852_100125012 | 322 |
| 450 | 3300001989 | JGI24739J22299_10010613 | JGI24739J22299_100106134 | 322 |
| 451 | 3300001990 | JGI24737J22298_10003981 | JGI24737J22298_100039815 | 322 |
| 452 | 3300002070 | JGI24750J21931_1000181 | JGI24750J21931_10001817 | 322 |
| 453 | 3300002074 | JGI24748J21848_1000571 | JGI24748J21848_10005713 | 322 |
| 454 | 3300002075 | JGI24738J21930_10001393 | JGI24738J21930_100013935 | 322 |
| 455 | 3300002076 | JGI24749J21850_1001394 | JGI24749J21850_10013944 | 322 |
| 456 | 3300002077 | JGI24744J21845_10000700 | JGI24744J21845_100007007 | 322 |
| 457 | 3300002126 | JGI24035J26624_1001034 | JGI24035J26624_10010343 | 322 |
| 458 | 3300002155 | JGI24033J26618_1000816 | JGI24033J26618_10008162 | 322 |
| 459 | 3300002239 | JGI24034J26672_10000836 | JGI24034J26672_100008361 | 322 |
| 460 | 3300002244 | JGI24742J22300_10001030 | JGI24742J22300_100010302 | 322 |
| 461 | 3300005290 | Ga0065712_10078399 | Ga0065712_100783993 | 322 |
| 462 | 3300005293 | Ga0065715_10089022 | Ga0065715_1008902215 | 322 |
| 463 | 3300005328 | Ga0070676_10002898 | Ga0070676_100028984 | 322 |
| 464 | 3300005329 | Ga0070683_100001166 | Ga0070683_1000011668 | 322 |
| 465 | 3300005330 | Ga0070690_100229444 | Ga0070690_1002294442 | 322 |
| 466 | 3300005331 | Ga0070670_100003635 | Ga0070670_10000363514 | 322 |
| 467 | 3300005333 | Ga0070677_10000126 | Ga0070677_1000012620 | 322 |
| 468 | 3300005334 | Ga0068869_100009659 | Ga0068869_1000096592 | 322 |
| 469 | 3300005335 | Ga0070666_10018143 | Ga0070666_100181435 | 322 |
| 470 | 3300005336 | Ga0070680_100013378 | Ga0070680_1000133787 | 322 |
| 471 | 3300005336 | Ga0070680_100153986 | Ga0070680_1001539861 | 322 |
| 472 | 3300005337 | Ga0070682_100003724 | Ga0070682_1000037243 | 322 |
| 473 | 3300005337 | Ga0070682_100100059 | Ga0070682_1001000592 | 322 |
| 474 | 3300005338 | Ga0068868_100003027 | Ga0068868_1000030273 | 322 |
| 475 | 3300005339 | Ga0070660_100010060 | Ga0070660_1000100604 | 322 |
| 476 | 3300005339 | Ga0070660_100051659 | Ga0070660_1000516592 | 322 |
| 477 | 3300005339 | Ga0070660_100164105 | Ga0070660_1001641052 | 322 |
| 478 | 3300005340 | Ga0070689_100003384 | Ga0070689_1000033848 | 322 |
| 479 | 3300005340 | Ga0070689_100018800 | Ga0070689_1000188006 | 322 |
| 480 | 3300005341 | Ga0070691_10000994 | Ga0070691_100009947 | 322 |
| 481 | 3300005343 | Ga0070687_100000085 | Ga0070687_1000000853 | 322 |
| 482 | 3300005344 | Ga0070661_100000307 | Ga0070661_10000030745 | 322 |
| 483 | 3300005345 | Ga0070692_10002518 | Ga0070692_100025187 | 322 |
| 484 | 3300005345 | Ga0070692_10029229 | Ga0070692_100292293 | 322 |
| 485 | 3300005347 | Ga0070668_100001248 | Ga0070668_10000124814 | 322 |
| 486 | 3300005353 | Ga0070669_100005868 | Ga0070669_1000058687 | 322 |
| 487 | 3300005354 | Ga0070675_100024482 | Ga0070675_1000244822 | 322 |
| 488 | 3300005354 | Ga0070675_100110171 | Ga0070675_1001101711 | 322 |
| 489 | 3300005355 | Ga0070671_100009899 | Ga0070671_1000098995 | 322 |
| 490 | 3300005356 | Ga0070674_100003469 | Ga0070674_1000034697 | 322 |
| 491 | 3300005364 | Ga0070673_100000152 | Ga0070673_1000001525 | 322 |
| 492 | 3300005365 | Ga0070688_100000558 | Ga0070688_10000055817 | 322 |
| 493 | 3300005366 | Ga0070659_100010268 | Ga0070659_1000102682 | 322 |
| 494 | 3300005367 | Ga0070667_100005640 | Ga0070667_1000056405 | 322 |
| 495 | 3300005367 | Ga0070667_100071738 | Ga0070667_1000717382 | 322 |
| 496 | 3300005436 | Ga0070713_100191199 | Ga0070713_1001911992 | 322 |
| 497 | 3300005437 | Ga0070710_10101024 | Ga0070710_101010242 | 322 |
| 498 | 3300005438 | Ga0070701_10006397 | Ga0070701_100063975 | 322 |
| 499 | 3300005438 | Ga0070701_10138846 | Ga0070701_101388462 | 322 |
| 500 | 3300005440 | Ga0070705_100005321 | Ga0070705_1000053212 | 322 |
| 501 | 3300005441 | Ga0070700_100002863 | Ga0070700_1000028637 | 322 |
| 502 | 3300005441 | Ga0070700_100098089 | Ga0070700_1000980892 | 322 |
| 503 | 3300005444 | Ga0070694_100001507 | Ga0070694_10000150714 | 322 |
| 504 | 3300005444 | Ga0070694_100158080 | Ga0070694_1001580802 | 322 |
| 505 | 3300005445 | Ga0070708_100167806 | Ga0070708_1001678062 | 322 |
| 506 | 3300005455 | Ga0070663_100000522 | Ga0070663_10000052221 | 322 |
| 507 | 3300005456 | Ga0070678_100040107 | Ga0070678_1000401072 | 322 |
| 508 | 3300005457 | Ga0070662_100001666 | Ga0070662_10000166614 | 322 |
| 509 | 3300005458 | Ga0070681_10017661 | Ga0070681_100176617 | 322 |
| 510 | 3300005459 | Ga0068867_100005662 | Ga0068867_1000056627 | 322 |
| 511 | 3300005466 | Ga0070685_10006948 | Ga0070685_100069483 | 322 |
| 512 | 3300005530 | Ga0070679_100007489 | Ga0070679_1000074894 | 322 |
| 513 | 3300005530 | Ga0070679_100154571 | Ga0070679_1001545712 | 322 |
| 514 | 3300005530 | Ga0070679_100194254 | Ga0070679_1001942542 | 322 |
| 515 | 3300005535 | Ga0070684_100000894 | Ga0070684_10000089421 | 322 |
| 516 | 3300005539 | Ga0068853_100010158 | Ga0068853_1000101583 | 322 |
| 517 | 3300005543 | Ga0070672_100011122 | Ga0070672_1000111227 | 322 |
| 518 | 3300005544 | Ga0070686_100016131 | Ga0070686_1000161311 | 322 |
| 519 | 3300005544 | Ga0070686_100130355 | Ga0070686_1001303551 | 322 |
| 520 | 3300005545 | Ga0070695_100031469 | Ga0070695_1000314694 | 322 |
| 521 | 3300005545 | Ga0070695_100111168 | Ga0070695_1001111681 | 322 |
| 522 | 3300005546 | Ga0070696_100005009 | Ga0070696_1000050097 | 322 |
| 523 | 3300005546 | Ga0070696_100020495 | Ga0070696_1000204955 | 322 |
| 524 | 3300005547 | Ga0070693_100000134 | Ga0070693_1000001342 | 322 |
| 525 | 3300005548 | Ga0070665_100059697 | Ga0070665_1000596974 | 322 |
| 526 | 3300005549 | Ga0070704_100000428 | Ga0070704_10000042814 | 322 |
| 527 | 3300005563 | Ga0068855_100007545 | Ga0068855_10000754513 | 322 |
| 528 | 3300005563 | Ga0068855_100010956 | Ga0068855_1000109563 | 322 |
| 529 | 3300005564 | Ga0070664_100026882 | Ga0070664_1000268822 | 322 |
| 530 | 3300005577 | Ga0068857_100011473 | Ga0068857_1000114732 | 322 |
| 531 | 3300005578 | Ga0068854_100005312 | Ga0068854_1000053128 | 322 |
| 532 | 3300005614 | Ga0068856_100021406 | Ga0068856_1000214063 | 322 |
| 533 | 3300005614 | Ga0068856_100114383 | Ga0068856_1001143834 | 322 |
| 534 | 3300005615 | Ga0070702_100000638 | Ga0070702_1000006382 | 322 |
| 535 | 3300005616 | Ga0068852_100002115 | Ga0068852_10000211514 | 322 |
| 536 | 3300005617 | Ga0068859_100006242 | Ga0068859_1000062428 | 322 |
| 537 | 3300005618 | Ga0068864_100028055 | Ga0068864_1000280555 | 322 |
| 538 | 3300005718 | Ga0068866_10000301 | Ga0068866_1000030117 | 322 |
| 539 | 3300005719 | Ga0068861_100057538 | Ga0068861_1000575383 | 322 |
| 540 | 3300005840 | Ga0068870_10000354 | Ga0068870_1000035415 | 322 |
| 541 | 3300005841 | Ga0068863_100000340 | Ga0068863_10000034026 | 322 |
| 542 | 3300005842 | Ga0068858_100009915 | Ga0068858_1000099154 | 322 |
| 543 | 3300005842 | Ga0068858_100267039 | Ga0068858_1002670391 | 322 |
| 544 | 3300005843 | Ga0068860_100013035 | Ga0068860_1000130357 | 322 |
| 545 | 3300005844 | Ga0068862_100015630 | Ga0068862_1000156304 | 322 |
| 546 | 3300005983 | Ga0081540_1032154 | Ga0081540_10321542 | 322 |
| 547 | 3300006175 | Ga0070712_100271797 | Ga0070712_1002717972 | 322 |
| 548 | 3300006178 | Ga0075367_10012900 | Ga0075367_100129003 | 322 |
| 549 | 3300006237 | Ga0097621_100000040 | Ga0097621_10000004074 | 322 |
| 550 | 3300006358 | Ga0068871_100000301 | Ga0068871_10000030121 | 322 |
| 551 | 3300006844 | Ga0075428_100003180 | Ga0075428_1000031808 | 322 |
| 552 | 3300006846 | Ga0075430_100000201 | Ga0075430_10000020134 | 322 |
| 553 | 3300006847 | Ga0075431_100000260 | Ga0075431_10000026034 | 322 |
| 554 | 3300006852 | Ga0075433_10000007 | Ga0075433_1000000745 | 322 |
| 555 | 3300006852 | Ga0075433_10009124 | Ga0075433_100091244 | 322 |
| 556 | 3300006871 | Ga0075434_100000091 | Ga0075434_10000009113 | 322 |
| 557 | 3300006871 | Ga0075434_100017859 | Ga0075434_1000178593 | 322 |
| 558 | 3300006871 | Ga0075434_100104601 | Ga0075434_1001046011 | 322 |
| 559 | 3300006880 | Ga0075429_100001824 | Ga0075429_1000018248 | 322 |
| 560 | 3300006881 | Ga0068865_100000275 | Ga0068865_1000002752 | 322 |
| 561 | 3300006931 | Ga0097620_100006242 | Ga0097620_1000062428 | 322 |
| 562 | 3300007076 | Ga0075435_100010439 | Ga0075435_1000104396 | 322 |
| 563 | 3300009094 | Ga0111539_10013469 | Ga0111539_100134695 | 322 |
| 564 | 3300009098 | Ga0105245_10010701 | Ga0105245_100107012 | 322 |
| 565 | 3300009101 | Ga0105247_10018307 | Ga0105247_100183073 | 322 |
| 566 | 3300009147 | Ga0114129_10002772 | Ga0114129_100027727 | 322 |
| 567 | 3300009148 | Ga0105243_10004388 | Ga0105243_100043889 | 322 |
| 568 | 3300009174 | Ga0105241_10001943 | Ga0105241_100019431 | 322 |
| 569 | 3300009176 | Ga0105242_10007706 | Ga0105242_100077065 | 322 |
| 570 | 3300009176 | Ga0105242_10019682 | Ga0105242_100196824 | 322 |
| 571 | 3300009177 | Ga0105248_10003102 | Ga0105248_1000310219 | 322 |
| 572 | 3300009177 | Ga0105248_10069324 | Ga0105248_100693243 | 322 |
| 573 | 3300009545 | Ga0105237_10054424 | Ga0105237_100544244 | 322 |
| 574 | 3300009551 | Ga0105238_10052558 | Ga0105238_100525582 | 322 |
| 575 | 3300009553 | Ga0105249_10001599 | Ga0105249_100015997 | 322 |
| 576 | 3300010375 | Ga0105239_10009752 | Ga0105239_100097525 | 322 |
| 577 | 3300011119 | Ga0105246_10007217 | Ga0105246_100072173 | 322 |
| 578 | 3300012495 | Ga0157323_1000404 | Ga0157323_10004041 | 322 |
| 579 | 3300012507 | Ga0157342_1004325 | Ga0157342_10043252 | 322 |
| 580 | 3300013102 | Ga0157371_10010606 | Ga0157371_100106064 | 322 |
| 581 | 3300013104 | Ga0157370_10078491 | Ga0157370_100784911 | 322 |
| 582 | 3300013296 | Ga0157374_10001695 | Ga0157374_1000169516 | 322 |
| 583 | 3300013297 | Ga0157378_10003374 | Ga0157378_100033747 | 322 |
| 584 | 3300013297 | Ga0157378_10163081 | Ga0157378_101630813 | 322 |
| 585 | 3300013306 | Ga0163162_10010828 | Ga0163162_100108285 | 322 |
| 586 | 3300013307 | Ga0157372_10004321 | Ga0157372_1000432117 | 322 |
| 587 | 3300013307 | Ga0157372_10148826 | Ga0157372_101488263 | 322 |
| 588 | 3300013307 | Ga0157372_10580702 | Ga0157372_105807022 | 322 |
| 589 | 3300013308 | Ga0157375_10008254 | Ga0157375_100082548 | 322 |
| 590 | 3300014325 | Ga0163163_10013922 | Ga0163163_100139224 | 322 |
| 591 | 3300014326 | Ga0157380_10000891 | Ga0157380_1000089114 | 322 |
| 592 | 3300014745 | Ga0157377_10000517 | Ga0157377_100005174 | 322 |
| 593 | 3300014968 | Ga0157379_10011995 | Ga0157379_100119957 | 322 |
| 594 | 3300014968 | Ga0157379_10068978 | Ga0157379_100689783 | 322 |
| 595 | 3300014969 | Ga0157376_10000088 | Ga0157376_1000008868 | 322 |
| 596 | 3300017792 | Ga0163161_10000144 | Ga0163161_100001443 | 322 |
| 597 | 3300021384 | Ga0213876_10074468 | Ga0213876_100744683 | 322 |
| 598 | 3300025271 | Ga0207666_1000059 | Ga0207666_100005919 | 322 |
| 599 | 3300025271 | Ga0207666_1002359 | Ga0207666_10023593 | 322 |
| 600 | 3300025290 | Ga0207673_1000330 | Ga0207673_10003304 | 322 |
| 601 | 3300025315 | Ga0207697_10005773 | Ga0207697_100057735 | 322 |
| 602 | 3300025885 | Ga0207653_10002470 | Ga0207653_100024706 | 322 |
| 603 | 3300025893 | Ga0207682_10000509 | Ga0207682_100005095 | 322 |
| 604 | 3300025899 | Ga0207642_10006243 | Ga0207642_100062432 | 322 |
| 605 | 3300025900 | Ga0207710_10006153 | Ga0207710_100061533 | 322 |
| 606 | 3300025901 | Ga0207688_10000167 | Ga0207688_1000016729 | 322 |
| 607 | 3300025903 | Ga0207680_10042799 | Ga0207680_100427992 | 322 |
| 608 | 3300025904 | Ga0207647_10006799 | Ga0207647_100067997 | 322 |
| 609 | 3300025906 | Ga0207699_10015419 | Ga0207699_100154193 | 322 |
| 610 | 3300025907 | Ga0207645_10000100 | Ga0207645_1000010068 | 322 |
| 611 | 3300025907 | Ga0207645_10071803 | Ga0207645_100718032 | 322 |
| 612 | 3300025908 | Ga0207643_10000007 | Ga0207643_10000007179 | 322 |
| 613 | 3300025909 | Ga0207705_10018696 | Ga0207705_100186962 | 322 |
| 614 | 3300025912 | Ga0207707_10005018 | Ga0207707_100050185 | 322 |
| 615 | 3300025912 | Ga0207707_10398898 | Ga0207707_103988982 | 322 |
| 616 | 3300025914 | Ga0207671_10097263 | Ga0207671_100972632 | 322 |
| 617 | 3300025915 | Ga0207693_10244667 | Ga0207693_102446672 | 322 |
| 618 | 3300025917 | Ga0207660_10000041 | Ga0207660_100000414 | 322 |
| 619 | 3300025918 | Ga0207662_10000195 | Ga0207662_1000019530 | 322 |
| 620 | 3300025919 | Ga0207657_10002386 | Ga0207657_1000238619 | 322 |
| 621 | 3300025919 | Ga0207657_10009921 | Ga0207657_1000992110 | 322 |
| 622 | 3300025919 | Ga0207657_10027937 | Ga0207657_100279373 | 322 |
| 623 | 3300025920 | Ga0207649_10001482 | Ga0207649_100014823 | 322 |
| 624 | 3300025921 | Ga0207652_10002995 | Ga0207652_100029953 | 322 |
| 625 | 3300025921 | Ga0207652_10022353 | Ga0207652_100223532 | 322 |
| 626 | 3300025923 | Ga0207681_10001546 | Ga0207681_1000154614 | 322 |
| 627 | 3300025924 | Ga0207694_10030806 | Ga0207694_100308065 | 322 |
| 628 | 3300025925 | Ga0207650_10001317 | Ga0207650_100013176 | 322 |
| 629 | 3300025926 | Ga0207659_10003760 | Ga0207659_100037605 | 322 |
| 630 | 3300025927 | Ga0207687_10000072 | Ga0207687_1000007270 | 322 |
| 631 | 3300025927 | Ga0207687_10032877 | Ga0207687_100328774 | 322 |
| 632 | 3300025931 | Ga0207644_10001292 | Ga0207644_1000129214 | 322 |
| 633 | 3300025931 | Ga0207644_10044109 | Ga0207644_100441093 | 322 |
| 634 | 3300025932 | Ga0207690_10004975 | Ga0207690_100049753 | 322 |
| 635 | 3300025933 | Ga0207706_10010659 | Ga0207706_100106595 | 322 |
| 636 | 3300025933 | Ga0207706_10123401 | Ga0207706_101234013 | 322 |
| 637 | 3300025934 | Ga0207686_10001034 | Ga0207686_1000103411 | 322 |
| 638 | 3300025935 | Ga0207709_10001423 | Ga0207709_1000142314 | 322 |
| 639 | 3300025936 | Ga0207670_10007269 | Ga0207670_100072693 | 322 |
| 640 | 3300025937 | Ga0207669_10000176 | Ga0207669_1000017628 | 322 |
| 641 | 3300025938 | Ga0207704_10013299 | Ga0207704_100132993 | 322 |
| 642 | 3300025940 | Ga0207691_10008719 | Ga0207691_100087197 | 322 |
| 643 | 3300025941 | Ga0207711_10001106 | Ga0207711_1000110614 | 322 |
| 644 | 3300025942 | Ga0207689_10000366 | Ga0207689_1000036618 | 322 |
| 645 | 3300025944 | Ga0207661_10000087 | Ga0207661_100000873 | 322 |
| 646 | 3300025945 | Ga0207679_10000029 | Ga0207679_1000002918 | 322 |
| 647 | 3300025945 | Ga0207679_10339267 | Ga0207679_103392672 | 322 |
| 648 | 3300025949 | Ga0207667_10009257 | Ga0207667_100092572 | 322 |
| 649 | 3300025960 | Ga0207651_10001426 | Ga0207651_100014267 | 322 |
| 650 | 3300025961 | Ga0207712_10001547 | Ga0207712_1000154714 | 322 |
| 651 | 3300025961 | Ga0207712_10140029 | Ga0207712_101400292 | 322 |
| 652 | 3300025972 | Ga0207668_10007326 | Ga0207668_100073267 | 322 |
| 653 | 3300025981 | Ga0207640_10001474 | Ga0207640_100014743 | 322 |
| 654 | 3300025981 | Ga0207640_10288556 | Ga0207640_102885562 | 322 |
| 655 | 3300025981 | Ga0207640_10378418 | Ga0207640_103784181 | 322 |
| 656 | 3300025986 | Ga0207658_10005146 | Ga0207658_100051466 | 322 |
| 657 | 3300026035 | Ga0207703_10003109 | Ga0207703_100031092 | 322 |
| 658 | 3300026035 | Ga0207703_10117473 | Ga0207703_101174732 | 322 |
| 659 | 3300026041 | Ga0207639_10009108 | Ga0207639_100091083 | 322 |
| 660 | 3300026067 | Ga0207678_10007393 | Ga0207678_100073937 | 322 |
| 661 | 3300026067 | Ga0207678_10039128 | Ga0207678_100391284 | 322 |
| 662 | 3300026075 | Ga0207708_10007017 | Ga0207708_100070175 | 322 |
| 663 | 3300026075 | Ga0207708_10012400 | Ga0207708_100124005 | 322 |
| 664 | 3300026075 | Ga0207708_10088527 | Ga0207708_100885273 | 322 |
| 665 | 3300026078 | Ga0207702_10015638 | Ga0207702_100156383 | 322 |
| 666 | 3300026078 | Ga0207702_10056447 | Ga0207702_100564473 | 322 |
| 667 | 3300026088 | Ga0207641_10011956 | Ga0207641_100119563 | 322 |
| 668 | 3300026089 | Ga0207648_10008796 | Ga0207648_100087965 | 322 |
| 669 | 3300026095 | Ga0207676_10004807 | Ga0207676_100048077 | 322 |
| 670 | 3300026116 | Ga0207674_10000697 | Ga0207674_1000069748 | 322 |
| 671 | 3300026118 | Ga0207675_100005465 | Ga0207675_1000054657 | 322 |
| 672 | 3300026121 | Ga0207683_10000029 | Ga0207683_100000295 | 322 |
| 673 | 3300026142 | Ga0207698_10018865 | Ga0207698_100188653 | 322 |
| 674 | 3300027617 | Ga0210002_1001959 | Ga0210002_10019592 | 322 |
| 675 | 3300027695 | Ga0209966_1001374 | Ga0209966_10013743 | 322 |
| 676 | 3300027695 | Ga0209966_1003142 | Ga0209966_10031422 | 322 |
| 677 | 3300027717 | Ga0209998_10001898 | Ga0209998_100018983 | 322 |
| 678 | 3300027717 | Ga0209998_10005560 | Ga0209998_100055602 | 322 |
| 679 | 3300027876 | Ga0209974_10002097 | Ga0209974_100020977 | 322 |
| 680 | 3300027907 | Ga0207428_10000100 | Ga0207428_10000100131 | 322 |
| 681 | 3300027907 | Ga0207428_10000115 | Ga0207428_1000011537 | 322 |
| 682 | 3300028379 | Ga0268266_10040823 | Ga0268266_100408234 | 322 |
| 683 | 3300028380 | Ga0268265_10024411 | Ga0268265_100244114 | 322 |
| 684 | 3300028381 | Ga0268264_10002968 | Ga0268264_1000296814 | 322 |
| 685 | 3300028556 | Ga0265337_1000769 | Ga0265337_10007693 | 322 |
| 686 | 3300031247 | Ga0265340_10022433 | Ga0265340_100224332 | 322 |
| 687 | 3300031250 | Ga0265331_10017934 | Ga0265331_100179342 | 322 |
| 688 | 3300031344 | Ga0265316_10107017 | Ga0265316_101070172 | 322 |
| 689 | 3300031595 | Ga0265313_10049108 | Ga0265313_100491082 | 322 |
| 690 | 3300031595 | Ga0265313_10056004 | Ga0265313_100560042 | 322 |
| 691 | 3300031711 | Ga0265314_10098001 | Ga0265314_100980012 | 322 |
| 692 | 3300031712 | Ga0265342_10000282 | Ga0265342_1000028245 | 322 |
| 693 | 3300031712 | Ga0265342_10000896 | Ga0265342_1000089633 | 322 |
| 694 | 3300031712 | Ga0265342_10080137 | Ga0265342_100801372 | 322 |
| 695 | 3300034818 | Ga0373950_0002702 | Ga0373950_0002702_181_1149 | 322 |
| 696 | 3300034819 | Ga0373958_0000857 | Ga0373958_0000857_209_1177 | 322 |
| 697 | 3300034820 | Ga0373959_0003668 | Ga0373959_0003668_1406_2374 | 322 |
| 698 | 3300034957 | Ga0373938_0003291 | Ga0373938_0003291_1486_2454 | 322 |
| 699 | 3300035083 | Ga0373926_0002200 | Ga0373926_0002200_181_1149 | 322 |
| 700 | 3300035084 | Ga0373928_0003507 | Ga0373928_0003507_719_1687 | 322 |
| 701 | 3300035085 | Ga0373929_0008065 | Ga0373929_0008065_105_1073 | 322 |
| 702 | 3300035088 | Ga0373940_0003500 | Ga0373940_0003500_962_1930 | 322 |
| 703 | 3300035090 | Ga0373949_0001408 | Ga0373949_0001408_2981_3949 | 322 |
| 704 | 3300035091 | Ga0373951_0003300 | Ga0373951_0003300_1349_2317 | 322 |
| 705 | 3300035092 | Ga0373952_0001605 | Ga0373952_0001605_2225_3193 | 322 |
| 706 | 3300035092 | Ga0373952_0003186 | Ga0373952_0003186_1590_2558 | 322 |
| 707 | 3300035114 | Ga0373939_0001446 | Ga0373939_0001446_1469_2437 | 322 |
| 708 | 3300035114 | Ga0373939_0021303 | Ga0373939_0021303_540_1508 | 322 |
| 709 | 3300035117 | Ga0373953_0005709 | Ga0373953_0005709_1751_2719 | 322 |
| 710 | 3300035118 | Ga0373954_0002351 | Ga0373954_0002351_1895_2863 | 322 |
| 711 | 3300035119 | Ga0373956_0006571 | Ga0373956_0006571_2049_3017 | 322 |
| 712 | 3300035121 | Ga0373960_0001089 | Ga0373960_0001089_124_1092 | 322 |
| 713 | 3300035171 | Ga0373946_0005396 | Ga0373946_0005396_2051_3019 | 322 |
| 714 | 3300035171 | Ga0373946_0083690 | Ga0373946_0083690_136_1104 | 322 |
| 715 | 3300035172 | Ga0373955_0000424 | Ga0373955_0000424_3960_4928 | 322 |
| 716 | 3300035207 | Ga0373942_0010868 | Ga0373942_0010868_1025_1993 | 322 |
| 717 | 3300035241 | Ga0373961_0001706 | Ga0373961_0001706_1012_1980 | 322 |
| 718 | 3300035242 | Ga0373962_0006210 | Ga0373962_0006210_475_1443 | 322 |
| 719 | 3300035691 | Ga0373931_0001534 | Ga0373931_0001534_4998_5966 | 322 |
| 720 | 3300035692 | Ga0373935_0006416 | Ga0373935_0006416_3782_4750 | 322 |
| 721 | 3300035692 | Ga0373935_0053663 | Ga0373935_0053663_606_1574 | 322 |
| 722 | 3300035695 | Ga0373927_0013197 | Ga0373927_0013197_1694_2662 | 322 |
| 723 | 3300035724 | Ga0373933_0001949 | Ga0373933_0001949_3432_4400 | 322 |
| 724 | 3300035725 | Ga0373947_0001014 | Ga0373947_0001014_13373_14341 | 322 |
| 725 | 3300036401 | Ga0373937_0001798 | Ga0373937_0001798_751_1719 | 322 |
| 726 | 3300037068 | Ga0373925_0010893 | Ga0373925_0010893_3771_4739 | 322 |
| 727 | 3300039437 | Ga0436365_0088563 | Ga0436365_0088563_4461_5429 | 322 |
| 728 | 3300042008 | Ga0439450_010990 | Ga0439450_010990_574_1542 | 322 |
| 729 | 3300042439 | Ga0439464_0017190 | Ga0439464_0017190_126_1094 | 322 |
| 730 | 3300046454 | Ga0495592_0001873 | Ga0495592_0001873_7004_7972 | 322 |
| 731 | 3300046454 | Ga0495592_0005376 | Ga0495592_0005376_6266_7234 | 322 |
| 732 | 3300046455 | Ga0495603_0000847 | Ga0495603_0000847_2781_3749 | 322 |
| 733 | 3300046459 | Ga0495629_0002130 | Ga0495629_0002130_10086_11054 | 322 |
| 734 | 3300046462 | Ga0495651_0001256 | Ga0495651_0001256_8211_9179 | 322 |
| 735 | 3300046463 | Ga0495653_0001017 | Ga0495653_0001017_6792_7760 | 322 |
| 736 | 3300046473 | Ga0495582_0005835 | Ga0495582_0005835_439_1407 | 322 |
| 737 | 3300046475 | Ga0495639_0033182 | Ga0495639_0033182_101_1069 | 322 |
| 738 | 3300046476 | Ga0495662_0012227 | Ga0495662_0012227_2838_3806 | 322 |
| 739 | 3300046477 | Ga0495664_0009316 | Ga0495664_0009316_2386_3354 | 322 |
| 740 | 3300046477 | Ga0495664_0013950 | Ga0495664_0013950_1227_2195 | 322 |
| 741 | 3300046499 | Ga0495594_0010150 | Ga0495594_0010150_480_1448 | 322 |
| 742 | 3300046511 | Ga0495608_0000646 | Ga0495608_0000646_16062_17030 | 322 |
| 743 | 3300046514 | Ga0495618_0000819 | Ga0495618_0000819_13916_14884 | 322 |
| 744 | 3300046514 | Ga0495618_0001132 | Ga0495618_0001132_2831_3799 | 322 |
| 745 | 3300046517 | Ga0495630_0011250 | Ga0495630_0011250_1350_2318 | 322 |
| 746 | 3300046517 | Ga0495630_0231864 | Ga0495630_0231864_343_1311 | 322 |
| 747 | 3300046520 | Ga0495637_0043145 | Ga0495637_0043145_28_996 | 322 |
| 748 | 3300046526 | Ga0495666_0006222 | Ga0495666_0006222_2832_3800 | 322 |
| 749 | 3300046529 | Ga0495652_0011396 | Ga0495652_0011396_6321_7289 | 322 |
| 750 | 3300046531 | Ga0495665_0022103 | Ga0495665_0022103_2249_3217 | 322 |
| 751 | 3300046533 | Ga0495640_0017622 | Ga0495640_0017622_2783_3751 | 322 |
| 752 | 3300046533 | Ga0495640_0144951 | Ga0495640_0144951_25_993 | 322 |
| 753 | 3300046536 | Ga0495587_0000770 | Ga0495587_0000770_12874_13842 | 322 |
| 754 | 3300046543 | Ga0495645_0007688 | Ga0495645_0007688_2420_3388 | 322 |
| 755 | 3300046557 | Ga0495622_0059070 | Ga0495622_0059070_496_1464 | 322 |
| 756 | 3300046559 | Ga0495667_0009756 | Ga0495667_0009756_1922_2890 | 322 |
| 757 | 3300046642 | Ga0495634_0003907 | Ga0495634_0003907_3011_3979 | 322 |
| 758 | 3300046642 | Ga0495634_0041891 | Ga0495634_0041891_1183_2151 | 322 |
| 759 | 3300046663 | Ga0495635_0000812 | Ga0495635_0000812_16694_17662 | 322 |
| 760 | 3300046663 | Ga0495635_0076007 | Ga0495635_0076007_430_1398 | 322 |
| 761 | 3300046674 | Ga0495588_0008598 | Ga0495588_0008598_2780_3748 | 322 |
| 762 | 3300046675 | Ga0495657_0005959 | Ga0495657_0005959_808_1776 | 322 |
| 763 | 3300046678 | Ga0495599_0008486 | Ga0495599_0008486_3230_4198 | 322 |
| 764 | 3300046679 | Ga0495623_0001381 | Ga0495623_0001381_13172_14140 | 322 |
| 765 | 3300046681 | Ga0495647_0003781 | Ga0495647_0003781_2820_3788 | 322 |
| 766 | 3300046683 | Ga0495658_0012531 | Ga0495658_0012531_506_1474 | 322 |
| 767 | 3300046684 | Ga0495669_0050559 | Ga0495669_0050559_518_1486 | 322 |
| 768 | 3300046684 | Ga0495669_0053619 | Ga0495669_0053619_76_1047 | 322 |
| 769 | 3300046689 | Ga0495613_0045613 | Ga0495613_0045613_623_1591 | 322 |
| 770 | 3300046690 | Ga0495624_0025898 | Ga0495624_0025898_1497_2465 | 322 |
| 771 | 3300046809 | Ga0495600_0009057 | Ga0495600_0009057_2507_3475 | 322 |
| 772 | 3300047315 | Ga0495581_0013701 | Ga0495581_0013701_2821_3789 | 322 |
| 773 | 3300047317 | Ga0495604_0019293 | Ga0495604_0019293_2050_3018 | 322 |
| 774 | 3300047319 | Ga0495674_0003170 | Ga0495674_0003170_3709_4677 | 322 |
| 775 | 3300047319 | Ga0495674_0070558 | Ga0495674_0070558_406_1374 | 322 |
| 776 | 3300047321 | Ga0495676_0008104 | Ga0495676_0008104_4982_5950 | 322 |
| 777 | 3300047321 | Ga0495676_0148786 | Ga0495676_0148786_505_1473 | 322 |
| 778 | 3300047322 | Ga0495680_0006835 | Ga0495680_0006835_7694_8662 | 322 |
| 779 | 3300047322 | Ga0495680_0149845 | Ga0495680_0149845_567_1535 | 322 |
| 780 | 3300047444 | Ga0495675_0001036 | Ga0495675_0001036_13990_14958 | 322 |
| 781 | 3300047673 | Ga0495593_0084324 | Ga0495593_0084324_81_1049 | 322 |
| 782 | 3300048088 | Ga0495602_0001368 | Ga0495602_0001368_17050_18018 | 322 |
| 783 | 3300048903 | Ga0496100_0013020 | Ga0496100_0013020_3566_4534 | 322 |
| 784 | 3300048903 | Ga0496100_0013989 | Ga0496100_0013989_1801_2769 | 322 |
| 785 | 3300048904 | Ga0496101_0025517 | Ga0496101_0025517_85_1053 | 322 |
| 786 | 3300048905 | Ga0496102_0080615 | Ga0496102_0080615_508_1476 | 322 |
| 787 | 3300048905 | Ga0496102_0393579 | Ga0496102_0393579_113_1081 | 322 |
| 788 | 3300048907 | Ga0496104_0062099 | Ga0496104_0062099_1901_2869 | 322 |
| 789 | 3300048908 | Ga0496105_0102107 | Ga0496105_0102107_124_1092 | 322 |
| 790 | 3300048909 | Ga0496106_0011982 | Ga0496106_0011982_783_1751 | 322 |
| 791 | 3300048911 | Ga0496108_0008415 | Ga0496108_0008415_4264_5232 | 322 |
| 792 | 3300048912 | Ga0496109_0000488 | Ga0496109_0000488_31558_32526 | 322 |
| 793 | 3300048912 | Ga0496109_0114624 | Ga0496109_0114624_1075_2043 | 322 |
| 794 | 3300048912 | Ga0496109_0176780 | Ga0496109_0176780_711_1679 | 322 |
| 795 | 3300048913 | Ga0496110_0011628 | Ga0496110_0011628_3892_4860 | 322 |
| 796 | 3300048913 | Ga0496110_0049042 | Ga0496110_0049042_1387_2355 | 322 |
| 797 | 3300048914 | Ga0496111_0057088 | Ga0496111_0057088_880_1848 | 322 |
| 798 | 3300048915 | Ga0496112_0137244 | Ga0496112_0137244_389_1357 | 322 |
| 799 | 3300048915 | Ga0496112_0351932 | Ga0496112_0351932_403_1371 | 322 |
| 800 | 3300048916 | Ga0496113_0022983 | Ga0496113_0022983_1319_2287 | 322 |
| 801 | 3300048916 | Ga0496113_0211452 | Ga0496113_0211452_382_1350 | 322 |
| 802 | 3300048917 | Ga0496114_0012742 | Ga0496114_0012742_5593_6561 | 322 |
| 803 | 3300048918 | Ga0496115_0015693 | Ga0496115_0015693_3082_4050 | 322 |
| 804 | 3300048918 | Ga0496115_0019198 | Ga0496115_0019198_2709_3677 | 322 |
| 805 | 3300049569 | Ga0501032_0000129 | Ga0501032_0000129_47447_48418 | 322 |
| 806 | 3300049570 | Ga0501033_0001179 | Ga0501033_0001179_16792_17763 | 322 |
| 807 | 3300049571 | Ga0501034_0000503 | Ga0501034_0000503_22418_23389 | 322 |
| 808 | 3300049571 | Ga0501034_0436204 | Ga0501034_0436204_126_1094 | 322 |
| 809 | 3300049572 | Ga0501036_0001453 | Ga0501036_0001453_14574_15545 | 322 |
| 810 | 3300049573 | Ga0501037_0000106 | Ga0501037_0000106_64106_65077 | 322 |
| 811 | 3300049574 | Ga0501038_0001655 | Ga0501038_0001655_14510_15481 | 322 |
| 812 | 3300049575 | Ga0501039_0000416 | Ga0501039_0000416_15516_16487 | 322 |
| 813 | 3300049578 | Ga0501042_0016537 | Ga0501042_0016537_1708_2679 | 322 |
| 814 | 3300049579 | Ga0501043_0019247 | Ga0501043_0019247_1247_2218 | 322 |
| 815 | 3300049580 | Ga0501046_0000235 | Ga0501046_0000235_34806_35777 | 322 |
| 816 | 3300049581 | Ga0501047_0000844 | Ga0501047_0000844_14404_15375 | 322 |
| 817 | 3300049582 | Ga0501048_0001444 | Ga0501048_0001444_2829_3800 | 322 |
| 818 | 3300049583 | Ga0501067_0000160 | Ga0501067_0000160_26454_27425 | 322 |
| 819 | 3300049584 | Ga0501068_0000014 | Ga0501068_0000014_7674_8645 | 322 |
| 820 | 3300049585 | Ga0501069_0004593 | Ga0501069_0004593_3790_4761 | 322 |
| 821 | 3300049586 | Ga0501070_0034852 | Ga0501070_0034852_252_1223 | 322 |
| 822 | 3300049586 | Ga0501070_0123779 | Ga0501070_0123779_978_1946 | 322 |
| 823 | 3300049588 | Ga0501072_0001159 | Ga0501072_0001159_2317_3288 | 322 |
| 824 | 3300049588 | Ga0501072_0022832 | Ga0501072_0022832_892_1860 | 322 |
| 825 | 3300049589 | Ga0501073_0000417 | Ga0501073_0000417_752_1723 | 322 |
| 826 | 3300049590 | Ga0501074_0001839 | Ga0501074_0001839_619_1590 | 322 |
| 827 | 3300049741 | Ga0501079_0000261 | Ga0501079_0000261_4029_5000 | 322 |
| 828 | 3300049742 | Ga0501080_0000917 | Ga0501080_0000917_10852_11823 | 322 |
| 829 | 3300049742 | Ga0501080_0177694 | Ga0501080_0177694_387_1355 | 322 |
| 830 | 3300049744 | Ga0501083_0000301 | Ga0501083_0000301_26343_27314 | 322 |
| 831 | 3300049822 | Ga0501035_0000324 | Ga0501035_0000324_31909_32880 | 322 |
| 832 | 3300049823 | Ga0501044_0000051 | Ga0501044_0000051_128204_129175 | 322 |
| 833 | 3300049823 | Ga0501044_0000084 | Ga0501044_0000084_49347_50330 | 322 |
| 834 | 3300049823 | Ga0501044_0103933 | Ga0501044_0103933_1038_2006 | 322 |
| 835 | 3300050494 | nmdc:mga06z11_6052_c1 | nmdc:mga06z11_6052_c1_1693_2661 | 322 |
| 836 | 3300050496 | nmdc:mga07m45_60952_c1 | nmdc:mga07m45_60952_c1_692_1660 | 322 |
| 837 | 3300050507 | nmdc:mga05p37_2742_c1 | nmdc:mga05p37_2742_c1_17760_18728 | 322 |
| 838 | 3300050507 | nmdc:mga05p37_505_c1 | nmdc:mga05p37_505_c1_39066_40037 | 322 |
| 839 | 3300050508 | nmdc:mga09592_772_c1 | nmdc:mga09592_772_c1_977_1948 | 322 |
| 840 | 3300050509 | nmdc:mga0qj67_165_c1 | nmdc:mga0qj67_165_c1_29451_30422 | 322 |
| 841 | 3300050510 | nmdc:mga06r32_513_c1 | nmdc:mga06r32_513_c1_29378_30349 | 322 |
| 842 | 3300050511 | nmdc:mga08y16_2844_c1 | nmdc:mga08y16_2844_c1_3062_4033 | 322 |
| 843 | 3300050511 | nmdc:mga08y16_35524_c1 | nmdc:mga08y16_35524_c1_1878_2846 | 322 |
| 844 | 3300050512 | nmdc:mga0n895_20210_c1 | nmdc:mga0n895_20210_c1_5091_6059 | 322 |
| 845 | 3300050512 | nmdc:mga0n895_3322_c1 | nmdc:mga0n895_3322_c1_6626_7597 | 322 |
| 846 | 3300050513 | nmdc:mga0rr50_1278_c1 | nmdc:mga0rr50_1278_c1_7209_8180 | 322 |
| 847 | 3300050515 | nmdc:mga0a205_1632_c1 | nmdc:mga0a205_1632_c1_8269_9240 | 322 |
| 848 | 3300050515 | nmdc:mga0a205_26496_c1 | nmdc:mga0a205_26496_c1_683_1651 | 322 |
| 849 | 3300050515 | nmdc:mga0a205_6515_c2 | nmdc:mga0a205_6515_c2_8352_9320 | 322 |
| 850 | 3300053077 | Ga0495601_0004638 | Ga0495601_0004638_5111_6079 | 322 |
| 851 | 3300053077 | Ga0495601_0007149 | Ga0495601_0007149_3805_4773 | 322 |
| 852 | 3300053078 | Ga0495612_0012825 | Ga0495612_0012825_533_1501 | 322 |
| 853 | 3300053078 | Ga0495612_0019874 | Ga0495612_0019874_1700_2668 | 322 |
| 854 | 3300053084 | Ga0495595_0000253 | Ga0495595_0000253_1922_2890 | 322 |
| 855 | 3300053084 | Ga0495595_0154729 | Ga0495595_0154729_14_982 | 322 |
| 856 | 3300053085 | Ga0495619_0027382 | Ga0495619_0027382_876_1844 | 322 |
| 857 | 3300053085 | Ga0495619_0144309 | Ga0495619_0144309_460_1428 | 322 |
| 858 | 3300053085 | Ga0495619_0148649 | Ga0495619_0148649_115_1083 | 322 |
| 859 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_710051_711031 | 322 |
| 860 | 3300053153 | Ga0500616_0047881 | Ga0500616_0047881_412_1440 | 322 |
| 861 | 3300054114 | Ga0501084_0014689 | Ga0501084_0014689_1964_2935 | 322 |
| 862 | 3300060353 | Ga0501082_0018584 | Ga0501082_0018584_2790_3761 | 322 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5377 | 22 | 306 |
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.5276 | 37 | 304 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5157 | 22 | 306 |
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.4996 | 15 | 281 |
| 4g1u-assembly1.cif.gz_B | x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis | 0.4905 | 17 | 303 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58666_4_320_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8366 | 40 | 307 | 1.10.3470.10 |
| af_P23200_41_325_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7935 | 42 | 302 | 1.10.3470.10 |
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7929 | 38 | 302 | 1.10.3470.10 |
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7874 | 38 | 302 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7852 | 38 | 302 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522JLP9-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9945 | 21 | 259 |
GO:0005886
GO:0015658 |
| AF-A0A519ZAF0-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9931 | 20 | 249 |
GO:0005886
GO:0015658 |
| AF-A0A3D3SVL4-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9918 | 45 | 259 |
GO:0005886
GO:0015658 |
| AF-A0A1F4HPC3-F1-model_v4 | deleted | 0.9906 | 17 | 262 |
|
| AF-A0A530R883-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9903 | 18 | 281 |
GO:0005886
GO:0015658 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar