F483909

General Info

Members Datasets Scaffolds Average Seq Length
863 334 1726 408

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100171187|Ga0070698_1001711871
Length 426
Sequence MPEAVIARKGQDPAVPPAAAEKNVAAAKGAGEETSLITGSEAIAVACKLADVDVITAYPIRPYDTVMQYVAKLVSNGELDCEYIVAESEHSQFEIVKHASAVGARVFCGSSGVGWMYAFEALTVTPALRIPMVAMVGNRALDDPGAFGVEHNDALAVRDLGWQLIWVDNAQEALDTALIAYRVAEDRRVFLPCAISCDGAFLTHSQALVKIPSAEKVKAFLPPYDRGDLQLHPDNPITVAPQVNEDWLMEIRRQNAAAMDRSSTVIREAYADFERIFGRHYGNPFFEEYQTDDADVVLVGMGTLSNPVRVAIRQMRQEGKKVGFVRLRWFRPFAAEELAATLGRFRAVGVIDRDFSLGSPYRSGVLATEVRAAMYPAAKRPPVLGFICGLGGREVTVPGVRKMTESVYLAAEGKTQPGTQWIGLRE

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
217 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
220 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
222 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
230 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
236 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
244 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
255 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
256 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
257 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 1.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100171187 3300005471 Bacteria 2113
2 JGI24737J22298_10020201 3300001990 Unclassified 2128
3 JGI24750J21931_1003244 3300002070 Unclassified 1952
4 JGI24748J21848_1001738 3300002074 Unclassified 2419
5 JGI24749J21850_1000495 3300002076 Bacteria 5821
6 JGI24744J21845_10002809 3300002077 Unclassified 3561
7 JGI24033J26618_1002888 3300002155 Unclassified 1786
8 JGI24751J29686_10007042 3300002459 Unclassified 2297
9 JGI25406J46586_10036499 3300003203 Unclassified 1782
10 JGI25404J52841_10010084 3300003659 Unclassified 2028
11 Ga0058861_10081639 3300004800 Bacteria 6805
12 Ga0058862_10109908 3300004803 Bacteria 3178
13 Ga0065712_10073237 3300005290 Bacteria 4457
14 Ga0065715_10000289 3300005293 Bacteria 20354
15 Ga0065707_10017786 3300005295 Bacteria 2275
16 Ga0070658_10000964 3300005327 Bacteria 24657
17 Ga0070676_10000731 3300005328 Bacteria 16092
18 Ga0070676_10033611 3300005328 Bacteria 2942
19 Ga0070676_10079558 3300005328 Bacteria 1985
20 Ga0070683_100053570 3300005329 Bacteria 3738
21 Ga0070683_100108108 3300005329 Bacteria 2623
22 Ga0070690_100000211 3300005330 Bacteria 30323
23 Ga0070670_100001759 3300005331 Bacteria 17629
24 Ga0070670_100006195 3300005331 Bacteria 10113
25 Ga0070677_10000191 3300005333 Bacteria 21097
26 Ga0068869_100000011 3300005334 Bacteria 75554
27 Ga0068869_100001917 3300005334 Bacteria 12480
28 Ga0070666_10000076 3300005335 Bacteria 70960
29 Ga0070680_100000065 3300005336 Bacteria 55815
30 Ga0070680_100000772 3300005336 Bacteria 22451
31 Ga0070682_100000164 3300005337 Bacteria 50996
32 Ga0068868_100062947 3300005338 Bacteria 2942
33 Ga0070660_100001094 3300005339 Bacteria 18206
34 Ga0070660_100003516 3300005339 Bacteria 10798
35 Ga0070689_100000105 3300005340 Bacteria 48734
36 Ga0070689_100065843 3300005340 Bacteria 2823
37 Ga0070691_10008442 3300005341 Bacteria 4713
38 Ga0070687_100000008 3300005343 Bacteria 60285
39 Ga0070687_100144769 3300005343 Bacteria 1388
40 Ga0070661_100000737 3300005344 Bacteria 23845
41 Ga0070661_100007975 3300005344 Bacteria 7310
42 Ga0070692_10000182 3300005345 Bacteria 16506
43 Ga0070692_10001891 3300005345 Bacteria 7895
44 Ga0070692_10016651 3300005345 Bacteria 3499
45 Ga0070692_10104486 3300005345 Bacteria 1557
46 Ga0070668_100004566 3300005347 Bacteria 10269
47 Ga0070669_100000435 3300005353 Bacteria 31853
48 Ga0070669_100148378 3300005353 Bacteria 1813
49 Ga0070675_100001324 3300005354 Bacteria 18106
50 Ga0070671_100008710 3300005355 Bacteria 8139
51 Ga0070674_100000404 3300005356 Bacteria 21701
52 Ga0070673_100007851 3300005364 Bacteria 7067
53 Ga0070673_100067465 3300005364 Bacteria 2861
54 Ga0070673_100229566 3300005364 Bacteria 1610
55 Ga0070688_100000094 3300005365 Bacteria 45129
56 Ga0070659_100000063 3300005366 Bacteria 84883
57 Ga0070659_100000169 3300005366 Bacteria 50438
58 Ga0070667_100000734 3300005367 Bacteria 31411
59 Ga0070703_10002078 3300005406 Bacteria 5832
60 Ga0070703_10007622 3300005406 Bacteria 3040
61 Ga0070714_100027218 3300005435 Bacteria 4732
62 Ga0070710_10063565 3300005437 Bacteria 2109
63 Ga0070701_10028732 3300005438 Bacteria 2735
64 Ga0070701_10074815 3300005438 Bacteria 1820
65 Ga0070711_100117627 3300005439 Bacteria 1961
66 Ga0070705_100001337 3300005440 Bacteria 13147
67 Ga0070705_100036621 3300005440 Bacteria 2761
68 Ga0070705_100040271 3300005440 Bacteria 2656
69 Ga0070705_100047355 3300005440 Bacteria 2485
70 Ga0070705_100070853 3300005440 Unclassified 2106
71 Ga0070705_100142191 3300005440 Bacteria 1581
72 Ga0070700_100012042 3300005441 Bacteria 4808
73 Ga0070694_100007786 3300005444 Bacteria 6537
74 Ga0070694_100014375 3300005444 Bacteria 4954
75 Ga0070694_100031029 3300005444 Bacteria 3502
76 Ga0070708_100001883 3300005445 Bacteria 16097
77 Ga0070708_100002729 3300005445 Bacteria 13706
78 Ga0070708_100008999 3300005445 Bacteria 8046
79 Ga0070708_100010509 3300005445 Bacteria 7504
80 Ga0070708_100013536 3300005445 Bacteria 6684
81 Ga0070708_100020341 3300005445 Bacteria 5595
82 Ga0070708_100024297 3300005445 Bacteria 5167
83 Ga0070708_100038442 3300005445 Bacteria 4180
84 Ga0070708_100053936 3300005445 Bacteria 3569
85 Ga0070708_100054281 3300005445 Bacteria 3558
86 Ga0070708_100080303 3300005445 Bacteria 2951
87 Ga0070663_100000445 3300005455 Bacteria 21833
88 Ga0070663_100002736 3300005455 Bacteria 9988
89 Ga0070678_100000456 3300005456 Bacteria 19484
90 Ga0070662_100000048 3300005457 Bacteria 65776
91 Ga0070662_100003120 3300005457 Bacteria 10292
92 Ga0070681_10001190 3300005458 Bacteria 22546
93 Ga0070681_10036763 3300005458 Bacteria 4917
94 Ga0068867_100000038 3300005459 Bacteria 80419
95 Ga0068867_100052140 3300005459 Bacteria 3018
96 Ga0070685_10000676 3300005466 Bacteria 18496
97 Ga0070706_100000078 3300005467 Bacteria 112530
98 Ga0070706_100000641 3300005467 Bacteria 40007
99 Ga0070706_100000718 3300005467 Bacteria 37282
100 Ga0070706_100007366 3300005467 Bacteria 10322
101 Ga0070706_100008544 3300005467 Bacteria 9543
102 Ga0070706_100032033 3300005467 Bacteria 4848
103 Ga0070706_100037319 3300005467 Bacteria 4488
104 Ga0070706_100056263 3300005467 Bacteria 3630
105 Ga0070706_100138406 3300005467 Bacteria 2272
106 Ga0070706_100215482 3300005467 Bacteria 1792
107 Ga0070706_100231666 3300005467 Bacteria 1724
108 Ga0070706_100277891 3300005467 Bacteria 1563
109 Ga0070707_100000453 3300005468 Bacteria 40597
110 Ga0070707_100001162 3300005468 Bacteria 25888
111 Ga0070707_100001982 3300005468 Bacteria 19597
112 Ga0070707_100002945 3300005468 Bacteria 16161
113 Ga0070707_100004099 3300005468 Bacteria 13683
114 Ga0070707_100006736 3300005468 Bacteria 10647
115 Ga0070707_100014753 3300005468 Bacteria 7324
116 Ga0070707_100014829 3300005468 Bacteria 7306
117 Ga0070707_100027703 3300005468 Bacteria 5390
118 Ga0070707_100027844 3300005468 Bacteria 5376
119 Ga0070707_100049759 3300005468 Bacteria 4017
120 Ga0070707_100059514 3300005468 Bacteria 3664
121 Ga0070707_100097857 3300005468 Bacteria 2842
122 Ga0070707_100127081 3300005468 Bacteria 2477
123 Ga0070707_100216945 3300005468 Bacteria 1864
124 Ga0070707_100243206 3300005468 Bacteria 1751
125 Ga0070698_100000439 3300005471 Bacteria 44124
126 Ga0070698_100003677 3300005471 Bacteria 16841
127 Ga0070698_100004713 3300005471 Bacteria 14979
128 Ga0070698_100009924 3300005471 Bacteria 10179
129 Ga0070698_100012354 3300005471 Bacteria 9042
130 Ga0070698_100019333 3300005471 Bacteria 7154
131 Ga0070698_100025289 3300005471 Bacteria 6187
132 Ga0070698_100039844 3300005471 Bacteria 4832
133 Ga0070698_100063006 3300005471 Bacteria 3739
134 Ga0070698_100079927 3300005471 Bacteria 3265
135 Ga0070698_100109380 3300005471 Bacteria 2730
136 Ga0070699_100001432 3300005518 Bacteria 21904
137 Ga0070699_100030325 3300005518 Bacteria 4668
138 Ga0070699_100033726 3300005518 Bacteria 4424
139 Ga0070699_100033841 3300005518 Bacteria 4415
140 Ga0070699_100034937 3300005518 Bacteria 4344
141 Ga0070699_100036802 3300005518 Bacteria 4234
142 Ga0070699_100050740 3300005518 Bacteria 3592
143 Ga0070699_100111660 3300005518 Bacteria 2400
144 Ga0070699_100128568 3300005518 Bacteria 2232
145 Ga0070699_100161721 3300005518 Bacteria 1981
146 Ga0070699_100165354 3300005518 Bacteria 1959
147 Ga0070699_100234216 3300005518 Bacteria 1638
148 Ga0070699_100263195 3300005518 Bacteria 1542
149 Ga0070679_100035651 3300005530 Bacteria 4936
150 Ga0070679_100056568 3300005530 Bacteria 3908
151 Ga0070684_100030452 3300005535 Bacteria 4585
152 Ga0070684_100068974 3300005535 Bacteria 3109
153 Ga0070697_100005470 3300005536 Bacteria 9791
154 Ga0070697_100006857 3300005536 Bacteria 8846
155 Ga0070697_100007011 3300005536 Bacteria 8760
156 Ga0070697_100030006 3300005536 Bacteria 4365
157 Ga0070697_100039384 3300005536 Bacteria 3821
158 Ga0070697_100068009 3300005536 Bacteria 2915
159 Ga0070697_100101084 3300005536 Bacteria 2395
160 Ga0070697_100133142 3300005536 Bacteria 2086
161 Ga0070697_100160853 3300005536 Bacteria 1897
162 Ga0068853_100000668 3300005539 Bacteria 23614
163 Ga0068853_100011928 3300005539 Bacteria 7067
164 Ga0068853_100176768 3300005539 Bacteria 1934
165 Ga0070672_100000114 3300005543 Bacteria 40780
166 Ga0070686_100000680 3300005544 Bacteria 19738
167 Ga0070695_100002565 3300005545 Bacteria 10485
168 Ga0070695_100007818 3300005545 Bacteria 6336
169 Ga0070695_100018830 3300005545 Bacteria 4196
170 Ga0070696_100012609 3300005546 Bacteria 5675
171 Ga0070696_100018237 3300005546 Bacteria 4741
172 Ga0070696_100099409 3300005546 Bacteria 2082
173 Ga0070696_100159425 3300005546 Bacteria 1661
174 Ga0070693_100000018 3300005547 Bacteria 62344
175 Ga0070693_100051464 3300005547 Bacteria 2359
176 Ga0070665_100097635 3300005548 Bacteria 2942
177 Ga0070704_100000298 3300005549 Bacteria 21923
178 Ga0070704_100003920 3300005549 Bacteria 8565
179 Ga0070704_100008478 3300005549 Bacteria 6167
180 Ga0070704_100039493 3300005549 Unclassified 3241
181 Ga0070704_100141632 3300005549 Unclassified 1878
182 Ga0070704_100164593 3300005549 Bacteria 1757
183 Ga0068855_100000523 3300005563 Bacteria 47127
184 Ga0070664_100000271 3300005564 Bacteria 37262
185 Ga0070664_100006179 3300005564 Bacteria 9682
186 Ga0068857_100005552 3300005577 Bacteria 10762
187 Ga0068854_100000169 3300005578 Bacteria 44380
188 Ga0068854_100025527 3300005578 Bacteria 4056
189 Ga0068856_100001345 3300005614 Bacteria 25827
190 Ga0068856_100001772 3300005614 Bacteria 22541
191 Ga0070702_100058953 3300005615 Bacteria 2226
192 Ga0068852_100000055 3300005616 Bacteria 76508
193 Ga0068852_100277381 3300005616 Bacteria 1615
194 Ga0068859_100001246 3300005617 Bacteria 25988
195 Ga0068859_100002625 3300005617 Bacteria 18291
196 Ga0068864_100000134 3300005618 Bacteria 71870
197 Ga0068864_100038169 3300005618 Bacteria 4100
198 Ga0068864_100122877 3300005618 Bacteria 2323
199 Ga0068866_10000012 3300005718 Bacteria 82152
200 Ga0068861_100000601 3300005719 Bacteria 21292
201 Ga0068851_10000406 3300005834 Bacteria 19451
202 Ga0068870_10000201 3300005840 Bacteria 21415
203 Ga0068863_100000581 3300005841 Bacteria 37234
204 Ga0068863_100060536 3300005841 Bacteria 3581
205 Ga0068858_100002645 3300005842 Bacteria 18036
206 Ga0068860_100000893 3300005843 Bacteria 33121
207 Ga0068860_100099563 3300005843 Bacteria 2772
208 Ga0068862_100000172 3300005844 Bacteria 72127
209 Ga0068862_100004185 3300005844 Bacteria 12223
210 Ga0068862_100031599 3300005844 Bacteria 4471
211 Ga0068862_100159791 3300005844 Bacteria 2011
212 Ga0068862_100284280 3300005844 Bacteria 1517
213 Ga0081455_10000499 3300005937 Bacteria 51066
214 Ga0081455_10024936 3300005937 Bacteria 5527
215 Ga0081455_10245567 3300005937 Unclassified 1313
216 Ga0081538_10002834 3300005981 Bacteria 16585
217 Ga0081538_10007052 3300005981 Bacteria 9775
218 Ga0081538_10053293 3300005981 Bacteria 2406
219 Ga0081540_1000029 3300005983 Bacteria 150173
220 Ga0081540_1001072 3300005983 Bacteria 24287
221 Ga0081540_1025826 3300005983 Bacteria 3369
222 Ga0081539_10000092 3300005985 Bacteria 208968
223 Ga0070717_10002168 3300006028 Bacteria 13762
224 Ga0070717_10030696 3300006028 Bacteria 4317
225 Ga0070716_100147353 3300006173 Bacteria 1509
226 Ga0070712_100087917 3300006175 Bacteria 2269
227 Ga0097621_100002506 3300006237 Bacteria 12579
228 Ga0097621_100090087 3300006237 Bacteria 2566
229 Ga0068871_100143949 3300006358 Bacteria 2028
230 Ga0075428_100000436 3300006844 Bacteria 41529
231 Ga0075428_100018983 3300006844 Bacteria 7604
232 Ga0075428_100075256 3300006844 Unclassified 3687
233 Ga0075428_100114097 3300006844 Bacteria 2944
234 Ga0075428_100122324 3300006844 Bacteria 2833
235 Ga0075430_100000002 3300006846 Bacteria 150510
236 Ga0075430_100004567 3300006846 Bacteria 11652
237 Ga0075430_100039977 3300006846 Bacteria 3970
238 Ga0075430_100184973 3300006846 Bacteria 1732
239 Ga0075431_100001143 3300006847 Bacteria 23854
240 Ga0075431_100004273 3300006847 Bacteria 13990
241 Ga0075431_100005337 3300006847 Bacteria 12678
242 Ga0075431_100006431 3300006847 Bacteria 11663
243 Ga0075431_100013306 3300006847 Bacteria 8315
244 Ga0075431_100064149 3300006847 Bacteria 3792
245 Ga0075431_100113332 3300006847 Bacteria 2799
246 Ga0075431_100123696 3300006847 Bacteria 2669
247 Ga0075431_100173833 3300006847 Bacteria 2213
248 Ga0075431_100176041 3300006847 Bacteria 2197
249 Ga0075431_100291632 3300006847 Bacteria 1650
250 Ga0075433_10006010 3300006852 Bacteria 9564
251 Ga0075433_10013030 3300006852 Bacteria 6742
252 Ga0075433_10061827 3300006852 Bacteria 3280
253 Ga0075433_10085273 3300006852 Bacteria 2788
254 Ga0075433_10110002 3300006852 Unclassified 2444
255 Ga0075433_10181016 3300006852 Bacteria 1875
256 Ga0075433_10210710 3300006852 Bacteria 1727
257 Ga0075434_100002356 3300006871 Bacteria 16547
258 Ga0075434_100009161 3300006871 Bacteria 9221
259 Ga0075434_100027738 3300006871 Bacteria 5560
260 Ga0075434_100046909 3300006871 Bacteria 4287
261 Ga0075434_100326276 3300006871 Bacteria 1555
262 Ga0075429_100000460 3300006880 Bacteria 30370
263 Ga0075429_100001996 3300006880 Bacteria 16953
264 Ga0075429_100065959 3300006880 Bacteria 3151
265 Ga0075429_100067702 3300006880 Bacteria 3107
266 Ga0075429_100083769 3300006880 Bacteria 2779
267 Ga0068865_100000201 3300006881 Bacteria 33183
268 Ga0075436_100001438 3300006914 Bacteria 16202
269 Ga0075436_100048236 3300006914 Bacteria 2938
270 Ga0075436_100079090 3300006914 Bacteria 2278
271 Ga0075436_100132019 3300006914 Bacteria 1752
272 Ga0097620_100001246 3300006931 Bacteria 25988
273 Ga0097620_100002625 3300006931 Bacteria 18291
274 Ga0075435_100003478 3300007076 Bacteria 10682
275 Ga0075435_100051018 3300007076 Bacteria 3331
276 Ga0075435_100053393 3300007076 Bacteria 3259
277 Ga0099794_10000012 3300007265 Bacteria 84649
278 Ga0099794_10003423 3300007265 Bacteria 6051
279 Ga0099794_10040861 3300007265 Bacteria 2207
280 Ga0099794_10049709 3300007265 Bacteria 2016
281 Ga0099794_10049716 3300007265 Bacteria 2016
282 Ga0099794_10057754 3300007265 Bacteria 1880
283 Ga0099794_10079975 3300007265 Bacteria 1611
284 Ga0105250_10027533 3300009092 Bacteria 2291
285 Ga0105240_10012250 3300009093 Bacteria 11847
286 Ga0111539_10000557 3300009094 Bacteria 47767
287 Ga0111539_10014763 3300009094 Bacteria 9743
288 Ga0111539_10123524 3300009094 Bacteria 3034
289 Ga0111539_10295650 3300009094 Bacteria 1884
290 Ga0105245_10000441 3300009098 Bacteria 38149
291 Ga0105247_10001336 3300009101 Bacteria 17996
292 Ga0114129_10001149 3300009147 Bacteria 35039
293 Ga0114129_10001410 3300009147 Bacteria 32384
294 Ga0114129_10002948 3300009147 Bacteria 23803
295 Ga0114129_10004296 3300009147 Bacteria 20137
296 Ga0114129_10009108 3300009147 Bacteria 14149
297 Ga0114129_10010580 3300009147 Bacteria 13152
298 Ga0114129_10018918 3300009147 Bacteria 9814
299 Ga0114129_10022145 3300009147 Bacteria 9020
300 Ga0114129_10022405 3300009147 Bacteria 8969
301 Ga0114129_10027955 3300009147 Bacteria 7986
302 Ga0114129_10061413 3300009147 Bacteria 5251
303 Ga0114129_10070979 3300009147 Bacteria 4856
304 Ga0114129_10075187 3300009147 Bacteria 4704
305 Ga0114129_10076005 3300009147 Bacteria 4676
306 Ga0114129_10099597 3300009147 Bacteria 4023
307 Ga0114129_10330173 3300009147 Bacteria 2025
308 Ga0114129_10535317 3300009147 Unclassified 1525
309 Ga0105243_10126588 3300009148 Bacteria 2162
310 Ga0105241_10004015 3300009174 Bacteria 10884
311 Ga0105241_10004089 3300009174 Bacteria 10781
312 Ga0105242_10003647 3300009176 Bacteria 11985
313 Ga0105242_10011665 3300009176 Bacteria 6761
314 Ga0105248_10001691 3300009177 Bacteria 24563
315 Ga0105248_10384653 3300009177 Bacteria 1580
316 Ga0105237_10000991 3300009545 Bacteria 38178
317 Ga0105238_10001094 3300009551 Bacteria 27380
318 Ga0105249_10000163 3300009553 Bacteria 79859
319 Ga0105239_10003746 3300010375 Bacteria 18510
320 Ga0105246_10001081 3300011119 Bacteria 15757
321 Ga0157373_10004197 3300013100 Bacteria 10865
322 Ga0157373_10146492 3300013100 Bacteria 1661
323 Ga0157373_10196002 3300013100 Bacteria 1424
324 Ga0157371_10000464 3300013102 Bacteria 49652
325 Ga0157371_10026739 3300013102 Bacteria 4191
326 Ga0157369_10000305 3300013105 Bacteria 65880
327 Ga0157374_10000048 3300013296 Bacteria 136734
328 Ga0157378_10003844 3300013297 Bacteria 13288
329 Ga0157378_10149918 3300013297 Bacteria 2172
330 Ga0163162_10000105 3300013306 Bacteria 75516
331 Ga0157372_10000760 3300013307 Bacteria 34965
332 Ga0157372_10000846 3300013307 Bacteria 33218
333 Ga0157372_10015202 3300013307 Bacteria 8243
334 Ga0157375_10001406 3300013308 Bacteria 20746
335 Ga0157375_10490825 3300013308 Unclassified 1393
336 Ga0163163_10003872 3300014325 Bacteria 12750
337 Ga0163163_10032327 3300014325 Bacteria 5053
338 Ga0163163_10376715 3300014325 Bacteria 1477
339 Ga0157377_10000267 3300014745 Bacteria 25479
340 Ga0157379_10000037 3300014968 Bacteria 81320
341 Ga0157376_10001032 3300014969 Bacteria 18221
342 Ga0206356_11367602 3300020070 Bacteria 4126
343 Ga0213876_10028216 3300021384 Bacteria 2958
344 Ga0207697_10000034 3300025315 Bacteria 50188
345 Ga0207656_10000276 3300025321 Bacteria 17736
346 Ga0207653_10000189 3300025885 Bacteria 42321
347 Ga0207653_10000554 3300025885 Bacteria 13697
348 Ga0207682_10000057 3300025893 Bacteria 48247
349 Ga0207688_10000032 3300025901 Bacteria 46977
350 Ga0207688_10002237 3300025901 Bacteria 10431
351 Ga0207680_10000859 3300025903 Bacteria 14328
352 Ga0207647_10001367 3300025904 Bacteria 18742
353 Ga0207699_10037360 3300025906 Bacteria 2775
354 Ga0207699_10099526 3300025906 Bacteria 1842
355 Ga0207645_10000057 3300025907 Bacteria 80731
356 Ga0207645_10000340 3300025907 Bacteria 39096
357 Ga0207643_10000045 3300025908 Bacteria 81242
358 Ga0207643_10000105 3300025908 Bacteria 57132
359 Ga0207643_10011571 3300025908 Bacteria 4764
360 Ga0207705_10126317 3300025909 Bacteria 1901
361 Ga0207684_10000009 3300025910 Bacteria 572126
362 Ga0207684_10000094 3300025910 Bacteria 165810
363 Ga0207684_10000157 3300025910 Bacteria 115860
364 Ga0207684_10000242 3300025910 Bacteria 81735
365 Ga0207684_10000716 3300025910 Bacteria 39003
366 Ga0207684_10002560 3300025910 Bacteria 18242
367 Ga0207684_10010076 3300025910 Bacteria 8325
368 Ga0207684_10010346 3300025910 Bacteria 8211
369 Ga0207684_10017290 3300025910 Bacteria 6185
370 Ga0207684_10035076 3300025910 Bacteria 4260
371 Ga0207684_10042663 3300025910 Bacteria 3846
372 Ga0207684_10071480 3300025910 Bacteria 2948
373 Ga0207684_10091672 3300025910 Bacteria 2590
374 Ga0207684_10122084 3300025910 Bacteria 2233
375 Ga0207684_10158185 3300025910 Bacteria 1950
376 Ga0207684_10183877 3300025910 Bacteria 1802
377 Ga0207684_10230042 3300025910 Bacteria 1600
378 Ga0207654_10003239 3300025911 Bacteria 8218
379 Ga0207707_10000034 3300025912 Bacteria 152677
380 Ga0207695_10012609 3300025913 Bacteria 10128
381 Ga0207671_10001647 3300025914 Bacteria 25418
382 Ga0207693_10051089 3300025915 Bacteria 3246
383 Ga0207693_10148826 3300025915 Bacteria 1841
384 Ga0207660_10000276 3300025917 Bacteria 33906
385 Ga0207660_10001693 3300025917 Bacteria 14785
386 Ga0207660_10009710 3300025917 Bacteria 6228
387 Ga0207662_10000036 3300025918 Bacteria 59484
388 Ga0207657_10000066 3300025919 Bacteria 98663
389 Ga0207657_10000108 3300025919 Bacteria 80540
390 Ga0207649_10001774 3300025920 Bacteria 12339
391 Ga0207649_10002859 3300025920 Bacteria 9526
392 Ga0207652_10000245 3300025921 Bacteria 56703
393 Ga0207652_10051237 3300025921 Bacteria 3539
394 Ga0207646_10000020 3300025922 Bacteria 272909
395 Ga0207646_10000574 3300025922 Bacteria 48122
396 Ga0207646_10001048 3300025922 Bacteria 35174
397 Ga0207646_10001059 3300025922 Bacteria 35029
398 Ga0207646_10001338 3300025922 Bacteria 30615
399 Ga0207646_10002468 3300025922 Bacteria 21845
400 Ga0207646_10002779 3300025922 Bacteria 20442
401 Ga0207646_10009105 3300025922 Bacteria 9857
402 Ga0207646_10019416 3300025922 Bacteria 6318
403 Ga0207646_10024129 3300025922 Bacteria 5574
404 Ga0207646_10025199 3300025922 Bacteria 5443
405 Ga0207646_10028463 3300025922 Bacteria 5086
406 Ga0207646_10032739 3300025922 Bacteria 4703
407 Ga0207646_10034130 3300025922 Bacteria 4598
408 Ga0207646_10035230 3300025922 Bacteria 4521
409 Ga0207646_10043074 3300025922 Bacteria 4054
410 Ga0207646_10077421 3300025922 Bacteria 2972
411 Ga0207646_10090698 3300025922 Bacteria 2735
412 Ga0207646_10119506 3300025922 Bacteria 2367
413 Ga0207646_10142044 3300025922 Bacteria 2163
414 Ga0207646_10318498 3300025922 Unclassified 1405
415 Ga0207681_10000449 3300025923 Bacteria 28895
416 Ga0207694_10003207 3300025924 Bacteria 13041
417 Ga0207650_10000037 3300025925 Bacteria 211825
418 Ga0207650_10012802 3300025925 Bacteria 5796
419 Ga0207659_10000012 3300025926 Bacteria 198502
420 Ga0207687_10046519 3300025927 Bacteria 3004
421 Ga0207644_10000044 3300025931 Bacteria 108379
422 Ga0207690_10000338 3300025932 Bacteria 31302
423 Ga0207706_10000131 3300025933 Bacteria 81169
424 Ga0207706_10138570 3300025933 Bacteria 2140
425 Ga0207686_10004052 3300025934 Bacteria 7865
426 Ga0207686_10008526 3300025934 Bacteria 5537
427 Ga0207709_10076529 3300025935 Bacteria 2142
428 Ga0207670_10000026 3300025936 Bacteria 131381
429 Ga0207670_10150425 3300025936 Bacteria 1727
430 Ga0207669_10000202 3300025937 Bacteria 27225
431 Ga0207704_10000024 3300025938 Bacteria 136163
432 Ga0207665_10003460 3300025939 Bacteria 10546
433 Ga0207665_10016683 3300025939 Bacteria 4824
434 Ga0207691_10000082 3300025940 Bacteria 80524
435 Ga0207691_10040836 3300025940 Bacteria 4286
436 Ga0207711_10000026 3300025941 Bacteria 254807
437 Ga0207711_10222130 3300025941 Bacteria 1728
438 Ga0207689_10000076 3300025942 Bacteria 80422
439 Ga0207689_10000365 3300025942 Bacteria 42716
440 Ga0207689_10140260 3300025942 Bacteria 1991
441 Ga0207661_10010112 3300025944 Bacteria 6780
442 Ga0207679_10000094 3300025945 Bacteria 77409
443 Ga0207679_10000291 3300025945 Bacteria 37793
444 Ga0207679_10096490 3300025945 Bacteria 2300
445 Ga0207667_10000790 3300025949 Bacteria 41185
446 Ga0207667_10004431 3300025949 Bacteria 17193
447 Ga0207651_10000046 3300025960 Bacteria 56571
448 Ga0207712_10000193 3300025961 Bacteria 62674
449 Ga0207668_10058065 3300025972 Bacteria 2703
450 Ga0207640_10000897 3300025981 Bacteria 16841
451 Ga0207640_10031597 3300025981 Bacteria 3273
452 Ga0207658_10000036 3300025986 Bacteria 152337
453 Ga0207677_10000184 3300026023 Bacteria 50145
454 Ga0207677_10126286 3300026023 Bacteria 1934
455 Ga0207677_10136555 3300026023 Bacteria 1871
456 Ga0207703_10000144 3300026035 Bacteria 83711
457 Ga0207639_10001744 3300026041 Bacteria 14654
458 Ga0207639_10003499 3300026041 Bacteria 10562
459 Ga0207678_10000200 3300026067 Bacteria 52538
460 Ga0207678_10007028 3300026067 Bacteria 9996
461 Ga0207708_10003807 3300026075 Bacteria 11121
462 Ga0207702_10000483 3300026078 Bacteria 44845
463 Ga0207702_10004981 3300026078 Bacteria 11664
464 Ga0207702_10184460 3300026078 Bacteria 1923
465 Ga0207641_10003361 3300026088 Bacteria 14221
466 Ga0207641_10072734 3300026088 Bacteria 2961
467 Ga0207648_10000110 3300026089 Bacteria 80524
468 Ga0207648_10002784 3300026089 Bacteria 18550
469 Ga0207648_10126312 3300026089 Bacteria 2250
470 Ga0207676_10000244 3300026095 Bacteria 47429
471 Ga0207676_10234821 3300026095 Bacteria 1641
472 Ga0207674_10000050 3300026116 Bacteria 116782
473 Ga0207674_10009424 3300026116 Bacteria 11156
474 Ga0207674_10023541 3300026116 Bacteria 6593
475 Ga0207674_10027649 3300026116 Bacteria 5996
476 Ga0207674_10030803 3300026116 Bacteria 5639
477 Ga0207675_100000010 3300026118 Bacteria 147838
478 Ga0207675_100069759 3300026118 Bacteria 3285
479 Ga0207683_10000097 3300026121 Bacteria 71745
480 Ga0207698_10000790 3300026142 Bacteria 18439
481 Ga0207698_10158726 3300026142 Bacteria 1975
482 Ga0209969_1000321 3300027360 Bacteria 6410
483 Ga0209981_1003539 3300027378 Bacteria 2030
484 Ga0210000_1000454 3300027462 Bacteria 5637
485 Ga0209995_1000697 3300027471 Bacteria 5152
486 Ga0209968_1000363 3300027526 Bacteria 7488
487 Ga0209999_1000279 3300027543 Bacteria 7518
488 Ga0209982_1000886 3300027552 Bacteria 3932
489 Ga0209970_1000626 3300027614 Bacteria 6119
490 Ga0210002_1001408 3300027617 Bacteria 3384
491 Ga0209983_1000678 3300027665 Bacteria 7312
492 Ga0209588_1000009 3300027671 Bacteria 174900
493 Ga0209588_1009354 3300027671 Bacteria 2928
494 Ga0209588_1016561 3300027671 Bacteria 2277
495 Ga0209588_1041711 3300027671 Bacteria 1481
496 Ga0209966_1000071 3300027695 Bacteria 45482
497 Ga0209998_10000126 3300027717 Bacteria 29860
498 Ga0209974_10000121 3300027876 Bacteria 23101
499 Ga0207428_10000033 3300027907 Bacteria 232081
500 Ga0207428_10000054 3300027907 Bacteria 175237
501 Ga0207428_10040525 3300027907 Bacteria 3777
502 Ga0207428_10084288 3300027907 Bacteria 2477
503 Ga0268266_10000184 3300028379 Bacteria 111090
504 Ga0268265_10000093 3300028380 Bacteria 114038
505 Ga0268265_10029062 3300028380 Bacteria 3964
506 Ga0268265_10100639 3300028380 Bacteria 2333
507 Ga0268265_10187750 3300028380 Bacteria 1782
508 Ga0268264_10000090 3300028381 Bacteria 234383
509 Ga0268264_10033890 3300028381 Bacteria 4197
510 Ga0265326_10013978 3300028558 Bacteria 2340
511 Ga0265322_10010628 3300028654 Bacteria 2673
512 Ga0265338_10019108 3300028800 Bacteria 7292
513 Ga0265324_10030060 3300029957 Bacteria 1907
514 Ga0265760_10002263 3300031090 Bacteria 5632
515 Ga0265760_10002467 3300031090 Bacteria 5397
516 Ga0265760_10009011 3300031090 Unclassified 2851
517 Ga0265320_10000798 3300031240 Bacteria 23919
518 Ga0265329_10007711 3300031242 Bacteria 4137
519 Ga0265339_10006920 3300031249 Bacteria 7383
520 Ga0265316_10009993 3300031344 Bacteria 8685
521 Ga0265316_10055029 3300031344 Bacteria 3114
522 Ga0265316_10071263 3300031344 Bacteria 2679
523 Ga0307408_100007871 3300031548 Bacteria 7046
524 Ga0307408_100036781 3300031548 Bacteria 3443
525 Ga0307408_100092410 3300031548 Bacteria 2287
526 Ga0265313_10026960 3300031595 Bacteria 3015
527 Ga0316579_10006952 3300031691 Bacteria 4646
528 Ga0265314_10008034 3300031711 Bacteria 9095
529 Ga0316576_10019806 3300031727 Bacteria 4617
530 Ga0316576_10031320 3300031727 Unclassified 3773
531 Ga0316577_10001111 3300031733 Bacteria 12258
532 Ga0316577_10030257 3300031733 Bacteria 3022
533 Ga0316577_10041130 3300031733 Bacteria 2586
534 Ga0307409_100011542 3300031995 Bacteria 5579
535 Ga0307409_100051206 3300031995 Bacteria 3159
536 Ga0307409_100306013 3300031995 Bacteria 1481
537 Ga0316593_10024388 3300032168 Bacteria 1917
538 Ga0316588_1019638 3300033528 Bacteria 1524
539 Ga0316596_1004889 3300033541 Bacteria 3029
540 Ga0316596_1009946 3300033541 Bacteria 2292
541 Ga0316596_1028075 3300033541 Bacteria 1454
542 Ga0373928_0014666 3300035084 Bacteria 1587
543 Ga0373932_0004983 3300035112 Bacteria 3126
544 Ga0373955_0058009 3300035172 Bacteria 2129
545 Ga0373962_0006597 3300035242 Bacteria 2813
546 Ga0373931_0002271 3300035691 Bacteria 8496
547 Ga0373931_0083308 3300035691 Bacteria 1769
548 Ga0373935_0006011 3300035692 Bacteria 7208
549 Ga0373935_0055004 3300035692 Bacteria 2536
550 Ga0373927_0034253 3300035695 Bacteria 3304
551 Ga0373947_0044290 3300035725 Bacteria 2659
552 Ga0316582_0016410 3300036647 Bacteria 4257
553 Ga0316582_0028600 3300036647 Bacteria 3379
554 Ga0316584_0000790 3300036712 Bacteria 17800
555 Ga0316584_0076562 3300036712 Bacteria 2507
556 Ga0395899_0011209 3300037312 Bacteria 6869
557 Ga0395900_0001747 3300037418 Bacteria 25001
558 Ga0395900_0122142 3300037418 Bacteria 2672
559 Ga0395898_0003002 3300037466 Bacteria 19130
560 Ga0395898_0074404 3300037466 Bacteria 3281
561 Ga0395905_0113727 3300037471 Unclassified 2543
562 Ga0436364_1268616 3300037853 Bacteria 7582
563 Ga0395901_0001149 3300038443 Bacteria 28063
564 Ga0400489_06679 3300039093 Bacteria 1957
565 Ga0400489_40474 3300039093 Bacteria 3557
566 Ga0400489_40527 3300039093 Unclassified 2681
567 Ga0436365_1281712 3300039437 Bacteria 80367
568 Ga0436365_1387694 3300039437 Unclassified 1469
569 Ga0436365_1746921 3300039437 Bacteria 22133
570 Ga0439448_0000106 3300042005 Bacteria 15215
571 Ga0439458_0001750 3300042157 Bacteria 5413
572 Ga0439435_0007341 3300042436 Bacteria 2519
573 Ga0439459_0001030 3300042438 Bacteria 3975
574 Ga0439460_0008270 3300042461 Bacteria 2625
575 Ga0451577_0013011 3300042876 Bacteria 7806
576 Ga0451577_0017184 3300042876 Bacteria 6687
577 Ga0451577_0051388 3300042876 Bacteria 3679
578 Ga0451577_0100001 3300042876 Bacteria 2590
579 Ga0451577_0100320 3300042876 Bacteria 2586
580 Ga0453683_0004774 3300044673 Bacteria 9553
581 Ga0453683_0008054 3300044673 Bacteria 7095
582 Ga0453683_0008593 3300044673 Bacteria 6849
583 Ga0453683_0042944 3300044673 Bacteria 2838
584 Ga0453683_0044210 3300044673 Bacteria 2794
585 Ga0453683_0053018 3300044673 Bacteria 2538
586 Ga0466963_0024677 3300044694 Bacteria 3828
587 Ga0453684_0009330 3300044712 Bacteria 17209
588 Ga0453684_0015144 3300044712 Bacteria 12233
589 Ga0453684_0026613 3300044712 Bacteria 8340
590 Ga0453684_0027919 3300044712 Bacteria 8073
591 Ga0453684_0040494 3300044712 Bacteria 6325
592 Ga0453684_0061773 3300044712 Bacteria 4806
593 Ga0453684_0069374 3300044712 Bacteria 4471
594 Ga0453684_0128349 3300044712 Bacteria 3047
595 Ga0466959_0035383 3300045049 Bacteria 3694
596 Ga0451576_0013754 3300045051 Bacteria 9040
597 Ga0451576_0034468 3300045051 Bacteria 5376
598 Ga0451576_0044194 3300045051 Bacteria 4697
599 Ga0451576_0046178 3300045051 Bacteria 4586
600 Ga0451576_0065167 3300045051 Bacteria 3793
601 Ga0451576_0084872 3300045051 Bacteria 3294
602 Ga0451576_0191261 3300045051 Bacteria 2137
603 Ga0451576_0251925 3300045051 Bacteria 1845
604 Ga0466967_0001694 3300045976 Bacteria 13110
605 Ga0466967_0105977 3300045976 Bacteria 2576
606 Ga0495651_0000023 3300046462 Bacteria 116915
607 Ga0495653_0008239 3300046463 Bacteria 8541
608 Ga0495653_0084406 3300046463 Bacteria 2339
609 Ga0495580_0001185 3300046472 Bacteria 22935
610 Ga0495580_0003670 3300046472 Bacteria 13017
611 Ga0495580_0021206 3300046472 Bacteria 4797
612 Ga0495580_0197982 3300046472 Bacteria 1385
613 Ga0495628_0003216 3300046516 Bacteria 14646
614 Ga0495630_0050047 3300046517 Unclassified 3126
615 Ga0495642_0028088 3300046528 Bacteria 2240
616 Ga0495665_0004071 3300046531 Bacteria 7889
617 Ga0495667_0001010 3300046559 Bacteria 18263
618 Ga0495659_0028756 3300046664 Bacteria 1925
619 Ga0495623_0007868 3300046679 Bacteria 6932
620 Ga0495613_0012214 3300046689 Bacteria 6382
621 Ga0495624_0026969 3300046690 Bacteria 3763
622 Ga0495600_0018327 3300046809 Bacteria 4460
623 Ga0495604_0000750 3300047317 Bacteria 27284
624 Ga0495674_0077260 3300047319 Bacteria 2862
625 Ga0495680_0001474 3300047322 Bacteria 25380
626 Ga0495675_0027546 3300047444 Bacteria 3621
627 Ga0495675_0035872 3300047444 Unclassified 3165
628 Ga0495593_0003784 3300047673 Bacteria 9038
629 Ga0495602_0028964 3300048088 Bacteria 5288
630 Ga0495614_0021538 3300048089 Bacteria 2783
631 Ga0496101_0213727 3300048904 Bacteria 1495
632 Ga0496102_0003402 3300048905 Bacteria 13491
633 Ga0496106_0016111 3300048909 Bacteria 5527
634 Ga0496108_0046373 3300048911 Bacteria 3631
635 Ga0496112_0000404 3300048915 Bacteria 28250
636 Ga0496112_0060046 3300048915 Bacteria 3746
637 Ga0496112_0067549 3300048915 Bacteria 3529
638 Ga0501031_0014383 3300049568 Bacteria 5145
639 Ga0501033_0013012 3300049570 Bacteria 6346
640 Ga0501033_0042801 3300049570 Bacteria 3376
641 Ga0501033_0105130 3300049570 Bacteria 2058
642 Ga0501036_0003619 3300049572 Bacteria 12356
643 Ga0501036_0006610 3300049572 Bacteria 9420
644 Ga0501037_0001789 3300049573 Bacteria 15606
645 Ga0501038_0001715 3300049574 Bacteria 20367
646 Ga0501038_0015884 3300049574 Bacteria 6840
647 Ga0501039_0001933 3300049575 Bacteria 15358
648 Ga0501039_0029395 3300049575 Bacteria 4233
649 Ga0501039_0065927 3300049575 Bacteria 2810
650 Ga0501039_0095132 3300049575 Bacteria 2322
651 Ga0501039_0157818 3300049575 Bacteria 1783
652 Ga0501039_0174436 3300049575 Bacteria 1691
653 Ga0501040_0001728 3300049576 Bacteria 14017
654 Ga0501040_0029959 3300049576 Bacteria 3673
655 Ga0501040_0050199 3300049576 Bacteria 2853
656 Ga0501040_0071632 3300049576 Bacteria 2393
657 Ga0501040_0084364 3300049576 Bacteria 2204
658 Ga0501040_0122854 3300049576 Bacteria 1822
659 Ga0501041_0000249 3300049577 Bacteria 25299
660 Ga0501041_0003148 3300049577 Bacteria 9492
661 Ga0501041_0009461 3300049577 Bacteria 5745
662 Ga0501041_0037519 3300049577 Bacteria 2937
663 Ga0501041_0064549 3300049577 Bacteria 2242
664 Ga0501041_0115008 3300049577 Unclassified 1670
665 Ga0501042_0007229 3300049578 Bacteria 7267
666 Ga0501042_0030480 3300049578 Bacteria 3809
667 Ga0501042_0086005 3300049578 Bacteria 2255
668 Ga0501042_0117746 3300049578 Bacteria 1912
669 Ga0501042_0126756 3300049578 Bacteria 1838
670 Ga0501042_0212821 3300049578 Bacteria 1394
671 Ga0501043_0012083 3300049579 Bacteria 6754
672 Ga0501046_0000084 3300049580 Bacteria 100971
673 Ga0501046_0009424 3300049580 Bacteria 8438
674 Ga0501046_0063705 3300049580 Bacteria 2878
675 Ga0501046_0134453 3300049580 Bacteria 1874
676 Ga0501048_0000322 3300049582 Bacteria 32900
677 Ga0501048_0030179 3300049582 Bacteria 3924
678 Ga0501048_0073303 3300049582 Bacteria 2416
679 Ga0501048_0207176 3300049582 Unclassified 1391
680 Ga0501068_0006552 3300049584 Bacteria 6421
681 Ga0501068_0134010 3300049584 Bacteria 1550
682 Ga0501068_0188723 3300049584 Bacteria 1305
683 Ga0501069_0037165 3300049585 Bacteria 2687
684 Ga0501071_0000026 3300049587 Bacteria 48260
685 Ga0501071_0002922 3300049587 Bacteria 10551
686 Ga0501071_0056325 3300049587 Bacteria 2839
687 Ga0501071_0135552 3300049587 Bacteria 1832
688 Ga0501071_0174504 3300049587 Bacteria 1610
689 Ga0501072_0000376 3300049588 Bacteria 31894
690 Ga0501072_0023812 3300049588 Bacteria 4757
691 Ga0501072_0057456 3300049588 Bacteria 3066
692 Ga0501072_0105952 3300049588 Bacteria 2236
693 Ga0501072_0109440 3300049588 Bacteria 2199
694 Ga0501072_0119281 3300049588 Bacteria 2102
695 Ga0501072_0160848 3300049588 Bacteria 1791
696 Ga0501072_0188826 3300049588 Bacteria 1643
697 Ga0501073_0089273 3300049589 Bacteria 2143
698 Ga0501073_0102881 3300049589 Bacteria 1983
699 Ga0501074_0003604 3300049590 Bacteria 10997
700 Ga0501074_0044961 3300049590 Bacteria 3195
701 Ga0501074_0084515 3300049590 Bacteria 2275
702 Ga0501075_0000066 3300049591 Bacteria 45649
703 Ga0501075_0000177 3300049591 Bacteria 33160
704 Ga0501075_0019568 3300049591 Bacteria 4915
705 Ga0501075_0030681 3300049591 Bacteria 3983
706 Ga0501075_0043500 3300049591 Bacteria 3369
707 Ga0501075_0046530 3300049591 Bacteria 3259
708 Ga0501075_0055781 3300049591 Bacteria 2973
709 Ga0501075_0067858 3300049591 Bacteria 2693
710 Ga0501075_0078009 3300049591 Bacteria 2507
711 Ga0501075_0084083 3300049591 Bacteria 2410
712 Ga0501075_0110633 3300049591 Bacteria 2088
713 Ga0501075_0177518 3300049591 Unclassified 1625
714 Ga0501076_0000014 3300049592 Bacteria 97509
715 Ga0501076_0000017 3300049592 Bacteria 94144
716 Ga0501076_0004543 3300049592 Bacteria 9887
717 Ga0501076_0006353 3300049592 Bacteria 8569
718 Ga0501076_0010457 3300049592 Bacteria 6888
719 Ga0501076_0017060 3300049592 Bacteria 5514
720 Ga0501076_0024248 3300049592 Bacteria 4687
721 Ga0501076_0030060 3300049592 Bacteria 4230
722 Ga0501076_0042089 3300049592 Bacteria 3596
723 Ga0501077_0000762 3300049593 Bacteria 19449
724 Ga0501077_0012344 3300049593 Bacteria 5351
725 Ga0501077_0021199 3300049593 Bacteria 4112
726 Ga0501077_0034222 3300049593 Bacteria 3233
727 Ga0501077_0051825 3300049593 Unclassified 2607
728 Ga0501077_0078475 3300049593 Bacteria 2092
729 Ga0501077_0141242 3300049593 Bacteria 1527
730 Ga0501079_0000726 3300049741 Bacteria 22256
731 Ga0501079_0002073 3300049741 Bacteria 14372
732 Ga0501079_0027802 3300049741 Bacteria 4338
733 Ga0501079_0030830 3300049741 Bacteria 4121
734 Ga0501079_0038071 3300049741 Bacteria 3709
735 Ga0501079_0082636 3300049741 Bacteria 2484
736 Ga0501079_0094377 3300049741 Bacteria 2318
737 Ga0501079_0106510 3300049741 Bacteria 2176
738 Ga0501079_0126257 3300049741 Bacteria 1990
739 Ga0501080_0008363 3300049742 Bacteria 9370
740 Ga0501080_0026586 3300049742 Bacteria 5378
741 Ga0501080_0119788 3300049742 Bacteria 2440
742 Ga0501080_0162068 3300049742 Bacteria 2065
743 Ga0501080_0291942 3300049742 Bacteria 1480
744 Ga0501080_0452387 3300049742 Bacteria 1151
745 Ga0501081_0000011 3300049743 Bacteria 67455
746 Ga0501081_0015410 3300049743 Bacteria 5044
747 Ga0501081_0032635 3300049743 Bacteria 3533
748 Ga0501081_0051651 3300049743 Bacteria 2835
749 Ga0501081_0057262 3300049743 Bacteria 2695
750 Ga0501081_0092595 3300049743 Bacteria 2127
751 Ga0501081_0093316 3300049743 Bacteria 2119
752 Ga0501081_0144631 3300049743 Bacteria 1705
753 Ga0501083_0057096 3300049744 Bacteria 2614
754 Ga0501035_0022094 3300049822 Bacteria 5844
755 Ga0501035_0214232 3300049822 Unclassified 1647
756 Ga0501045_0000024 3300049824 Bacteria 63402
757 Ga0501045_0030077 3300049824 Bacteria 3929
758 Ga0501045_0076395 3300049824 Bacteria 2468
759 Ga0501045_0089391 3300049824 Bacteria 2275
760 nmdc:mga05p37_103804_c1 3300050507 Bacteria 3498
761 nmdc:mga05p37_132169_c1 3300050507 Bacteria 3062
762 nmdc:mga05p37_13925_c1 3300050507 Bacteria 9641
763 nmdc:mga05p37_15583_c1 3300050507 Bacteria 9136
764 nmdc:mga05p37_18193_c1 3300050507 Bacteria 8491
765 nmdc:mga05p37_186738_c1 3300050507 Bacteria 2520
766 nmdc:mga05p37_190869_c1 3300050507 Bacteria 2487
767 nmdc:mga05p37_195033_c2 3300050507 Bacteria 2036
768 nmdc:mga05p37_34529_c1 3300050507 Bacteria 6195
769 nmdc:mga05p37_40828_c1 3300050507 Bacteria 5697
770 nmdc:mga05p37_4961_c1 3300050507 Bacteria 15591
771 nmdc:mga05p37_52015_c1 3300050507 Bacteria 5037
772 nmdc:mga05p37_6146_c1 3300050507 Bacteria 14129
773 nmdc:mga05p37_6225_c1 3300050507 Bacteria 14050
774 nmdc:mga05p37_733_c1 3300050507 Bacteria 36361
775 nmdc:mga05p37_74211_c1 3300050507 Bacteria 4187
776 nmdc:mga05p37_74584_c1 3300050507 Bacteria 4176
777 nmdc:mga05p37_84983_c1 3300050507 Bacteria 3899
778 nmdc:mga05p37_93048_c1 3300050507 Bacteria 3715
779 nmdc:mga05p37_9994_c1 3300050507 Bacteria 11268
780 nmdc:mga09592_1059_c1 3300050508 Bacteria 21817
781 nmdc:mga09592_149813_c1 3300050508 Bacteria 2013
782 nmdc:mga09592_196959_c1 3300050508 Bacteria 1744
783 nmdc:mga09592_22145_c1 3300050508 Bacteria 5243
784 nmdc:mga09592_56_c1 3300050508 Bacteria 62143
785 nmdc:mga09592_6184_c2 3300050508 Bacteria 9102
786 nmdc:mga09592_7946_c1 3300050508 Bacteria 8619
787 nmdc:mga0qj67_116001_c1 3300050509 Bacteria 2164
788 nmdc:mga0qj67_14603_c1 3300050509 Bacteria 5938
789 nmdc:mga0qj67_4943_c1 3300050509 Bacteria 9687
790 nmdc:mga0qj67_6405_c1 3300050509 Bacteria 8650
791 nmdc:mga06r32_113220_c1 3300050510 Bacteria 2670
792 nmdc:mga06r32_132_c1 3300050510 Bacteria 54848
793 nmdc:mga06r32_173506_c1 3300050510 Bacteria 2140
794 nmdc:mga06r32_223672_c1 3300050510 Bacteria 1870
795 nmdc:mga06r32_293570_c1 3300050510 Bacteria 1612
796 nmdc:mga06r32_3570_c1 3300050510 Bacteria 13887
797 nmdc:mga06r32_428_c1 3300050510 Bacteria 35405
798 nmdc:mga06r32_57196_c1 3300050510 Bacteria 3746
799 nmdc:mga06r32_96796_c1 3300050510 Bacteria 2891
800 nmdc:mga08y16_37085_c1 3300050511 Bacteria 5119
801 nmdc:mga08y16_800_c1 3300050511 Bacteria 30094
802 nmdc:mga0n895_18199_c1 3300050512 Bacteria 6495
803 nmdc:mga0n895_185088_c1 3300050512 Unclassified 2114
804 nmdc:mga0n895_22917_c1 3300050512 Bacteria 5859
805 nmdc:mga0n895_26_c1 3300050512 Bacteria 89958
806 nmdc:mga0n895_406686_c1 3300050512 Bacteria 1377
807 nmdc:mga0n895_49777_c1 3300050512 Bacteria 4107
808 nmdc:mga0n895_59220_c1 3300050512 Bacteria 3779
809 nmdc:mga0n895_63339_c1 3300050512 Bacteria 3657
810 nmdc:mga0rr50_10942_c1 3300050513 Bacteria 5787
811 nmdc:mga0rr50_17406_c1 3300050513 Bacteria 4799
812 nmdc:mga0rr50_179_c1 3300050513 Bacteria 34229
813 nmdc:mga0rr50_23191_c1 3300050513 Bacteria 4275
814 nmdc:mga0rr50_63628_c1 3300050513 Bacteria 2787
815 nmdc:mga08x19_35615_c1 3300050514 Bacteria 3150
816 nmdc:mga08x19_37853_c1 3300050514 Bacteria 3063
817 nmdc:mga08x19_47866_c1 3300050514 Bacteria 2738
818 nmdc:mga08x19_50112_c1 3300050514 Bacteria 2679
819 nmdc:mga08x19_50941_c1 3300050514 Bacteria 2658
820 nmdc:mga0a205_10471_c2 3300050515 Bacteria 5100
821 nmdc:mga0a205_105967_c1 3300050515 Bacteria 2710
822 nmdc:mga0a205_11848_c2 3300050515 Bacteria 4810
823 nmdc:mga0a205_130292_c1 3300050515 Bacteria 2416
824 nmdc:mga0a205_15338_c1 3300050515 Bacteria 7160
825 nmdc:mga0a205_159864_c1 3300050515 Bacteria 2150
826 nmdc:mga0a205_16101_c1 3300050515 Bacteria 7000
827 nmdc:mga0a205_223360_c1 3300050515 Bacteria 1769
828 nmdc:mga0a205_4297_c1 3300050515 Bacteria 6807
829 nmdc:mga0a205_47306_c1 3300050515 Bacteria 4150
830 nmdc:mga0a205_67998_c1 3300050515 Bacteria 2892
831 nmdc:mga0a205_68359_c1 3300050515 Bacteria 3431
832 nmdc:mga0a205_80355_c1 3300050515 Bacteria 3151
833 nmdc:mga0a205_82686_c1 3300050515 Bacteria 3102
834 Ga0495612_0001701 3300053078 Bacteria 9031
835 Ga0501084_0000521 3300054114 Bacteria 29417
836 Ga0501084_0007454 3300054114 Bacteria 9018
837 Ga0501084_0010273 3300054114 Bacteria 7744
838 Ga0501084_0012673 3300054114 Bacteria 6986
839 Ga0501084_0016610 3300054114 Bacteria 6112
840 Ga0501084_0093629 3300054114 Bacteria 2523
841 Ga0501084_0146810 3300054114 Bacteria 1987
842 Ga0501084_0177959 3300054114 Bacteria 1795
843 Ga0501084_0181239 3300054114 Bacteria 1778
844 Ga0587066_003942 3300059490 Bacteria 1787
845 Ga0587070_003308 3300059491 Bacteria 1927
846 Ga0587083_0003552 3300059505 Bacteria 2082
847 Ga0587109_001215 3300059624 Bacteria 2905
848 Ga0587071_007491 3300060344 Unclassified 1742
849 Ga0501082_0003568 3300060353 Bacteria 13582
850 Ga0501082_0005422 3300060353 Bacteria 11069
851 Ga0501082_0013650 3300060353 Bacteria 6983
852 Ga0501082_0025458 3300060353 Bacteria 5098
853 Ga0501082_0046988 3300060353 Bacteria 3720
854 Ga0501082_0047767 3300060353 Bacteria 3688
855 Ga0530510_0000034 3300061734 Bacteria 62610
856 Ga0530510_0000045 3300061734 Bacteria 56772
857 Ga0530510_0001424 3300061734 Bacteria 16019
858 Ga0530510_0002079 3300061734 Bacteria 13746
859 Ga0530510_0005772 3300061734 Bacteria 8578
860 Ga0530510_0016985 3300061734 Bacteria 5154
861 Ga0530510_0025681 3300061734 Bacteria 4213
862 Ga0530510_0049211 3300061734 Bacteria 3046
863 Ga0530510_0175783 3300061734 Bacteria 1587
864 Ga0070698_100171187
865 JGI24737J22298_10020201
866 JGI24750J21931_1003244
867 JGI24748J21848_1001738
868 JGI24749J21850_1000495
869 JGI24744J21845_10002809
870 JGI24033J26618_1002888
871 JGI24751J29686_10007042
872 JGI25406J46586_10036499
873 JGI25404J52841_10010084
874 Ga0058861_10081639
875 Ga0058862_10109908
876 Ga0065712_10073237
877 Ga0065715_10000289
878 Ga0065707_10017786
879 Ga0070658_10000964
880 Ga0070676_10000731
881 Ga0070676_10033611
882 Ga0070676_10079558
883 Ga0070683_100053570
884 Ga0070683_100108108
885 Ga0070690_100000211
886 Ga0070670_100001759
887 Ga0070670_100006195
888 Ga0070677_10000191
889 Ga0068869_100000011
890 Ga0068869_100001917
891 Ga0070666_10000076
892 Ga0070680_100000065
893 Ga0070680_100000772
894 Ga0070682_100000164
895 Ga0068868_100062947
896 Ga0070660_100001094
897 Ga0070660_100003516
898 Ga0070689_100000105
899 Ga0070689_100065843
900 Ga0070691_10008442
901 Ga0070687_100000008
902 Ga0070687_100144769
903 Ga0070661_100000737
904 Ga0070661_100007975
905 Ga0070692_10000182
906 Ga0070692_10001891
907 Ga0070692_10016651
908 Ga0070692_10104486
909 Ga0070668_100004566
910 Ga0070669_100000435
911 Ga0070669_100148378
912 Ga0070675_100001324
913 Ga0070671_100008710
914 Ga0070674_100000404
915 Ga0070673_100007851
916 Ga0070673_100067465
917 Ga0070673_100229566
918 Ga0070688_100000094
919 Ga0070659_100000063
920 Ga0070659_100000169
921 Ga0070667_100000734
922 Ga0070703_10002078
923 Ga0070703_10007622
924 Ga0070714_100027218
925 Ga0070710_10063565
926 Ga0070701_10028732
927 Ga0070701_10074815
928 Ga0070711_100117627
929 Ga0070705_100001337
930 Ga0070705_100036621
931 Ga0070705_100040271
932 Ga0070705_100047355
933 Ga0070705_100070853
934 Ga0070705_100142191
935 Ga0070700_100012042
936 Ga0070694_100007786
937 Ga0070694_100014375
938 Ga0070694_100031029
939 Ga0070708_100001883
940 Ga0070708_100002729
941 Ga0070708_100008999
942 Ga0070708_100010509
943 Ga0070708_100013536
944 Ga0070708_100020341
945 Ga0070708_100024297
946 Ga0070708_100038442
947 Ga0070708_100053936
948 Ga0070708_100054281
949 Ga0070708_100080303
950 Ga0070663_100000445
951 Ga0070663_100002736
952 Ga0070678_100000456
953 Ga0070662_100000048
954 Ga0070662_100003120
955 Ga0070681_10001190
956 Ga0070681_10036763
957 Ga0068867_100000038
958 Ga0068867_100052140
959 Ga0070685_10000676
960 Ga0070706_100000078
961 Ga0070706_100000641
962 Ga0070706_100000718
963 Ga0070706_100007366
964 Ga0070706_100008544
965 Ga0070706_100032033
966 Ga0070706_100037319
967 Ga0070706_100056263
968 Ga0070706_100138406
969 Ga0070706_100215482
970 Ga0070706_100231666
971 Ga0070706_100277891
972 Ga0070707_100000453
973 Ga0070707_100001162
974 Ga0070707_100001982
975 Ga0070707_100002945
976 Ga0070707_100004099
977 Ga0070707_100006736
978 Ga0070707_100014753
979 Ga0070707_100014829
980 Ga0070707_100027703
981 Ga0070707_100027844
982 Ga0070707_100049759
983 Ga0070707_100059514
984 Ga0070707_100097857
985 Ga0070707_100127081
986 Ga0070707_100216945
987 Ga0070707_100243206
988 Ga0070698_100000439
989 Ga0070698_100003677
990 Ga0070698_100004713
991 Ga0070698_100009924
992 Ga0070698_100012354
993 Ga0070698_100019333
994 Ga0070698_100025289
995 Ga0070698_100039844
996 Ga0070698_100063006
997 Ga0070698_100079927
998 Ga0070698_100109380
999 Ga0070699_100001432
1000 Ga0070699_100030325
1001 Ga0070699_100033726
1002 Ga0070699_100033841
1003 Ga0070699_100034937
1004 Ga0070699_100036802
1005 Ga0070699_100050740
1006 Ga0070699_100111660
1007 Ga0070699_100128568
1008 Ga0070699_100161721
1009 Ga0070699_100165354
1010 Ga0070699_100234216
1011 Ga0070699_100263195
1012 Ga0070679_100035651
1013 Ga0070679_100056568
1014 Ga0070684_100030452
1015 Ga0070684_100068974
1016 Ga0070697_100005470
1017 Ga0070697_100006857
1018 Ga0070697_100007011
1019 Ga0070697_100030006
1020 Ga0070697_100039384
1021 Ga0070697_100068009
1022 Ga0070697_100101084
1023 Ga0070697_100133142
1024 Ga0070697_100160853
1025 Ga0068853_100000668
1026 Ga0068853_100011928
1027 Ga0068853_100176768
1028 Ga0070672_100000114
1029 Ga0070686_100000680
1030 Ga0070695_100002565
1031 Ga0070695_100007818
1032 Ga0070695_100018830
1033 Ga0070696_100012609
1034 Ga0070696_100018237
1035 Ga0070696_100099409
1036 Ga0070696_100159425
1037 Ga0070693_100000018
1038 Ga0070693_100051464
1039 Ga0070665_100097635
1040 Ga0070704_100000298
1041 Ga0070704_100003920
1042 Ga0070704_100008478
1043 Ga0070704_100039493
1044 Ga0070704_100141632
1045 Ga0070704_100164593
1046 Ga0068855_100000523
1047 Ga0070664_100000271
1048 Ga0070664_100006179
1049 Ga0068857_100005552
1050 Ga0068854_100000169
1051 Ga0068854_100025527
1052 Ga0068856_100001345
1053 Ga0068856_100001772
1054 Ga0070702_100058953
1055 Ga0068852_100000055
1056 Ga0068852_100277381
1057 Ga0068859_100001246
1058 Ga0068859_100002625
1059 Ga0068864_100000134
1060 Ga0068864_100038169
1061 Ga0068864_100122877
1062 Ga0068866_10000012
1063 Ga0068861_100000601
1064 Ga0068851_10000406
1065 Ga0068870_10000201
1066 Ga0068863_100000581
1067 Ga0068863_100060536
1068 Ga0068858_100002645
1069 Ga0068860_100000893
1070 Ga0068860_100099563
1071 Ga0068862_100000172
1072 Ga0068862_100004185
1073 Ga0068862_100031599
1074 Ga0068862_100159791
1075 Ga0068862_100284280
1076 Ga0081455_10000499
1077 Ga0081455_10024936
1078 Ga0081455_10245567
1079 Ga0081538_10002834
1080 Ga0081538_10007052
1081 Ga0081538_10053293
1082 Ga0081540_1000029
1083 Ga0081540_1001072
1084 Ga0081540_1025826
1085 Ga0081539_10000092
1086 Ga0070717_10002168
1087 Ga0070717_10030696
1088 Ga0070716_100147353
1089 Ga0070712_100087917
1090 Ga0097621_100002506
1091 Ga0097621_100090087
1092 Ga0068871_100143949
1093 Ga0075428_100000436
1094 Ga0075428_100018983
1095 Ga0075428_100075256
1096 Ga0075428_100114097
1097 Ga0075428_100122324
1098 Ga0075430_100000002
1099 Ga0075430_100004567
1100 Ga0075430_100039977
1101 Ga0075430_100184973
1102 Ga0075431_100001143
1103 Ga0075431_100004273
1104 Ga0075431_100005337
1105 Ga0075431_100006431
1106 Ga0075431_100013306
1107 Ga0075431_100064149
1108 Ga0075431_100113332
1109 Ga0075431_100123696
1110 Ga0075431_100173833
1111 Ga0075431_100176041
1112 Ga0075431_100291632
1113 Ga0075433_10006010
1114 Ga0075433_10013030
1115 Ga0075433_10061827
1116 Ga0075433_10085273
1117 Ga0075433_10110002
1118 Ga0075433_10181016
1119 Ga0075433_10210710
1120 Ga0075434_100002356
1121 Ga0075434_100009161
1122 Ga0075434_100027738
1123 Ga0075434_100046909
1124 Ga0075434_100326276
1125 Ga0075429_100000460
1126 Ga0075429_100001996
1127 Ga0075429_100065959
1128 Ga0075429_100067702
1129 Ga0075429_100083769
1130 Ga0068865_100000201
1131 Ga0075436_100001438
1132 Ga0075436_100048236
1133 Ga0075436_100079090
1134 Ga0075436_100132019
1135 Ga0097620_100001246
1136 Ga0097620_100002625
1137 Ga0075435_100003478
1138 Ga0075435_100051018
1139 Ga0075435_100053393
1140 Ga0099794_10000012
1141 Ga0099794_10003423
1142 Ga0099794_10040861
1143 Ga0099794_10049709
1144 Ga0099794_10049716
1145 Ga0099794_10057754
1146 Ga0099794_10079975
1147 Ga0105250_10027533
1148 Ga0105240_10012250
1149 Ga0111539_10000557
1150 Ga0111539_10014763
1151 Ga0111539_10123524
1152 Ga0111539_10295650
1153 Ga0105245_10000441
1154 Ga0105247_10001336
1155 Ga0114129_10001149
1156 Ga0114129_10001410
1157 Ga0114129_10002948
1158 Ga0114129_10004296
1159 Ga0114129_10009108
1160 Ga0114129_10010580
1161 Ga0114129_10018918
1162 Ga0114129_10022145
1163 Ga0114129_10022405
1164 Ga0114129_10027955
1165 Ga0114129_10061413
1166 Ga0114129_10070979
1167 Ga0114129_10075187
1168 Ga0114129_10076005
1169 Ga0114129_10099597
1170 Ga0114129_10330173
1171 Ga0114129_10535317
1172 Ga0105243_10126588
1173 Ga0105241_10004015
1174 Ga0105241_10004089
1175 Ga0105242_10003647
1176 Ga0105242_10011665
1177 Ga0105248_10001691
1178 Ga0105248_10384653
1179 Ga0105237_10000991
1180 Ga0105238_10001094
1181 Ga0105249_10000163
1182 Ga0105239_10003746
1183 Ga0105246_10001081
1184 Ga0157373_10004197
1185 Ga0157373_10146492
1186 Ga0157373_10196002
1187 Ga0157371_10000464
1188 Ga0157371_10026739
1189 Ga0157369_10000305
1190 Ga0157374_10000048
1191 Ga0157378_10003844
1192 Ga0157378_10149918
1193 Ga0163162_10000105
1194 Ga0157372_10000760
1195 Ga0157372_10000846
1196 Ga0157372_10015202
1197 Ga0157375_10001406
1198 Ga0157375_10490825
1199 Ga0163163_10003872
1200 Ga0163163_10032327
1201 Ga0163163_10376715
1202 Ga0157377_10000267
1203 Ga0157379_10000037
1204 Ga0157376_10001032
1205 Ga0206356_11367602
1206 Ga0213876_10028216
1207 Ga0207697_10000034
1208 Ga0207656_10000276
1209 Ga0207653_10000189
1210 Ga0207653_10000554
1211 Ga0207682_10000057
1212 Ga0207688_10000032
1213 Ga0207688_10002237
1214 Ga0207680_10000859
1215 Ga0207647_10001367
1216 Ga0207699_10037360
1217 Ga0207699_10099526
1218 Ga0207645_10000057
1219 Ga0207645_10000340
1220 Ga0207643_10000045
1221 Ga0207643_10000105
1222 Ga0207643_10011571
1223 Ga0207705_10126317
1224 Ga0207684_10000009
1225 Ga0207684_10000094
1226 Ga0207684_10000157
1227 Ga0207684_10000242
1228 Ga0207684_10000716
1229 Ga0207684_10002560
1230 Ga0207684_10010076
1231 Ga0207684_10010346
1232 Ga0207684_10017290
1233 Ga0207684_10035076
1234 Ga0207684_10042663
1235 Ga0207684_10071480
1236 Ga0207684_10091672
1237 Ga0207684_10122084
1238 Ga0207684_10158185
1239 Ga0207684_10183877
1240 Ga0207684_10230042
1241 Ga0207654_10003239
1242 Ga0207707_10000034
1243 Ga0207695_10012609
1244 Ga0207671_10001647
1245 Ga0207693_10051089
1246 Ga0207693_10148826
1247 Ga0207660_10000276
1248 Ga0207660_10001693
1249 Ga0207660_10009710
1250 Ga0207662_10000036
1251 Ga0207657_10000066
1252 Ga0207657_10000108
1253 Ga0207649_10001774
1254 Ga0207649_10002859
1255 Ga0207652_10000245
1256 Ga0207652_10051237
1257 Ga0207646_10000020
1258 Ga0207646_10000574
1259 Ga0207646_10001048
1260 Ga0207646_10001059
1261 Ga0207646_10001338
1262 Ga0207646_10002468
1263 Ga0207646_10002779
1264 Ga0207646_10009105
1265 Ga0207646_10019416
1266 Ga0207646_10024129
1267 Ga0207646_10025199
1268 Ga0207646_10028463
1269 Ga0207646_10032739
1270 Ga0207646_10034130
1271 Ga0207646_10035230
1272 Ga0207646_10043074
1273 Ga0207646_10077421
1274 Ga0207646_10090698
1275 Ga0207646_10119506
1276 Ga0207646_10142044
1277 Ga0207646_10318498
1278 Ga0207681_10000449
1279 Ga0207694_10003207
1280 Ga0207650_10000037
1281 Ga0207650_10012802
1282 Ga0207659_10000012
1283 Ga0207687_10046519
1284 Ga0207644_10000044
1285 Ga0207690_10000338
1286 Ga0207706_10000131
1287 Ga0207706_10138570
1288 Ga0207686_10004052
1289 Ga0207686_10008526
1290 Ga0207709_10076529
1291 Ga0207670_10000026
1292 Ga0207670_10150425
1293 Ga0207669_10000202
1294 Ga0207704_10000024
1295 Ga0207665_10003460
1296 Ga0207665_10016683
1297 Ga0207691_10000082
1298 Ga0207691_10040836
1299 Ga0207711_10000026
1300 Ga0207711_10222130
1301 Ga0207689_10000076
1302 Ga0207689_10000365
1303 Ga0207689_10140260
1304 Ga0207661_10010112
1305 Ga0207679_10000094
1306 Ga0207679_10000291
1307 Ga0207679_10096490
1308 Ga0207667_10000790
1309 Ga0207667_10004431
1310 Ga0207651_10000046
1311 Ga0207712_10000193
1312 Ga0207668_10058065
1313 Ga0207640_10000897
1314 Ga0207640_10031597
1315 Ga0207658_10000036
1316 Ga0207677_10000184
1317 Ga0207677_10126286
1318 Ga0207677_10136555
1319 Ga0207703_10000144
1320 Ga0207639_10001744
1321 Ga0207639_10003499
1322 Ga0207678_10000200
1323 Ga0207678_10007028
1324 Ga0207708_10003807
1325 Ga0207702_10000483
1326 Ga0207702_10004981
1327 Ga0207702_10184460
1328 Ga0207641_10003361
1329 Ga0207641_10072734
1330 Ga0207648_10000110
1331 Ga0207648_10002784
1332 Ga0207648_10126312
1333 Ga0207676_10000244
1334 Ga0207676_10234821
1335 Ga0207674_10000050
1336 Ga0207674_10009424
1337 Ga0207674_10023541
1338 Ga0207674_10027649
1339 Ga0207674_10030803
1340 Ga0207675_100000010
1341 Ga0207675_100069759
1342 Ga0207683_10000097
1343 Ga0207698_10000790
1344 Ga0207698_10158726
1345 Ga0209969_1000321
1346 Ga0209981_1003539
1347 Ga0210000_1000454
1348 Ga0209995_1000697
1349 Ga0209968_1000363
1350 Ga0209999_1000279
1351 Ga0209982_1000886
1352 Ga0209970_1000626
1353 Ga0210002_1001408
1354 Ga0209983_1000678
1355 Ga0209588_1000009
1356 Ga0209588_1009354
1357 Ga0209588_1016561
1358 Ga0209588_1041711
1359 Ga0209966_1000071
1360 Ga0209998_10000126
1361 Ga0209974_10000121
1362 Ga0207428_10000033
1363 Ga0207428_10000054
1364 Ga0207428_10040525
1365 Ga0207428_10084288
1366 Ga0268266_10000184
1367 Ga0268265_10000093
1368 Ga0268265_10029062
1369 Ga0268265_10100639
1370 Ga0268265_10187750
1371 Ga0268264_10000090
1372 Ga0268264_10033890
1373 Ga0265326_10013978
1374 Ga0265322_10010628
1375 Ga0265338_10019108
1376 Ga0265324_10030060
1377 Ga0265760_10002263
1378 Ga0265760_10002467
1379 Ga0265760_10009011
1380 Ga0265320_10000798
1381 Ga0265329_10007711
1382 Ga0265339_10006920
1383 Ga0265316_10009993
1384 Ga0265316_10055029
1385 Ga0265316_10071263
1386 Ga0307408_100007871
1387 Ga0307408_100036781
1388 Ga0307408_100092410
1389 Ga0265313_10026960
1390 Ga0316579_10006952
1391 Ga0265314_10008034
1392 Ga0316576_10019806
1393 Ga0316576_10031320
1394 Ga0316577_10001111
1395 Ga0316577_10030257
1396 Ga0316577_10041130
1397 Ga0307409_100011542
1398 Ga0307409_100051206
1399 Ga0307409_100306013
1400 Ga0316593_10024388
1401 Ga0316588_1019638
1402 Ga0316596_1004889
1403 Ga0316596_1009946
1404 Ga0316596_1028075
1405 Ga0373928_0014666
1406 Ga0373932_0004983
1407 Ga0373955_0058009
1408 Ga0373962_0006597
1409 Ga0373931_0002271
1410 Ga0373931_0083308
1411 Ga0373935_0006011
1412 Ga0373935_0055004
1413 Ga0373927_0034253
1414 Ga0373947_0044290
1415 Ga0316582_0016410
1416 Ga0316582_0028600
1417 Ga0316584_0000790
1418 Ga0316584_0076562
1419 Ga0395899_0011209
1420 Ga0395900_0001747
1421 Ga0395900_0122142
1422 Ga0395898_0003002
1423 Ga0395898_0074404
1424 Ga0395905_0113727
1425 Ga0436364_1268616
1426 Ga0395901_0001149
1427 Ga0400489_06679
1428 Ga0400489_40474
1429 Ga0400489_40527
1430 Ga0436365_1281712
1431 Ga0436365_1387694
1432 Ga0436365_1746921
1433 Ga0439448_0000106
1434 Ga0439458_0001750
1435 Ga0439435_0007341
1436 Ga0439459_0001030
1437 Ga0439460_0008270
1438 Ga0451577_0013011
1439 Ga0451577_0017184
1440 Ga0451577_0051388
1441 Ga0451577_0100001
1442 Ga0451577_0100320
1443 Ga0453683_0004774
1444 Ga0453683_0008054
1445 Ga0453683_0008593
1446 Ga0453683_0042944
1447 Ga0453683_0044210
1448 Ga0453683_0053018
1449 Ga0466963_0024677
1450 Ga0453684_0009330
1451 Ga0453684_0015144
1452 Ga0453684_0026613
1453 Ga0453684_0027919
1454 Ga0453684_0040494
1455 Ga0453684_0061773
1456 Ga0453684_0069374
1457 Ga0453684_0128349
1458 Ga0466959_0035383
1459 Ga0451576_0013754
1460 Ga0451576_0034468
1461 Ga0451576_0044194
1462 Ga0451576_0046178
1463 Ga0451576_0065167
1464 Ga0451576_0084872
1465 Ga0451576_0191261
1466 Ga0451576_0251925
1467 Ga0466967_0001694
1468 Ga0466967_0105977
1469 Ga0495651_0000023
1470 Ga0495653_0008239
1471 Ga0495653_0084406
1472 Ga0495580_0001185
1473 Ga0495580_0003670
1474 Ga0495580_0021206
1475 Ga0495580_0197982
1476 Ga0495628_0003216
1477 Ga0495630_0050047
1478 Ga0495642_0028088
1479 Ga0495665_0004071
1480 Ga0495667_0001010
1481 Ga0495659_0028756
1482 Ga0495623_0007868
1483 Ga0495613_0012214
1484 Ga0495624_0026969
1485 Ga0495600_0018327
1486 Ga0495604_0000750
1487 Ga0495674_0077260
1488 Ga0495680_0001474
1489 Ga0495675_0027546
1490 Ga0495675_0035872
1491 Ga0495593_0003784
1492 Ga0495602_0028964
1493 Ga0495614_0021538
1494 Ga0496101_0213727
1495 Ga0496102_0003402
1496 Ga0496106_0016111
1497 Ga0496108_0046373
1498 Ga0496112_0000404
1499 Ga0496112_0060046
1500 Ga0496112_0067549
1501 Ga0501031_0014383
1502 Ga0501033_0013012
1503 Ga0501033_0042801
1504 Ga0501033_0105130
1505 Ga0501036_0003619
1506 Ga0501036_0006610
1507 Ga0501037_0001789
1508 Ga0501038_0001715
1509 Ga0501038_0015884
1510 Ga0501039_0001933
1511 Ga0501039_0029395
1512 Ga0501039_0065927
1513 Ga0501039_0095132
1514 Ga0501039_0157818
1515 Ga0501039_0174436
1516 Ga0501040_0001728
1517 Ga0501040_0029959
1518 Ga0501040_0050199
1519 Ga0501040_0071632
1520 Ga0501040_0084364
1521 Ga0501040_0122854
1522 Ga0501041_0000249
1523 Ga0501041_0003148
1524 Ga0501041_0009461
1525 Ga0501041_0037519
1526 Ga0501041_0064549
1527 Ga0501041_0115008
1528 Ga0501042_0007229
1529 Ga0501042_0030480
1530 Ga0501042_0086005
1531 Ga0501042_0117746
1532 Ga0501042_0126756
1533 Ga0501042_0212821
1534 Ga0501043_0012083
1535 Ga0501046_0000084
1536 Ga0501046_0009424
1537 Ga0501046_0063705
1538 Ga0501046_0134453
1539 Ga0501048_0000322
1540 Ga0501048_0030179
1541 Ga0501048_0073303
1542 Ga0501048_0207176
1543 Ga0501068_0006552
1544 Ga0501068_0134010
1545 Ga0501068_0188723
1546 Ga0501069_0037165
1547 Ga0501071_0000026
1548 Ga0501071_0002922
1549 Ga0501071_0056325
1550 Ga0501071_0135552
1551 Ga0501071_0174504
1552 Ga0501072_0000376
1553 Ga0501072_0023812
1554 Ga0501072_0057456
1555 Ga0501072_0105952
1556 Ga0501072_0109440
1557 Ga0501072_0119281
1558 Ga0501072_0160848
1559 Ga0501072_0188826
1560 Ga0501073_0089273
1561 Ga0501073_0102881
1562 Ga0501074_0003604
1563 Ga0501074_0044961
1564 Ga0501074_0084515
1565 Ga0501075_0000066
1566 Ga0501075_0000177
1567 Ga0501075_0019568
1568 Ga0501075_0030681
1569 Ga0501075_0043500
1570 Ga0501075_0046530
1571 Ga0501075_0055781
1572 Ga0501075_0067858
1573 Ga0501075_0078009
1574 Ga0501075_0084083
1575 Ga0501075_0110633
1576 Ga0501075_0177518
1577 Ga0501076_0000014
1578 Ga0501076_0000017
1579 Ga0501076_0004543
1580 Ga0501076_0006353
1581 Ga0501076_0010457
1582 Ga0501076_0017060
1583 Ga0501076_0024248
1584 Ga0501076_0030060
1585 Ga0501076_0042089
1586 Ga0501077_0000762
1587 Ga0501077_0012344
1588 Ga0501077_0021199
1589 Ga0501077_0034222
1590 Ga0501077_0051825
1591 Ga0501077_0078475
1592 Ga0501077_0141242
1593 Ga0501079_0000726
1594 Ga0501079_0002073
1595 Ga0501079_0027802
1596 Ga0501079_0030830
1597 Ga0501079_0038071
1598 Ga0501079_0082636
1599 Ga0501079_0094377
1600 Ga0501079_0106510
1601 Ga0501079_0126257
1602 Ga0501080_0008363
1603 Ga0501080_0026586
1604 Ga0501080_0119788
1605 Ga0501080_0162068
1606 Ga0501080_0291942
1607 Ga0501080_0452387
1608 Ga0501081_0000011
1609 Ga0501081_0015410
1610 Ga0501081_0032635
1611 Ga0501081_0051651
1612 Ga0501081_0057262
1613 Ga0501081_0092595
1614 Ga0501081_0093316
1615 Ga0501081_0144631
1616 Ga0501083_0057096
1617 Ga0501035_0022094
1618 Ga0501035_0214232
1619 Ga0501045_0000024
1620 Ga0501045_0030077
1621 Ga0501045_0076395
1622 Ga0501045_0089391
1623 nmdc:mga05p37_103804_c1
1624 nmdc:mga05p37_132169_c1
1625 nmdc:mga05p37_13925_c1
1626 nmdc:mga05p37_15583_c1
1627 nmdc:mga05p37_18193_c1
1628 nmdc:mga05p37_186738_c1
1629 nmdc:mga05p37_190869_c1
1630 nmdc:mga05p37_195033_c2
1631 nmdc:mga05p37_34529_c1
1632 nmdc:mga05p37_40828_c1
1633 nmdc:mga05p37_4961_c1
1634 nmdc:mga05p37_52015_c1
1635 nmdc:mga05p37_6146_c1
1636 nmdc:mga05p37_6225_c1
1637 nmdc:mga05p37_733_c1
1638 nmdc:mga05p37_74211_c1
1639 nmdc:mga05p37_74584_c1
1640 nmdc:mga05p37_84983_c1
1641 nmdc:mga05p37_93048_c1
1642 nmdc:mga05p37_9994_c1
1643 nmdc:mga09592_1059_c1
1644 nmdc:mga09592_149813_c1
1645 nmdc:mga09592_196959_c1
1646 nmdc:mga09592_22145_c1
1647 nmdc:mga09592_56_c1
1648 nmdc:mga09592_6184_c2
1649 nmdc:mga09592_7946_c1
1650 nmdc:mga0qj67_116001_c1
1651 nmdc:mga0qj67_14603_c1
1652 nmdc:mga0qj67_4943_c1
1653 nmdc:mga0qj67_6405_c1
1654 nmdc:mga06r32_113220_c1
1655 nmdc:mga06r32_132_c1
1656 nmdc:mga06r32_173506_c1
1657 nmdc:mga06r32_223672_c1
1658 nmdc:mga06r32_293570_c1
1659 nmdc:mga06r32_3570_c1
1660 nmdc:mga06r32_428_c1
1661 nmdc:mga06r32_57196_c1
1662 nmdc:mga06r32_96796_c1
1663 nmdc:mga08y16_37085_c1
1664 nmdc:mga08y16_800_c1
1665 nmdc:mga0n895_18199_c1
1666 nmdc:mga0n895_185088_c1
1667 nmdc:mga0n895_22917_c1
1668 nmdc:mga0n895_26_c1
1669 nmdc:mga0n895_406686_c1
1670 nmdc:mga0n895_49777_c1
1671 nmdc:mga0n895_59220_c1
1672 nmdc:mga0n895_63339_c1
1673 nmdc:mga0rr50_10942_c1
1674 nmdc:mga0rr50_17406_c1
1675 nmdc:mga0rr50_179_c1
1676 nmdc:mga0rr50_23191_c1
1677 nmdc:mga0rr50_63628_c1
1678 nmdc:mga08x19_35615_c1
1679 nmdc:mga08x19_37853_c1
1680 nmdc:mga08x19_47866_c1
1681 nmdc:mga08x19_50112_c1
1682 nmdc:mga08x19_50941_c1
1683 nmdc:mga0a205_10471_c2
1684 nmdc:mga0a205_105967_c1
1685 nmdc:mga0a205_11848_c2
1686 nmdc:mga0a205_130292_c1
1687 nmdc:mga0a205_15338_c1
1688 nmdc:mga0a205_159864_c1
1689 nmdc:mga0a205_16101_c1
1690 nmdc:mga0a205_223360_c1
1691 nmdc:mga0a205_4297_c1
1692 nmdc:mga0a205_47306_c1
1693 nmdc:mga0a205_67998_c1
1694 nmdc:mga0a205_68359_c1
1695 nmdc:mga0a205_80355_c1
1696 nmdc:mga0a205_82686_c1
1697 Ga0495612_0001701
1698 Ga0501084_0000521
1699 Ga0501084_0007454
1700 Ga0501084_0010273
1701 Ga0501084_0012673
1702 Ga0501084_0016610
1703 Ga0501084_0093629
1704 Ga0501084_0146810
1705 Ga0501084_0177959
1706 Ga0501084_0181239
1707 Ga0587066_003942
1708 Ga0587070_003308
1709 Ga0587083_0003552
1710 Ga0587109_001215
1711 Ga0587071_007491
1712 Ga0501082_0003568
1713 Ga0501082_0005422
1714 Ga0501082_0013650
1715 Ga0501082_0025458
1716 Ga0501082_0046988
1717 Ga0501082_0047767
1718 Ga0530510_0000034
1719 Ga0530510_0000045
1720 Ga0530510_0001424
1721 Ga0530510_0002079
1722 Ga0530510_0005772
1723 Ga0530510_0016985
1724 Ga0530510_0025681
1725 Ga0530510_0049211
1726 Ga0530510_0175783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01855

POR_N

Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg

45

271

0.98

PF17147

PFOR_II

Pyruvate:ferredoxin oxidoreductase core domain II

294

400

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c4i-assembly1.cif.gz_D structure of an oxalate oxidoreductase 0.9483 17 407
5c4i-assembly1.cif.gz_D structure of an oxalate oxidoreductase 0.9389 17 407
6cin-assembly1.cif.gz_B crystal structure of pyruvate:ferredoxin oxidoreductase from moorella thermoacetica 0.8862 17 404
2c3u-assembly1.cif.gz_B crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus, oxygen inhibited form 0.8843 16 406
6cin-assembly1.cif.gz_A crystal structure of pyruvate:ferredoxin oxidoreductase from moorella thermoacetica 0.8837 17 404
ID Description Score Start End Superfamily
5c4iD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9492 268 407 3.40.50.920
af_Q57715_4_255_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.933 16 266 3.40.50.970
af_Q57715_257_388_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9288 269 409 3.40.50.920
5exdG01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9265 17 266 3.40.50.970
af_Q57715_4_255_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9259 16 266 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A662QCJ1-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9749 21 120 GO:0006082
GO:0006979
GO:0016491
GO:0044272
AF-A0A7J2LK67-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9706 19 120 GO:0006082
GO:0006979
GO:0016491
GO:0044272
AF-A0A832YPW9-F1-model_v4 deleted 0.9681 19 120
AF-A0A6V8P9U7-F1-model_v4 Pyruvate ferredoxin oxidoreductase alpha subunit 0.9602 17 120 GO:0000287
GO:0006979
GO:0016491
AF-A0A6L7TUN0-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9599 15 410 GO:0006979
GO:0016491

Map