F483933
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 863 | 672 | 422 | 265 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221689|2644499791 |
| Length | 316 |
| Sequence | LPLRGRVGAKLRGGVSCGVYNRLWCSRWVTPTRRVAATSPLKGEVNERRAMFDRYIQAFDLVPDGSPVVTHSSHLLPVRWQGLPAMLKVATVSEEKRGALLMQWWDGLGAAKVYANDDDAVLLERAHGKLSLLSMAMSGDDDAASRIICGTVQTLHRPHTKPYPELVPLDIWFRALETASTIHGGAFATSHAVAKTLLDGPLETGALHGDIHHSNILDFEDRGWLAIDPKGLLGERGYDYANLFCNPDLPATKDAARLRRQLPIVAEVSGLAPERLLRWVIAYAGLSAAWFLEDEGDPAPALHVAEIAAAELGGGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 2 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 3 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 4 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 5 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 6 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 7 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 8 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 9 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 10 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 11 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 12 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 13 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 14 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 15 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 16 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 17 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 18 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 19 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 20 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 21 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 22 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 23 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 24 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 25 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 26 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 27 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 28 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 29 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 30 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 31 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 32 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 33 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 34 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 35 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 36 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 37 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 38 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 39 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 40 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 41 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 42 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 43 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 44 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 45 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 46 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 47 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 48 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 49 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 50 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 51 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 52 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 53 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 54 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 55 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 56 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 57 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 58 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 59 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 60 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 61 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 62 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 63 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 64 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 65 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 66 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 67 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 68 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 69 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 70 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 71 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 72 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 73 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 74 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 75 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 76 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 77 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 78 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 79 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 80 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 81 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 82 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 83 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 84 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 85 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 86 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 87 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 88 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 89 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 90 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 91 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 92 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 93 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 94 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 95 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 96 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 97 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 98 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 99 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 100 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 101 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 102 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 103 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 104 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 105 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 106 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 107 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 108 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 109 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 110 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 111 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 112 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 113 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 114 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 115 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 116 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 117 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 118 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 119 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 120 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 121 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 122 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 123 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 124 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 125 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 126 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 127 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 128 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 129 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 130 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 131 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 132 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 133 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 134 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 135 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 136 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 137 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 138 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 139 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 140 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 141 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 142 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 143 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 144 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 145 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 146 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 147 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 148 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 149 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 150 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 151 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 152 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 153 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 154 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 155 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 156 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 157 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 158 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 159 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 160 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 161 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 162 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 163 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 164 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 165 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 166 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 167 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 168 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 169 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 170 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 171 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 172 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 173 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 174 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 175 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 176 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 177 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 178 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 179 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 180 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 181 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 182 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 183 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 184 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 185 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 186 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 187 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 188 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 189 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 190 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 191 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 192 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 193 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 194 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 195 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 196 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 197 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 198 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 199 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 200 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 201 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 202 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 203 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 204 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 205 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 206 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 207 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 208 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 209 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 210 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 211 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 212 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 213 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 214 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 215 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 216 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 217 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 218 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 219 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 220 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 221 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 222 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 223 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 224 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 225 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 226 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 227 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 228 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 229 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 230 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 231 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 232 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 233 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 234 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 235 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 236 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 237 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 238 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 239 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 240 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 241 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 242 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 243 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 244 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 245 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 246 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 247 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 248 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 249 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 250 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 251 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 252 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 253 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 254 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 255 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 256 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 257 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 258 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 259 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 260 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 261 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 262 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 263 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 264 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 265 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 266 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 267 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 268 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 269 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 270 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 271 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 272 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 273 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 274 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 275 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 276 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 277 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 278 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 279 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 280 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 281 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 282 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 283 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 284 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 285 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 286 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 287 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 288 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 289 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 290 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 291 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 292 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 293 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 294 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 295 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 296 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 297 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 298 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 299 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 300 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 301 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 302 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 303 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 304 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 305 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 306 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 307 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 308 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 309 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 310 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 311 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 312 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 313 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 314 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 315 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 316 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 317 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 318 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 319 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 320 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 321 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 322 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 323 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 324 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 325 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 326 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 327 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 328 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 329 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 330 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 331 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 332 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 333 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 334 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 335 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 336 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 337 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 338 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 339 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 340 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 341 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 342 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 343 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 344 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 345 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 346 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 347 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 348 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 349 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 350 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 351 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 352 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 353 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 354 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 355 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 356 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 357 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 358 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 359 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 360 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 361 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 362 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 363 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 364 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 365 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 366 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 367 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 368 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 369 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 370 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 371 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 372 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 373 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 374 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 375 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 376 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 377 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 378 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 379 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 380 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 381 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 382 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 383 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 384 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 385 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 386 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 387 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 388 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 389 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 390 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 391 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 392 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 393 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 394 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 395 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 396 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 397 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 398 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 399 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 400 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 401 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 402 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 403 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 404 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 405 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 406 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 407 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 408 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 409 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 410 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 411 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 412 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 413 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 414 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 415 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 416 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 417 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 418 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 419 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 420 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 421 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 422 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 423 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 424 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 425 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 426 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 427 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 428 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 429 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 430 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 431 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 432 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 433 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 434 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 435 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 436 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 437 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 438 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 439 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 440 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 441 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 442 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 443 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 444 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 445 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 446 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 447 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 448 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 449 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 450 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 451 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 452 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 453 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 454 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 456 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 457 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 458 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 459 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 460 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 461 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 462 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 463 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 464 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 465 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 466 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 467 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 468 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 469 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 470 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 471 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 472 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 473 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 474 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 475 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 476 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 477 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 478 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 479 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 480 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 481 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 482 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 483 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 484 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 485 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 486 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 487 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 488 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 489 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 490 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 491 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 492 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 493 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 505 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 506 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 507 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 508 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 509 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 510 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 511 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 512 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 513 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 514 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 515 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 516 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 517 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 518 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 519 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 520 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 521 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 522 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 523 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 524 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 525 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 526 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 527 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 528 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 529 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 530 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 531 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 532 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 533 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 534 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 535 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 536 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 563 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 564 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 565 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 566 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 567 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 568 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 569 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 570 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 571 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 572 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 573 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 574 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 575 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 576 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 577 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 578 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 579 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 580 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 581 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 582 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 583 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 584 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 589 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 590 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 591 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 593 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 594 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 595 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 598 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 599 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 602 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 603 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 604 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 606 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 607 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 608 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 609 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 610 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 611 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 612 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 613 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 614 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 615 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 616 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 617 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 618 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 619 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 620 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 621 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 622 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 623 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 624 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 625 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 626 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 627 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 628 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 629 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 630 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 631 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 632 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 633 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 634 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 635 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 636 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 637 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 638 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 639 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 640 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 641 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 642 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 643 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 644 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 645 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 646 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 647 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 648 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 649 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 650 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 651 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 652 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 653 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 654 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 655 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 656 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 657 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 658 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 659 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 660 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 661 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 662 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 663 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 664 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 665 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 666 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 667 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 668 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 669 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 670 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 671 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
| 672 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 48.9 |
| Metatranscriptomes | 0 |
| Isolates | 51.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.73 |
| Nodule | 40.79 |
| Rhizoplane | 4.29 |
| Rhizosphere | 24.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10043393 | 3300001979 | Bacteria | 1341 |
| 2 | JGI25155J39150_1000003 | 3300002704 | Bacteria | 279666 |
| 3 | JGI25156J39149_1000004 | 3300002705 | Bacteria | 273027 |
| 4 | JGI25162J39368_1000081 | 3300002737 | Bacteria | 113016 |
| 5 | JGI25162J39368_1000165 | 3300002737 | Bacteria | 73081 |
| 6 | JGI25162J39368_1000589 | 3300002737 | Bacteria | 26498 |
| 7 | JGI25154J39366_1000013 | 3300002738 | Bacteria | 268260 |
| 8 | JGI25158J39367_1003941 | 3300002739 | Bacteria | 2251 |
| 9 | JGI25157J39369_1000004 | 3300002741 | Bacteria | 273009 |
| 10 | JGI25163J39215_1000016 | 3300002771 | Bacteria | 82638 |
| 11 | JGI25164J39214_1000060 | 3300002772 | Bacteria | 110667 |
| 12 | JGI25152J39213_1009714 | 3300002773 | Bacteria | 2262 |
| 13 | JGI25159J45721_1000029 | 3300002987 | Bacteria | 105868 |
| 14 | JGI25159J45721_1000393 | 3300002987 | Bacteria | 20327 |
| 15 | JGI25159J45721_1001256 | 3300002987 | Bacteria | 10697 |
| 16 | JGI25151J46595_10003303 | 3300003187 | Bacteria | 8955 |
| 17 | JGI25151J46595_10019917 | 3300003187 | Bacteria | 2837 |
| 18 | JGI25151J46595_10027236 | 3300003187 | Bacteria | 2295 |
| 19 | JGI25165J46597_1000068 | 3300003214 | Bacteria | 196201 |
| 20 | JGI25165J46597_1000153 | 3300003214 | Bacteria | 113016 |
| 21 | JGI25165J46597_1000233 | 3300003214 | Bacteria | 77242 |
| 22 | JGI25153J46596_10001757 | 3300003215 | Bacteria | 12850 |
| 23 | rootH1_10085227 | 3300003316 | Bacteria | 4053 |
| 24 | rootH1_10131537 | 3300003316 | Bacteria | 1645 |
| 25 | rootH2_10112232 | 3300003320 | Bacteria | 4889 |
| 26 | rootH2_10197019 | 3300003320 | Bacteria | 2075 |
| 27 | rootL2_10001966 | 3300003322 | Bacteria | 6367 |
| 28 | rootH1_10033048 | 3300003323 | Bacteria | 4594 |
| 29 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 30 | JGI25160J50197_1000011 | 3300003354 | Bacteria | 275577 |
| 31 | JGI25160J50197_1005624 | 3300003354 | Bacteria | 5193 |
| 32 | JGI25160J50197_1013799 | 3300003354 | Bacteria | 2736 |
| 33 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 34 | JGI25161J50226_1000068 | 3300003374 | Bacteria | 90522 |
| 35 | JGI25161J50226_1000152 | 3300003374 | Bacteria | 47933 |
| 36 | JGI25161J50226_1004423 | 3300003374 | Bacteria | 2942 |
| 37 | Ga0055526_1001546 | 3300003771 | Bacteria | 16285 |
| 38 | Ga0055526_1002259 | 3300003771 | Bacteria | 13165 |
| 39 | Ga0055526_1002927 | 3300003771 | Bacteria | 11210 |
| 40 | Ga0055524_1001331 | 3300003775 | Bacteria | 14401 |
| 41 | Ga0055524_1008256 | 3300003775 | Bacteria | 4339 |
| 42 | Ga0055524_1023545 | 3300003775 | Bacteria | 1980 |
| 43 | Ga0055524_1035939 | 3300003775 | Bacteria | 1342 |
| 44 | Ga0055536_1000015 | 3300003781 | Bacteria | 237585 |
| 45 | Ga0055536_1000356 | 3300003781 | Bacteria | 34069 |
| 46 | Ga0055528_1000256 | 3300003790 | Bacteria | 45159 |
| 47 | Ga0055528_1001003 | 3300003790 | Bacteria | 18727 |
| 48 | Ga0055528_1001848 | 3300003790 | Bacteria | 12070 |
| 49 | Ga0055528_1007339 | 3300003790 | Bacteria | 4888 |
| 50 | Ga0055528_1020168 | 3300003790 | Bacteria | 2174 |
| 51 | Ga0055530_10000003 | 3300003791 | Bacteria | 237585 |
| 52 | Ga0055540_1001929 | 3300003792 | Bacteria | 11588 |
| 53 | Ga0055531_10002064 | 3300003794 | Bacteria | 13842 |
| 54 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 55 | Ga0055543_1000097 | 3300004625 | Bacteria | 75364 |
| 56 | Ga0055543_1000470 | 3300004625 | Bacteria | 23657 |
| 57 | Ga0065165_1000018 | 3300005262 | Bacteria | 275082 |
| 58 | Ga0065165_1000335 | 3300005262 | Bacteria | 77037 |
| 59 | Ga0065165_1006900 | 3300005262 | Bacteria | 5770 |
| 60 | Ga0065165_1061827 | 3300005262 | Bacteria | 1023 |
| 61 | Ga0070658_10000047 | 3300005327 | Bacteria | 129483 |
| 62 | Ga0070666_10051408 | 3300005335 | Bacteria | 2775 |
| 63 | Ga0070682_100046011 | 3300005337 | Bacteria | 2707 |
| 64 | Ga0070660_100384467 | 3300005339 | Bacteria | 1159 |
| 65 | Ga0070671_100011067 | 3300005355 | Bacteria | 7243 |
| 66 | Ga0070663_100222403 | 3300005455 | Bacteria | 1483 |
| 67 | Ga0070684_100296218 | 3300005535 | Bacteria | 1484 |
| 68 | Ga0070665_100219802 | 3300005548 | Bacteria | 1900 |
| 69 | Ga0068855_100000360 | 3300005563 | Bacteria | 56448 |
| 70 | Ga0068855_100027064 | 3300005563 | Bacteria | 6860 |
| 71 | Ga0068855_100145188 | 3300005563 | Bacteria | 2702 |
| 72 | Ga0068856_100004342 | 3300005614 | Bacteria | 14127 |
| 73 | Ga0068856_100592914 | 3300005614 | Bacteria | 1129 |
| 74 | Ga0068852_100416227 | 3300005616 | Bacteria | 1325 |
| 75 | Ga0068851_10061411 | 3300005834 | Bacteria | 1926 |
| 76 | Ga0068862_100768220 | 3300005844 | Bacteria | 939 |
| 77 | Ga0081455_10410500 | 3300005937 | Bacteria | 937 |
| 78 | Ga0075365_10008493 | 3300006038 | Bacteria | 5840 |
| 79 | Ga0075368_10067142 | 3300006042 | Bacteria | 1443 |
| 80 | Ga0075363_100135800 | 3300006048 | Bacteria | 1382 |
| 81 | Ga0075362_10007517 | 3300006177 | Bacteria | 4130 |
| 82 | Ga0075367_10085089 | 3300006178 | Bacteria | 1919 |
| 83 | Ga0075369_10003366 | 3300006186 | Bacteria | 5815 |
| 84 | Ga0075369_10071718 | 3300006186 | Bacteria | 1525 |
| 85 | Ga0075366_10003422 | 3300006195 | Bacteria | 8362 |
| 86 | Ga0075370_10048128 | 3300006353 | Bacteria | 2415 |
| 87 | Ga0105251_10004448 | 3300009011 | Bacteria | 9535 |
| 88 | Ga0105240_10000014 | 3300009093 | Bacteria | 482033 |
| 89 | Ga0111539_10243148 | 3300009094 | Bacteria | 2095 |
| 90 | Ga0105243_10000310 | 3300009148 | Bacteria | 53933 |
| 91 | Ga0105243_10687524 | 3300009148 | Unclassified | 996 |
| 92 | Ga0105248_10039091 | 3300009177 | Bacteria | 5312 |
| 93 | Ga0105237_10001251 | 3300009545 | Bacteria | 33932 |
| 94 | Ga0123341_1000028 | 3300009765 | Bacteria | 69145 |
| 95 | Ga0123341_1068606 | 3300009765 | Bacteria | 1585 |
| 96 | Ga0123342_1012989 | 3300009766 | Bacteria | 8481 |
| 97 | Ga0123342_1028435 | 3300009766 | Bacteria | 3017 |
| 98 | Ga0157371_10000264 | 3300013102 | Bacteria | 71499 |
| 99 | Ga0157370_10000248 | 3300013104 | Bacteria | 68580 |
| 100 | Ga0157369_10492075 | 3300013105 | Bacteria | 1269 |
| 101 | Ga0171463_1008 | 3300013249 | Bacteria | 299022 |
| 102 | Ga0182008_10000050 | 3300014497 | Bacteria | 103527 |
| 103 | Ga0182007_10003611 | 3300015262 | Bacteria | 7256 |
| 104 | Ga0183363_1112 | 3300015690 | Bacteria | 22207 |
| 105 | Ga0213872_10092233 | 3300021361 | Bacteria | 1355 |
| 106 | Ga0228710_1000006 | 3300022740 | Bacteria | 209134 |
| 107 | Ga0209435_100006 | 3300025206 | Bacteria | 542459 |
| 108 | Ga0209760_100041 | 3300025207 | Bacteria | 115995 |
| 109 | Ga0209436_100070 | 3300025208 | Bacteria | 51558 |
| 110 | Ga0209436_100897 | 3300025208 | Bacteria | 11815 |
| 111 | Ga0207427_100104 | 3300025231 | Bacteria | 119099 |
| 112 | Ga0209437_100040 | 3300025233 | Bacteria | 448096 |
| 113 | Ga0209437_100067 | 3300025233 | Bacteria | 317685 |
| 114 | Ga0209437_100348 | 3300025233 | Bacteria | 54213 |
| 115 | Ga0207425_1001479 | 3300025245 | Bacteria | 9779 |
| 116 | Ga0209646_1000015 | 3300025246 | Bacteria | 542459 |
| 117 | Ga0209026_1000039 | 3300025250 | Bacteria | 280608 |
| 118 | Ga0209677_101078 | 3300025253 | Bacteria | 12891 |
| 119 | Ga0209759_1000005 | 3300025256 | Bacteria | 542459 |
| 120 | Ga0209129_1000252 | 3300025258 | Bacteria | 55710 |
| 121 | Ga0209129_1000341 | 3300025258 | Bacteria | 40242 |
| 122 | Ga0209129_1000454 | 3300025258 | Bacteria | 30433 |
| 123 | Ga0209129_1002985 | 3300025258 | Bacteria | 7710 |
| 124 | Ga0209129_1004740 | 3300025258 | Bacteria | 5155 |
| 125 | Ga0209233_1000051 | 3300025261 | Bacteria | 447617 |
| 126 | Ga0209233_1000088 | 3300025261 | Bacteria | 317980 |
| 127 | Ga0209233_1000148 | 3300025261 | Bacteria | 185135 |
| 128 | Ga0209233_1000202 | 3300025261 | Bacteria | 119099 |
| 129 | Ga0209565_1028280 | 3300025263 | Bacteria | 1109 |
| 130 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 131 | Ga0209673_1000025 | 3300025273 | Bacteria | 404572 |
| 132 | Ga0209673_1001232 | 3300025273 | Bacteria | 26878 |
| 133 | Ga0209673_1003248 | 3300025273 | Bacteria | 9821 |
| 134 | Ga0209673_1003720 | 3300025273 | Bacteria | 8733 |
| 135 | Ga0209673_1024752 | 3300025273 | Bacteria | 2010 |
| 136 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 137 | Ga0209130_1000020 | 3300025284 | Bacteria | 379297 |
| 138 | Ga0209130_1000029 | 3300025284 | Bacteria | 323399 |
| 139 | Ga0209676_1000017 | 3300025292 | Bacteria | 643409 |
| 140 | Ga0209676_1000438 | 3300025292 | Bacteria | 71339 |
| 141 | Ga0209676_1023377 | 3300025292 | Bacteria | 2025 |
| 142 | Ga0209025_1000033 | 3300025294 | Bacteria | 414511 |
| 143 | Ga0209025_1000091 | 3300025294 | Bacteria | 250401 |
| 144 | Ga0209025_1002551 | 3300025294 | Bacteria | 19004 |
| 145 | Ga0209025_1016097 | 3300025294 | Bacteria | 4449 |
| 146 | Ga0209025_1021964 | 3300025294 | Bacteria | 3409 |
| 147 | Ga0209564_1000275 | 3300025295 | Bacteria | 107884 |
| 148 | Ga0209564_1000588 | 3300025295 | Bacteria | 57321 |
| 149 | Ga0209564_1000644 | 3300025295 | Bacteria | 52727 |
| 150 | Ga0209564_1000883 | 3300025295 | Bacteria | 39645 |
| 151 | Ga0209564_1004772 | 3300025295 | Bacteria | 8095 |
| 152 | Ga0209564_1007448 | 3300025295 | Bacteria | 5651 |
| 153 | Ga0209564_1027103 | 3300025295 | Bacteria | 1870 |
| 154 | Ga0209758_1001217 | 3300025297 | Bacteria | 32348 |
| 155 | Ga0209758_1001396 | 3300025297 | Bacteria | 28704 |
| 156 | Ga0209758_1018413 | 3300025297 | Bacteria | 3423 |
| 157 | Ga0209758_1018414 | 3300025297 | Bacteria | 3423 |
| 158 | Ga0209758_1040880 | 3300025297 | Bacteria | 1742 |
| 159 | Ga0209050_1000076 | 3300025298 | Bacteria | 285628 |
| 160 | Ga0209050_1000516 | 3300025298 | Bacteria | 64933 |
| 161 | Ga0209256_1000218 | 3300025299 | Bacteria | 106228 |
| 162 | Ga0209256_1000924 | 3300025299 | Bacteria | 35882 |
| 163 | Ga0209256_1002389 | 3300025299 | Bacteria | 15470 |
| 164 | Ga0209256_1005850 | 3300025299 | Bacteria | 6832 |
| 165 | Ga0209256_1010630 | 3300025299 | Bacteria | 3822 |
| 166 | Ga0209256_1025141 | 3300025299 | Bacteria | 1740 |
| 167 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 168 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 169 | Ga0207426_1000074 | 3300025302 | Bacteria | 323399 |
| 170 | Ga0207426_1000218 | 3300025302 | Bacteria | 135865 |
| 171 | Ga0209051_1000050 | 3300025303 | Bacteria | 284349 |
| 172 | Ga0209051_1001494 | 3300025303 | Bacteria | 19577 |
| 173 | Ga0209051_1004736 | 3300025303 | Bacteria | 8241 |
| 174 | Ga0209051_1006706 | 3300025303 | Bacteria | 6434 |
| 175 | Ga0209257_1000569 | 3300025304 | Bacteria | 62370 |
| 176 | Ga0207705_10000052 | 3300025909 | Bacteria | 168319 |
| 177 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 178 | Ga0207671_10004383 | 3300025914 | Bacteria | 13528 |
| 179 | Ga0207644_10014715 | 3300025931 | Bacteria | 5243 |
| 180 | Ga0207709_10000280 | 3300025935 | Bacteria | 58638 |
| 181 | Ga0207661_10167251 | 3300025944 | Bacteria | 1912 |
| 182 | Ga0207667_10000430 | 3300025949 | Bacteria | 56466 |
| 183 | Ga0207667_10005189 | 3300025949 | Bacteria | 15905 |
| 184 | Ga0207667_10038463 | 3300025949 | Bacteria | 5110 |
| 185 | Ga0207668_10060610 | 3300025972 | Bacteria | 2657 |
| 186 | Ga0207668_10659881 | 3300025972 | Bacteria | 916 |
| 187 | Ga0207678_10210311 | 3300026067 | Bacteria | 1664 |
| 188 | Ga0207702_10000165 | 3300026078 | Bacteria | 79066 |
| 189 | Ga0207702_10014158 | 3300026078 | Bacteria | 6624 |
| 190 | Ga0207702_10496715 | 3300026078 | Bacteria | 1189 |
| 191 | Ga0207698_10780166 | 3300026142 | Bacteria | 956 |
| 192 | Ga0209281_1000508 | 3300027111 | Bacteria | 51432 |
| 193 | Ga0209281_1000621 | 3300027111 | Bacteria | 39698 |
| 194 | Ga0209282_1000116 | 3300027666 | Bacteria | 51432 |
| 195 | Ga0209813_10037095 | 3300027866 | Bacteria | 1467 |
| 196 | Ga0307515_10019406 | 3300028794 | Bacteria | 12244 |
| 197 | Ga0307515_10021842 | 3300028794 | Bacteria | 11320 |
| 198 | Ga0307412_10220453 | 3300031911 | Bacteria | 1454 |
| 199 | Ga0315914_1000008 | 3300031967 | Bacteria | 209133 |
| 200 | Ga0307416_100169017 | 3300032002 | Bacteria | 2033 |
| 201 | Ga0315913_1002685 | 3300033430 | Bacteria | 21084 |
| 202 | Ga0315915_1000058 | 3300033464 | Bacteria | 72461 |
| 203 | Ga0373937_0257806 | 3300036401 | Bacteria | 1644 |
| 204 | Ga0395905_0000435 | 3300037471 | Bacteria | 58317 |
| 205 | Ga0436361_0082179 | 3300039447 | Bacteria | 5869 |
| 206 | Ga0439436_0024270 | 3300041404 | Bacteria | 1791 |
| 207 | Ga0439438_007202 | 3300041405 | Bacteria | 3827 |
| 208 | Ga0451787_506080 | 3300041441 | Bacteria | 2449 |
| 209 | Ga0451789_0788741 | 3300041443 | Bacteria | 1043 |
| 210 | Ga0451807_0045927 | 3300041486 | Bacteria | 1382 |
| 211 | Ga0451833_0097459 | 3300041491 | Bacteria | 3501 |
| 212 | Ga0451833_0097858 | 3300041491 | Bacteria | 1684 |
| 213 | Ga0451835_0224880 | 3300041492 | Bacteria | 1997 |
| 214 | Ga0451835_1237521 | 3300041492 | Bacteria | 1740 |
| 215 | Ga0451837_0969126 | 3300041494 | Bacteria | 1710 |
| 216 | Ga0451839_0380119 | 3300041496 | Bacteria | 1880 |
| 217 | Ga0451841_0047569 | 3300041498 | Bacteria | 2227 |
| 218 | Ga0451847_0182853 | 3300041503 | Bacteria | 2096 |
| 219 | Ga0451849_1174138 | 3300041505 | Bacteria | 930 |
| 220 | Ga0451853_0010833 | 3300041512 | Bacteria | 2244 |
| 221 | Ga0451853_2734846 | 3300041512 | Bacteria | 3159 |
| 222 | Ga0439456_030539 | 3300042013 | Bacteria | 1153 |
| 223 | Ga0466963_0038589 | 3300044694 | Bacteria | 3124 |
| 224 | Ga0466970_0016022 | 3300044765 | Bacteria | 3860 |
| 225 | Ga0466957_0036552 | 3300044842 | Bacteria | 2953 |
| 226 | Ga0466959_0150878 | 3300045049 | Bacteria | 1638 |
| 227 | Ga0466958_0030668 | 3300045836 | Bacteria | 3195 |
| 228 | Ga0466967_0066790 | 3300045976 | Bacteria | 3206 |
| 229 | Ga0466967_0078854 | 3300045976 | Bacteria | 2968 |
| 230 | Ga0495638_0126249 | 3300046460 | Bacteria | 1507 |
| 231 | Ga0495605_0067923 | 3300046474 | Bacteria | 1690 |
| 232 | Ga0495585_0004459 | 3300046492 | Bacteria | 9076 |
| 233 | Ga0495607_0012593 | 3300046501 | Bacteria | 5574 |
| 234 | Ga0495607_0018504 | 3300046501 | Bacteria | 4440 |
| 235 | Ga0495583_0013880 | 3300046506 | Bacteria | 4467 |
| 236 | Ga0495606_0108135 | 3300046507 | Bacteria | 1681 |
| 237 | Ga0495610_0036671 | 3300046512 | Bacteria | 2503 |
| 238 | Ga0495610_0046222 | 3300046512 | Bacteria | 2149 |
| 239 | Ga0495616_0006680 | 3300046513 | Bacteria | 6962 |
| 240 | Ga0495616_0054958 | 3300046513 | Bacteria | 1973 |
| 241 | Ga0495620_0021011 | 3300046515 | Bacteria | 3177 |
| 242 | Ga0495631_0000627 | 3300046518 | Bacteria | 23229 |
| 243 | Ga0495631_0034272 | 3300046518 | Bacteria | 2277 |
| 244 | Ga0495632_0013093 | 3300046519 | Bacteria | 4750 |
| 245 | Ga0495643_0000033 | 3300046522 | Bacteria | 251940 |
| 246 | Ga0495643_0003546 | 3300046522 | Bacteria | 11343 |
| 247 | Ga0495643_0017682 | 3300046522 | Bacteria | 4162 |
| 248 | Ga0495643_0023729 | 3300046522 | Bacteria | 3484 |
| 249 | Ga0495648_0000074 | 3300046524 | Bacteria | 129886 |
| 250 | Ga0495648_0092903 | 3300046524 | Bacteria | 1684 |
| 251 | Ga0495609_0076261 | 3300046538 | Bacteria | 1469 |
| 252 | Ga0495597_0010430 | 3300046542 | Bacteria | 4544 |
| 253 | Ga0495633_0042377 | 3300046558 | Bacteria | 2162 |
| 254 | Ga0495668_0025358 | 3300046616 | Bacteria | 3369 |
| 255 | Ga0495611_0009214 | 3300046648 | Bacteria | 4167 |
| 256 | Ga0495611_0046262 | 3300046648 | Bacteria | 1951 |
| 257 | Ga0495625_0081011 | 3300046660 | Bacteria | 2260 |
| 258 | Ga0495625_0083670 | 3300046660 | Bacteria | 2217 |
| 259 | Ga0495625_0117552 | 3300046660 | Bacteria | 1812 |
| 260 | Ga0495661_0025571 | 3300046665 | Bacteria | 3812 |
| 261 | Ga0495671_0078996 | 3300046692 | Bacteria | 1613 |
| 262 | Ga0495649_0031399 | 3300046694 | Bacteria | 2929 |
| 263 | Ga0495649_0081402 | 3300046694 | Bacteria | 1731 |
| 264 | Ga0495660_0012839 | 3300046810 | Bacteria | 4859 |
| 265 | Ga0495660_0122000 | 3300046810 | Bacteria | 1317 |
| 266 | Ga0495660_0138959 | 3300046810 | Bacteria | 1211 |
| 267 | Ga0495673_0113262 | 3300047469 | Bacteria | 1082 |
| 268 | Ga0495686_0016214 | 3300047472 | Bacteria | 5058 |
| 269 | Ga0495686_0126797 | 3300047472 | Bacteria | 1517 |
| 270 | Ga0495626_0061655 | 3300048091 | Bacteria | 1705 |
| 271 | Ga0496101_0014663 | 3300048904 | Bacteria | 5272 |
| 272 | Ga0496101_0151638 | 3300048904 | Bacteria | 1773 |
| 273 | Ga0496102_0021862 | 3300048905 | Bacteria | 5662 |
| 274 | Ga0496102_0045843 | 3300048905 | Bacteria | 3969 |
| 275 | Ga0496102_0135123 | 3300048905 | Unclassified | 2311 |
| 276 | Ga0496103_0032993 | 3300048906 | Bacteria | 3162 |
| 277 | Ga0496104_0019802 | 3300048907 | Bacteria | 6161 |
| 278 | Ga0496105_0014556 | 3300048908 | Bacteria | 6263 |
| 279 | Ga0496106_0079661 | 3300048909 | Bacteria | 2515 |
| 280 | Ga0496106_0105275 | 3300048909 | Bacteria | 2192 |
| 281 | Ga0496108_0040907 | 3300048911 | Bacteria | 3867 |
| 282 | Ga0496109_0119319 | 3300048912 | Bacteria | 2456 |
| 283 | Ga0496110_0109793 | 3300048913 | Bacteria | 2477 |
| 284 | Ga0496111_0043867 | 3300048914 | Bacteria | 3215 |
| 285 | Ga0496111_0373548 | 3300048914 | Bacteria | 1055 |
| 286 | Ga0496113_0016669 | 3300048916 | Bacteria | 5080 |
| 287 | Ga0496116_0000290 | 3300048919 | Bacteria | 85274 |
| 288 | Ga0496116_0116643 | 3300048919 | Bacteria | 1555 |
| 289 | Ga0496116_0187617 | 3300048919 | Bacteria | 1098 |
| 290 | Ga0496117_0000307 | 3300048920 | Bacteria | 85437 |
| 291 | Ga0496117_0023215 | 3300048920 | Bacteria | 4952 |
| 292 | Ga0496117_0023913 | 3300048920 | Bacteria | 4851 |
| 293 | Ga0496118_0000277 | 3300048921 | Bacteria | 89996 |
| 294 | Ga0496118_0029235 | 3300048921 | Bacteria | 4626 |
| 295 | Ga0496118_0041646 | 3300048921 | Bacteria | 3633 |
| 296 | Ga0496118_0097248 | 3300048921 | Bacteria | 2004 |
| 297 | Ga0496119_0014493 | 3300048922 | Bacteria | 6161 |
| 298 | Ga0496119_0051565 | 3300048922 | Bacteria | 2528 |
| 299 | Ga0496120_0007629 | 3300048923 | Bacteria | 8017 |
| 300 | Ga0496120_0027978 | 3300048923 | Bacteria | 3461 |
| 301 | Ga0496120_0094168 | 3300048923 | Bacteria | 1595 |
| 302 | Ga0496121_0000255 | 3300048924 | Bacteria | 113201 |
| 303 | Ga0496121_0011982 | 3300048924 | Bacteria | 9533 |
| 304 | Ga0496121_0017363 | 3300048924 | Bacteria | 7357 |
| 305 | Ga0496121_0033436 | 3300048924 | Bacteria | 4652 |
| 306 | Ga0496121_0043649 | 3300048924 | Bacteria | 3879 |
| 307 | Ga0496121_0191165 | 3300048924 | Bacteria | 1467 |
| 308 | Ga0496121_0233904 | 3300048924 | Bacteria | 1285 |
| 309 | Ga0496122_0000654 | 3300048925 | Bacteria | 69918 |
| 310 | Ga0496122_0039175 | 3300048925 | Bacteria | 3782 |
| 311 | Ga0496122_0104215 | 3300048925 | Bacteria | 1885 |
| 312 | Ga0496122_0113041 | 3300048925 | Bacteria | 1775 |
| 313 | Ga0496122_0154798 | 3300048925 | Bacteria | 1408 |
| 314 | Ga0496123_0000688 | 3300048926 | Bacteria | 55759 |
| 315 | Ga0496123_0016107 | 3300048926 | Bacteria | 6091 |
| 316 | Ga0496123_0035064 | 3300048926 | Bacteria | 3582 |
| 317 | Ga0496123_0107461 | 3300048926 | Bacteria | 1605 |
| 318 | Ga0496124_0028074 | 3300048927 | Bacteria | 5037 |
| 319 | Ga0496124_0036841 | 3300048927 | Bacteria | 4260 |
| 320 | Ga0496124_0097838 | 3300048927 | Bacteria | 2382 |
| 321 | Ga0496124_0123284 | 3300048927 | Bacteria | 2068 |
| 322 | Ga0496125_0066200 | 3300048928 | Bacteria | 2857 |
| 323 | Ga0496126_0174171 | 3300048929 | Bacteria | 1831 |
| 324 | Ga0496126_0352434 | 3300048929 | Bacteria | 1203 |
| 325 | Ga0495678_060953 | 3300049459 | Bacteria | 1417 |
| 326 | Ga0495682_0094722 | 3300049460 | Bacteria | 1072 |
| 327 | Ga0501031_0008929 | 3300049568 | Bacteria | 6517 |
| 328 | Ga0501031_0247519 | 3300049568 | Bacteria | 1158 |
| 329 | Ga0501032_0001541 | 3300049569 | Bacteria | 18385 |
| 330 | Ga0501032_0007637 | 3300049569 | Bacteria | 7885 |
| 331 | Ga0501032_0013623 | 3300049569 | Bacteria | 5776 |
| 332 | Ga0501033_0000782 | 3300049570 | Bacteria | 29254 |
| 333 | Ga0501033_0009817 | 3300049570 | Bacteria | 7346 |
| 334 | Ga0501033_0226720 | 3300049570 | Bacteria | 1328 |
| 335 | Ga0501036_0001623 | 3300049572 | Bacteria | 17387 |
| 336 | Ga0501036_0006175 | 3300049572 | Bacteria | 9725 |
| 337 | Ga0501036_0044152 | 3300049572 | Bacteria | 3775 |
| 338 | Ga0501036_0049651 | 3300049572 | Bacteria | 3553 |
| 339 | Ga0501037_0008624 | 3300049573 | Bacteria | 7473 |
| 340 | Ga0501037_0040707 | 3300049573 | Bacteria | 3418 |
| 341 | Ga0501037_0112854 | 3300049573 | Bacteria | 1957 |
| 342 | Ga0501038_0001112 | 3300049574 | Bacteria | 24380 |
| 343 | Ga0501038_0002883 | 3300049574 | Bacteria | 16045 |
| 344 | Ga0501038_0017022 | 3300049574 | Bacteria | 6576 |
| 345 | Ga0501038_0023881 | 3300049574 | Bacteria | 5460 |
| 346 | Ga0501038_0034683 | 3300049574 | Bacteria | 4436 |
| 347 | Ga0501038_0055141 | 3300049574 | Bacteria | 3415 |
| 348 | Ga0501038_0106280 | 3300049574 | Bacteria | 2330 |
| 349 | Ga0501038_0114830 | 3300049574 | Unclassified | 2226 |
| 350 | Ga0501039_0005852 | 3300049575 | Bacteria | 9312 |
| 351 | Ga0501039_0027210 | 3300049575 | Bacteria | 4397 |
| 352 | Ga0501039_0036784 | 3300049575 | Bacteria | 3778 |
| 353 | Ga0501039_0079512 | 3300049575 | Bacteria | 2551 |
| 354 | Ga0501042_0244600 | 3300049578 | Bacteria | 1294 |
| 355 | Ga0501043_0007628 | 3300049579 | Bacteria | 8573 |
| 356 | Ga0501043_0037586 | 3300049579 | Bacteria | 3807 |
| 357 | Ga0501043_0090908 | 3300049579 | Bacteria | 2400 |
| 358 | Ga0501043_0112237 | 3300049579 | Bacteria | 2140 |
| 359 | Ga0501043_0298466 | 3300049579 | Bacteria | 1231 |
| 360 | Ga0501043_0302254 | 3300049579 | Bacteria | 1222 |
| 361 | Ga0501046_0007998 | 3300049580 | Bacteria | 9244 |
| 362 | Ga0501046_0012416 | 3300049580 | Bacteria | 7252 |
| 363 | Ga0501047_0045590 | 3300049581 | Bacteria | 4239 |
| 364 | Ga0501047_0151717 | 3300049581 | Bacteria | 2193 |
| 365 | Ga0501048_0016225 | 3300049582 | Bacteria | 5491 |
| 366 | Ga0501048_0080727 | 3300049582 | Bacteria | 2294 |
| 367 | Ga0501067_0005814 | 3300049583 | Bacteria | 6843 |
| 368 | Ga0501068_0001323 | 3300049584 | Bacteria | 13146 |
| 369 | Ga0501068_0017736 | 3300049584 | Bacteria | 4120 |
| 370 | Ga0501072_0005614 | 3300049588 | Bacteria | 9545 |
| 371 | Ga0501073_0005075 | 3300049589 | Bacteria | 9872 |
| 372 | Ga0501074_0004103 | 3300049590 | Bacteria | 10392 |
| 373 | Ga0501076_0023666 | 3300049592 | Bacteria | 4737 |
| 374 | Ga0501077_0066059 | 3300049593 | Unclassified | 2294 |
| 375 | Ga0501079_0002305 | 3300049741 | Bacteria | 13808 |
| 376 | Ga0501080_0029821 | 3300049742 | Bacteria | 5077 |
| 377 | Ga0501080_0043793 | 3300049742 | Bacteria | 4168 |
| 378 | Ga0501080_0073626 | 3300049742 | Bacteria | 3178 |
| 379 | Ga0501035_0000979 | 3300049822 | Bacteria | 30237 |
| 380 | Ga0501035_0005403 | 3300049822 | Bacteria | 12077 |
| 381 | Ga0501035_0061785 | 3300049822 | Bacteria | 3333 |
| 382 | Ga0501035_0208621 | 3300049822 | Bacteria | 1672 |
| 383 | Ga0501044_0000384 | 3300049823 | Bacteria | 54969 |
| 384 | Ga0501044_0005482 | 3300049823 | Bacteria | 14095 |
| 385 | Ga0501044_0033478 | 3300049823 | Bacteria | 5401 |
| 386 | Ga0501044_0071140 | 3300049823 | Bacteria | 3537 |
| 387 | Ga0501044_0194596 | 3300049823 | Bacteria | 1988 |
| 388 | Ga0501044_0219884 | 3300049823 | Bacteria | 1850 |
| 389 | Ga0501044_0352004 | 3300049823 | Bacteria | 1392 |
| 390 | Ga0501045_0000581 | 3300049824 | Bacteria | 22931 |
| 391 | Ga0501045_0305200 | 3300049824 | Bacteria | 1185 |
| 392 | nmdc:mga03683_2591_c1 | 3300050489 | Bacteria | 5645 |
| 393 | nmdc:mga03683_36703_c1 | 3300050489 | Bacteria | 1994 |
| 394 | nmdc:mga03n38_16653_c1 | 3300050490 | Bacteria | 2864 |
| 395 | nmdc:mga03n38_40727_c1 | 3300050490 | Bacteria | 2020 |
| 396 | nmdc:mga0yw44_4173_c1 | 3300050492 | Bacteria | 6571 |
| 397 | nmdc:mga0k408_12228_c1 | 3300050493 | Bacteria | 4691 |
| 398 | nmdc:mga04h51_31543_c1 | 3300050495 | Bacteria | 1675 |
| 399 | nmdc:mga07m45_3201_c1 | 3300050496 | Bacteria | 7851 |
| 400 | Ga0500578_0010727 | 3300053086 | Bacteria | 5919 |
| 401 | Ga0500556_0133097 | 3300053104 | Bacteria | 975 |
| 402 | Ga0500557_004893 | 3300053105 | Bacteria | 2871 |
| 403 | Ga0500562_014636 | 3300053108 | Bacteria | 2010 |
| 404 | Ga0500562_057034 | 3300053108 | Bacteria | 1047 |
| 405 | Ga0500569_001663 | 3300053109 | Bacteria | 4238 |
| 406 | Ga0500569_019294 | 3300053109 | Bacteria | 1772 |
| 407 | Ga0500594_0001268 | 3300053118 | Bacteria | 5482 |
| 408 | Ga0500618_002324 | 3300053125 | Bacteria | 7295 |
| 409 | Ga0500658_0006626 | 3300053134 | Bacteria | 4292 |
| 410 | Ga0500568_0001590 | 3300053139 | Bacteria | 14359 |
| 411 | Ga0500568_0003502 | 3300053139 | Bacteria | 8713 |
| 412 | Ga0500568_0013202 | 3300053139 | Bacteria | 3770 |
| 413 | Ga0500616_0007889 | 3300053153 | Bacteria | 6691 |
| 414 | Ga0500616_0009563 | 3300053153 | Bacteria | 5888 |
| 415 | Ga0500622_0003787 | 3300053156 | Bacteria | 9863 |
| 416 | Ga0500627_0015321 | 3300053158 | Bacteria | 2960 |
| 417 | Ga0500627_0036194 | 3300053158 | Bacteria | 2101 |
| 418 | Ga0500633_0000648 | 3300053160 | Bacteria | 5809 |
| 419 | Ga0500636_0107794 | 3300053177 | Bacteria | 1577 |
| 420 | Ga0500645_009303 | 3300053730 | Bacteria | 3306 |
| 421 | Ga0501084_0000733 | 3300054114 | Bacteria | 25011 |
| 422 | Ga0501082_0019608 | 3300060353 | Bacteria | 5831 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0247519 | Ga0501031_0247519_14_745 | 223 |
| 2 | 3300049823 | Ga0501044_0071140 | Ga0501044_0071140_14_745 | 223 |
| 3 | 3300005563 | Ga0068855_100027064 | Ga0068855_1000270647 | 226 |
| 4 | 3300025949 | Ga0207667_10005189 | Ga0207667_100051892 | 226 |
| 5 | 3300048920 | Ga0496117_0000307 | Ga0496117_0000307_71949_72638 | 228 |
| 6 | 3300048921 | Ga0496118_0000277 | Ga0496118_0000277_72132_72821 | 228 |
| 7 | 3300026142 | Ga0207698_10780166 | Ga0207698_107801661 | 230 |
| 8 | 3300021361 | Ga0213872_10092233 | Ga0213872_100922331 | 247 |
| 9 | 3300039447 | Ga0436361_0082179 | Ga0436361_0082179_1418_2164 | 247 |
| 10 | 3300049579 | Ga0501043_0298466 | Ga0501043_0298466_414_1217 | 247 |
| 11 | 3300002987 | JGI25159J45721_1001256 | JGI25159J45721_10012561 | 254 |
| 12 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001493 | 254 |
| 13 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_1000001264 | 254 |
| 14 | 3300004625 | Ga0055543_1000003 | Ga0055543_1000003280 | 254 |
| 15 | 3300005262 | Ga0065165_1000335 | Ga0065165_100033543 | 254 |
| 16 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003281 | 254 |
| 17 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011494 | 254 |
| 18 | 3300046522 | Ga0495643_0023729 | Ga0495643_0023729_903_1703 | 254 |
| 19 | 3300047469 | Ga0495673_0113262 | Ga0495673_0113262_212_1012 | 254 |
| 20 | 3300048923 | Ga0496120_0094168 | Ga0496120_0094168_697_1497 | 254 |
| 21 | 3300048924 | Ga0496121_0043649 | Ga0496121_0043649_56_856 | 254 |
| 22 | 3300049574 | Ga0501038_0055141 | Ga0501038_0055141_414_1247 | 257 |
| 23 | iso_pu_bacteria | 637000220 | 637321450 | 257 |
| 24 | 3300049568 | Ga0501031_0008929 | Ga0501031_0008929_3006_3854 | 258 |
| 25 | 3300049570 | Ga0501033_0226720 | Ga0501033_0226720_69_905 | 258 |
| 26 | 3300049572 | Ga0501036_0049651 | Ga0501036_0049651_2170_3006 | 258 |
| 27 | 3300049573 | Ga0501037_0040707 | Ga0501037_0040707_414_1250 | 258 |
| 28 | 3300049578 | Ga0501042_0244600 | Ga0501042_0244600_391_1227 | 258 |
| 29 | 3300049581 | Ga0501047_0045590 | Ga0501047_0045590_2846_3682 | 258 |
| 30 | 3300049582 | Ga0501048_0080727 | Ga0501048_0080727_517_1353 | 258 |
| 31 | 3300049584 | Ga0501068_0017736 | Ga0501068_0017736_2204_3040 | 258 |
| 32 | 3300049824 | Ga0501045_0000581 | Ga0501045_0000581_19384_20220 | 258 |
| 33 | 3300005327 | Ga0070658_10000047 | Ga0070658_1000004751 | 259 |
| 34 | 3300025909 | Ga0207705_10000052 | Ga0207705_1000005251 | 259 |
| 35 | 3300049569 | Ga0501032_0007637 | Ga0501032_0007637_3081_3860 | 259 |
| 36 | 3300049573 | Ga0501037_0008624 | Ga0501037_0008624_2586_3365 | 259 |
| 37 | 3300049574 | Ga0501038_0001112 | Ga0501038_0001112_19705_20484 | 259 |
| 38 | 3300049575 | Ga0501039_0005852 | Ga0501039_0005852_4682_5461 | 259 |
| 39 | 3300049579 | Ga0501043_0007628 | Ga0501043_0007628_5711_6490 | 259 |
| 40 | 3300049580 | Ga0501046_0007998 | Ga0501046_0007998_6902_7681 | 259 |
| 41 | 3300049582 | Ga0501048_0016225 | Ga0501048_0016225_1142_1921 | 259 |
| 42 | 3300049583 | Ga0501067_0005814 | Ga0501067_0005814_3897_4676 | 259 |
| 43 | 3300049584 | Ga0501068_0001323 | Ga0501068_0001323_8136_8915 | 259 |
| 44 | 3300049588 | Ga0501072_0005614 | Ga0501072_0005614_5437_6216 | 259 |
| 45 | 3300049589 | Ga0501073_0005075 | Ga0501073_0005075_3383_4162 | 259 |
| 46 | 3300049590 | Ga0501074_0004103 | Ga0501074_0004103_3903_4682 | 259 |
| 47 | 3300049592 | Ga0501076_0023666 | Ga0501076_0023666_17_796 | 259 |
| 48 | 3300049593 | Ga0501077_0066059 | Ga0501077_0066059_1388_2167 | 259 |
| 49 | 3300049741 | Ga0501079_0002305 | Ga0501079_0002305_3897_4676 | 259 |
| 50 | 3300049742 | Ga0501080_0029821 | Ga0501080_0029821_1065_1844 | 259 |
| 51 | 3300049822 | Ga0501035_0005403 | Ga0501035_0005403_9607_10386 | 259 |
| 52 | 3300049823 | Ga0501044_0005482 | Ga0501044_0005482_6086_6865 | 259 |
| 53 | 3300054114 | Ga0501084_0000733 | Ga0501084_0000733_8277_9056 | 259 |
| 54 | 3300060353 | Ga0501082_0019608 | Ga0501082_0019608_3361_4140 | 259 |
| 55 | iso_pu_bacteria | 2510065057 | 2510306219 | 259 |
| 56 | iso_pu_bacteria | 2511231052 | 2511501481 | 259 |
| 57 | iso_pu_bacteria | 2513237086 | 2513583012 | 259 |
| 58 | iso_pu_bacteria | 2513237091 | 2513617934 | 259 |
| 59 | iso_pu_bacteria | 2513237140 | 2513884920 | 259 |
| 60 | iso_pu_bacteria | 2513237143 | 2513905932 | 259 |
| 61 | iso_pu_bacteria | 2516653046 | 2516892797 | 259 |
| 62 | iso_pu_bacteria | 2524023207 | 2524453635 | 259 |
| 63 | iso_pu_bacteria | 2551306084 | 2551674227 | 259 |
| 64 | iso_pu_bacteria | 2551306084 | 2551680379 | 259 |
| 65 | iso_pu_bacteria | 2551306085 | 2551687012 | 259 |
| 66 | iso_pu_bacteria | 2551306086 | 2551694273 | 259 |
| 67 | iso_pu_bacteria | 2551306090 | 2551719896 | 259 |
| 68 | iso_pu_bacteria | 2551306092 | 2551732830 | 259 |
| 69 | iso_pu_bacteria | 2551306093 | 2551740070 | 259 |
| 70 | iso_pu_bacteria | 2855825444 | 2855825577 | 259 |
| 71 | iso_pu_bacteria | 2855839649 | 2855840954 | 259 |
| 72 | iso_pu_bacteria | 2858800743 | 2858801493 | 259 |
| 73 | iso_pu_bacteria | 2915986958 | 2915992809 | 259 |
| 74 | iso_pu_bacteria | 2915993759 | 2915994160 | 259 |
| 75 | iso_pu_bacteria | 2916000859 | 2916007488 | 259 |
| 76 | iso_pu_bacteria | 2916014648 | 2916016801 | 259 |
| 77 | iso_pu_bacteria | 2916021584 | 2916025106 | 259 |
| 78 | iso_pu_bacteria | 2916028427 | 2916029043 | 259 |
| 79 | iso_pu_bacteria | 2916035215 | 2916041699 | 259 |
| 80 | iso_pu_bacteria | 2916041962 | 2916044102 | 259 |
| 81 | iso_pu_bacteria | 2916048683 | 2916054139 | 259 |
| 82 | iso_pu_bacteria | 2916055098 | 2916061657 | 259 |
| 83 | iso_pu_bacteria | 2916068649 | 2916073570 | 259 |
| 84 | iso_pu_bacteria | 2921201388 | 2921202902 | 259 |
| 85 | iso_pu_bacteria | 2921208531 | 2921213550 | 259 |
| 86 | iso_pu_bacteria | 2921237296 | 2921239076 | 259 |
| 87 | iso_pu_bacteria | 2921244191 | 2921250382 | 259 |
| 88 | iso_pu_bacteria | 2921257292 | 2921257402 | 259 |
| 89 | iso_pu_bacteria | 2921263974 | 2921264626 | 259 |
| 90 | iso_pu_bacteria | 2921282425 | 2921283055 | 259 |
| 91 | iso_pu_bacteria | 2921289301 | 2921293243 | 259 |
| 92 | iso_pu_bacteria | 2921296804 | 2921301593 | 259 |
| 93 | iso_pu_bacteria | 2924144063 | 2924149638 | 259 |
| 94 | iso_pu_bacteria | 2924150972 | 2924156004 | 259 |
| 95 | iso_pu_bacteria | 2924158325 | 2924159028 | 259 |
| 96 | iso_pu_bacteria | 2924165586 | 2924167793 | 259 |
| 97 | iso_pu_bacteria | 2924172951 | 2924175469 | 259 |
| 98 | iso_pu_bacteria | 2924179722 | 2924182200 | 259 |
| 99 | iso_pu_bacteria | 2924186466 | 2924187574 | 259 |
| 100 | iso_pu_bacteria | 2924193448 | 2924198910 | 259 |
| 101 | iso_pu_bacteria | 2924200457 | 2924205378 | 259 |
| 102 | iso_pu_bacteria | 2924207177 | 2924213829 | 259 |
| 103 | iso_pu_bacteria | 2924214083 | 2924216554 | 259 |
| 104 | iso_pu_bacteria | 2924221636 | 2924225459 | 259 |
| 105 | iso_pu_bacteria | 2936996657 | 2936997989 | 259 |
| 106 | iso_pu_bacteria | 2937002841 | 2937007408 | 259 |
| 107 | iso_pu_bacteria | 2937009748 | 2937012624 | 259 |
| 108 | iso_pu_bacteria | 2937016420 | 2937019749 | 259 |
| 109 | iso_pu_bacteria | 2937023124 | 2937029319 | 259 |
| 110 | iso_pu_bacteria | 2937042894 | 2937044994 | 259 |
| 111 | iso_pu_bacteria | 2937049772 | 2937050515 | 259 |
| 112 | iso_pu_bacteria | 2937056579 | 2937057743 | 259 |
| 113 | iso_pu_bacteria | 2937063883 | 2937065646 | 259 |
| 114 | iso_pu_bacteria | 2937071275 | 2937076514 | 259 |
| 115 | iso_pu_bacteria | 2937091812 | 2937095896 | 259 |
| 116 | iso_pu_bacteria | 2937098957 | 2937100152 | 259 |
| 117 | iso_pu_bacteria | 2937106411 | 2937107395 | 259 |
| 118 | iso_pu_bacteria | 2937113482 | 2937118381 | 259 |
| 119 | iso_pu_bacteria | 2937119839 | 2937122394 | 259 |
| 120 | iso_pu_bacteria | 2937126314 | 2937130367 | 259 |
| 121 | iso_pu_bacteria | 2957382221 | 2957386408 | 259 |
| 122 | iso_pu_bacteria | 2957388812 | 2957389806 | 259 |
| 123 | iso_pu_bacteria | 2957395598 | 2957399935 | 259 |
| 124 | iso_pu_bacteria | 2957402308 | 2957406780 | 259 |
| 125 | iso_pu_bacteria | 2957408893 | 2957410185 | 259 |
| 126 | iso_pu_bacteria | 2957415311 | 2957420243 | 259 |
| 127 | iso_pu_bacteria | 2957422303 | 2957423444 | 259 |
| 128 | iso_pu_bacteria | 2957430029 | 2957433068 | 259 |
| 129 | iso_pu_bacteria | 2957443900 | 2957445486 | 259 |
| 130 | iso_pu_bacteria | 2957450854 | 2957453859 | 259 |
| 131 | iso_pu_bacteria | 2957457609 | 2957459770 | 259 |
| 132 | iso_pu_bacteria | 2957464669 | 2957465763 | 259 |
| 133 | iso_pu_bacteria | 2957471148 | 2957476580 | 259 |
| 134 | iso_pu_bacteria | 2957478035 | 2957478587 | 259 |
| 135 | iso_pu_bacteria | 2957484790 | 2957490061 | 259 |
| 136 | iso_pu_bacteria | 2957491536 | 2957494820 | 259 |
| 137 | iso_pu_bacteria | 2957498199 | 2957502555 | 259 |
| 138 | iso_pu_bacteria | 2957505466 | 2957511711 | 259 |
| 139 | iso_pu_bacteria | 2960584000 | 2960588904 | 259 |
| 140 | iso_pu_bacteria | 2960603979 | 2960605326 | 259 |
| 141 | iso_pu_bacteria | 2960610863 | 2960616502 | 259 |
| 142 | iso_pu_bacteria | 2960617483 | 2960618852 | 259 |
| 143 | iso_pu_bacteria | 2960624210 | 2960629636 | 259 |
| 144 | iso_pu_bacteria | 2960637947 | 2960645169 | 259 |
| 145 | iso_pu_bacteria | 2960645483 | 2960648566 | 259 |
| 146 | iso_pu_bacteria | 2960652885 | 2960655230 | 259 |
| 147 | iso_pu_bacteria | 2960660292 | 2960664190 | 259 |
| 148 | iso_pu_bacteria | 2960667422 | 2960669568 | 259 |
| 149 | iso_pu_bacteria | 2960674078 | 2960679524 | 259 |
| 150 | iso_pu_bacteria | 2960687367 | 2960688787 | 259 |
| 151 | iso_pu_bacteria | 2964607997 | 2964614069 | 259 |
| 152 | iso_pu_bacteria | 2964615318 | 2964616125 | 259 |
| 153 | iso_pu_bacteria | 2964621998 | 2964627565 | 259 |
| 154 | iso_pu_bacteria | 2964628898 | 2964632123 | 259 |
| 155 | iso_pu_bacteria | 2964636051 | 2964639282 | 259 |
| 156 | iso_pu_bacteria | 2964643177 | 2964648864 | 259 |
| 157 | iso_pu_bacteria | 2964649959 | 2964652113 | 259 |
| 158 | iso_pu_bacteria | 2964656573 | 2964662765 | 259 |
| 159 | iso_pu_bacteria | 2964663802 | 2964665070 | 259 |
| 160 | iso_pu_bacteria | 2964670856 | 2964677348 | 259 |
| 161 | iso_pu_bacteria | 2964678106 | 2964679823 | 259 |
| 162 | iso_pu_bacteria | 2964691889 | 2964694670 | 259 |
| 163 | iso_pu_bacteria | 2964698721 | 2964704111 | 259 |
| 164 | iso_pu_bacteria | 2964705432 | 2964708992 | 259 |
| 165 | iso_pu_bacteria | 2964712639 | 2964716179 | 259 |
| 166 | iso_pu_bacteria | 2964719344 | 2964724348 | 259 |
| 167 | iso_pu_bacteria | 2967664464 | 2967667102 | 259 |
| 168 | iso_pu_bacteria | 2967671571 | 2967672939 | 259 |
| 169 | iso_pu_bacteria | 2967678726 | 2967683872 | 259 |
| 170 | iso_pu_bacteria | 2967693043 | 2967693537 | 259 |
| 171 | iso_pu_bacteria | 2967706974 | 2967711680 | 259 |
| 172 | iso_pu_bacteria | 2967714385 | 2967715675 | 259 |
| 173 | iso_pu_bacteria | 2967721400 | 2967726818 | 259 |
| 174 | iso_pu_bacteria | 2967735183 | 2967736488 | 259 |
| 175 | iso_pu_bacteria | 2967742019 | 2967746917 | 259 |
| 176 | iso_pu_bacteria | 2967748971 | 2967749988 | 259 |
| 177 | iso_pu_bacteria | 2967755722 | 2967761052 | 259 |
| 178 | iso_pu_bacteria | 2967769361 | 2967770653 | 259 |
| 179 | iso_pu_bacteria | 2967775926 | 2967780835 | 259 |
| 180 | iso_pu_bacteria | 2970019648 | 2970022504 | 259 |
| 181 | iso_pu_bacteria | 2970033650 | 2970035807 | 259 |
| 182 | iso_pu_bacteria | 2970040964 | 2970041611 | 259 |
| 183 | iso_pu_bacteria | 2970047711 | 2970052500 | 259 |
| 184 | iso_pu_bacteria | 2970054988 | 2970061325 | 259 |
| 185 | iso_pu_bacteria | 2970061556 | 2970062478 | 259 |
| 186 | iso_pu_bacteria | 2970068827 | 2970070659 | 259 |
| 187 | iso_pu_bacteria | 2970076120 | 2970077353 | 259 |
| 188 | iso_pu_bacteria | 2970082768 | 2970085208 | 259 |
| 189 | iso_pu_bacteria | 2970088815 | 2970092227 | 259 |
| 190 | iso_pu_bacteria | 2970095765 | 2970102364 | 259 |
| 191 | iso_pu_bacteria | 2970102677 | 2970104213 | 259 |
| 192 | iso_pu_bacteria | 2970109326 | 2970115012 | 259 |
| 193 | iso_pu_bacteria | 2970116247 | 2970120127 | 259 |
| 194 | iso_pu_bacteria | 2970129317 | 2970130236 | 259 |
| 195 | iso_pu_bacteria | 2970136068 | 2970137153 | 259 |
| 196 | iso_pu_bacteria | 2970149975 | 2970151252 | 259 |
| 197 | iso_pu_bacteria | 2970156795 | 2970158727 | 259 |
| 198 | iso_pu_bacteria | 2970164137 | 2970170469 | 259 |
| 199 | iso_pu_bacteria | 2970170962 | 2970172137 | 259 |
| 200 | iso_pu_bacteria | 2970177841 | 2970181599 | 259 |
| 201 | iso_pu_bacteria | 2970184632 | 2970185581 | 259 |
| 202 | iso_pu_bacteria | 2970191845 | 2970193884 | 259 |
| 203 | iso_pu_bacteria | 2977516862 | 2977521155 | 259 |
| 204 | iso_pu_bacteria | 2977523885 | 2977526776 | 259 |
| 205 | iso_pu_bacteria | 2977537788 | 2977541742 | 259 |
| 206 | iso_pu_bacteria | 2977551784 | 2977554463 | 259 |
| 207 | iso_pu_bacteria | 2977558990 | 2977562605 | 259 |
| 208 | iso_pu_bacteria | 2977565890 | 2977571108 | 259 |
| 209 | iso_pu_bacteria | 2977572785 | 2977577357 | 259 |
| 210 | iso_pu_bacteria | 2977579622 | 2977583667 | 259 |
| 211 | iso_pu_bacteria | 648276728 | 648738951 | 259 |
| 212 | iso_pu_bacteria | 8003992118 | 8003993447 | 259 |
| 213 | 3300013102 | Ga0157371_10000264 | Ga0157371_1000026430 | 260 |
| 214 | iso_pu_bacteria | 8055693939 | 8055694446 | 260 |
| 215 | 3300005563 | Ga0068855_100000360 | Ga0068855_10000036064 | 261 |
| 216 | 3300005614 | Ga0068856_100592914 | Ga0068856_1005929141 | 261 |
| 217 | 3300014497 | Ga0182008_10000050 | Ga0182008_1000005030 | 261 |
| 218 | 3300025207 | Ga0209760_100041 | Ga0209760_10004130 | 261 |
| 219 | 3300025231 | Ga0207427_100104 | Ga0207427_10010456 | 261 |
| 220 | 3300025233 | Ga0209437_100348 | Ga0209437_10034819 | 261 |
| 221 | 3300025261 | Ga0209233_1000202 | Ga0209233_100020256 | 261 |
| 222 | 3300025935 | Ga0207709_10000280 | Ga0207709_1000028023 | 261 |
| 223 | 3300025949 | Ga0207667_10000430 | Ga0207667_1000043064 | 261 |
| 224 | 3300026078 | Ga0207702_10496715 | Ga0207702_104967151 | 261 |
| 225 | 3300037471 | Ga0395905_0000435 | Ga0395905_0000435_12765_13571 | 261 |
| 226 | 3300042013 | Ga0439456_030539 | Ga0439456_030539_103_918 | 261 |
| 227 | iso_pu_bacteria | 2510917030 | 2511199159 | 261 |
| 228 | iso_pu_bacteria | 2582581298 | 2585222989 | 261 |
| 229 | iso_pu_bacteria | 2585427529 | 2585545572 | 261 |
| 230 | iso_pu_bacteria | 2643221599 | 2644007129 | 261 |
| 231 | iso_pu_bacteria | 2919100787 | 2919106327 | 261 |
| 232 | iso_pu_bacteria | 3005445848 | 3005448584 | 261 |
| 233 | iso_pu_bacteria | 3005452660 | 3005454817 | 261 |
| 234 | iso_pu_bacteria | 8057798959 | 8057801576 | 261 |
| 235 | 3300041441 | Ga0451787_506080 | Ga0451787_506080_1114_1902 | 262 |
| 236 | 3300049574 | Ga0501038_0002883 | Ga0501038_0002883_3431_4270 | 262 |
| 237 | 3300049580 | Ga0501046_0012416 | Ga0501046_0012416_1212_2129 | 262 |
| 238 | iso_pu_bacteria | 2509276033 | 2509447246 | 262 |
| 239 | iso_pu_bacteria | 2510065019 | 2510134084 | 262 |
| 240 | iso_pu_bacteria | 2510461076 | 2510895510 | 262 |
| 241 | iso_pu_bacteria | 2510917022 | 2511136752 | 262 |
| 242 | iso_pu_bacteria | 2513237084 | 2513567843 | 262 |
| 243 | iso_pu_bacteria | 2513237085 | 2513577083 | 262 |
| 244 | iso_pu_bacteria | 2513237093 | 2513633250 | 262 |
| 245 | iso_pu_bacteria | 2513237103 | 2513707744 | 262 |
| 246 | iso_pu_bacteria | 2515075009 | 2515113187 | 262 |
| 247 | iso_pu_bacteria | 2515154114 | 2515645794 | 262 |
| 248 | iso_pu_bacteria | 2515154116 | 2515655218 | 262 |
| 249 | iso_pu_bacteria | 2515154134 | 2515739617 | 262 |
| 250 | iso_pu_bacteria | 2516653077 | 2517036849 | 262 |
| 251 | iso_pu_bacteria | 2516653085 | 2517077213 | 262 |
| 252 | iso_pu_bacteria | 2517093000 | 2517095961 | 262 |
| 253 | iso_pu_bacteria | 2517287029 | 2517407584 | 262 |
| 254 | iso_pu_bacteria | 2529292951 | 2530646668 | 262 |
| 255 | iso_pu_bacteria | 2554235341 | 2555671117 | 262 |
| 256 | iso_pu_bacteria | 2582581283 | 2585167362 | 262 |
| 257 | iso_pu_bacteria | 2582581294 | 2585202081 | 262 |
| 258 | iso_pu_bacteria | 2582581306 | 2585265584 | 262 |
| 259 | iso_pu_bacteria | 2582581307 | 2585271258 | 262 |
| 260 | iso_pu_bacteria | 2582581308 | 2585279196 | 262 |
| 261 | iso_pu_bacteria | 2582581315 | 2585323201 | 262 |
| 262 | iso_pu_bacteria | 2582581316 | 2585331306 | 262 |
| 263 | iso_pu_bacteria | 2582581865 | 2585388789 | 262 |
| 264 | iso_pu_bacteria | 2585427526 | 2585524640 | 262 |
| 265 | iso_pu_bacteria | 2585427527 | 2585531319 | 262 |
| 266 | iso_pu_bacteria | 2585427530 | 2585552758 | 262 |
| 267 | iso_pu_bacteria | 2585427531 | 2585559003 | 262 |
| 268 | iso_pu_bacteria | 2585427593 | 2585836281 | 262 |
| 269 | iso_pu_bacteria | 2585427609 | 2585904050 | 262 |
| 270 | iso_pu_bacteria | 2585428125 | 2587980832 | 262 |
| 271 | iso_pu_bacteria | 2599185160 | 2599358396 | 262 |
| 272 | iso_pu_bacteria | 2599185161 | 2599364734 | 262 |
| 273 | iso_pu_bacteria | 2599185162 | 2599371055 | 262 |
| 274 | iso_pu_bacteria | 2599185163 | 2599377434 | 262 |
| 275 | iso_pu_bacteria | 2599185164 | 2599383741 | 262 |
| 276 | iso_pu_bacteria | 2599185165 | 2599390008 | 262 |
| 277 | iso_pu_bacteria | 2599185166 | 2599396288 | 262 |
| 278 | iso_pu_bacteria | 2599185168 | 2599408475 | 262 |
| 279 | iso_pu_bacteria | 2599185181 | 2599465390 | 262 |
| 280 | iso_pu_bacteria | 2599185182 | 2599471697 | 262 |
| 281 | iso_pu_bacteria | 2599185186 | 2599494234 | 262 |
| 282 | iso_pu_bacteria | 2599185352 | 2600197150 | 262 |
| 283 | iso_pu_bacteria | 2599185356 | 2600211624 | 262 |
| 284 | iso_pu_bacteria | 2600255313 | 2601771780 | 262 |
| 285 | iso_pu_bacteria | 2615840624 | 2616293229 | 262 |
| 286 | iso_pu_bacteria | 2615840626 | 2616311363 | 262 |
| 287 | iso_pu_bacteria | 2617270742 | 2617383680 | 262 |
| 288 | iso_pu_bacteria | 2643221607 | 2644050313 | 262 |
| 289 | iso_pu_bacteria | 2643221618 | 2644107948 | 262 |
| 290 | iso_pu_bacteria | 2643221626 | 2644148380 | 262 |
| 291 | iso_pu_bacteria | 2643221636 | 2644204625 | 262 |
| 292 | iso_pu_bacteria | 2643221655 | 2644309342 | 262 |
| 293 | iso_pu_bacteria | 2643221659 | 2644333168 | 262 |
| 294 | iso_pu_bacteria | 2643221686 | 2644483233 | 262 |
| 295 | iso_pu_bacteria | 2643221698 | 2644545660 | 262 |
| 296 | iso_pu_bacteria | 2643221712 | 2644615284 | 262 |
| 297 | iso_pu_bacteria | 2643221723 | 2644673596 | 262 |
| 298 | iso_pu_bacteria | 2667528171 | 2671100914 | 262 |
| 299 | iso_pu_bacteria | 2718217882 | 2719181927 | 262 |
| 300 | iso_pu_bacteria | 2718217927 | 2719386539 | 262 |
| 301 | iso_pu_bacteria | 2718217997 | 2719666286 | 262 |
| 302 | iso_pu_bacteria | 2718218009 | 2719732644 | 262 |
| 303 | iso_pu_bacteria | 2718218199 | 2720492706 | 262 |
| 304 | iso_pu_bacteria | 2718218232 | 2720614176 | 262 |
| 305 | iso_pu_bacteria | 2718218233 | 2720620944 | 262 |
| 306 | iso_pu_bacteria | 2718218235 | 2720632268 | 262 |
| 307 | iso_pu_bacteria | 2718218269 | 2720775996 | 262 |
| 308 | iso_pu_bacteria | 2718218363 | 2721148018 | 262 |
| 309 | iso_pu_bacteria | 2718218365 | 2721159469 | 262 |
| 310 | iso_pu_bacteria | 2718218366 | 2721164854 | 262 |
| 311 | iso_pu_bacteria | 2718218423 | 2721400243 | 262 |
| 312 | iso_pu_bacteria | 2721755514 | 2722841024 | 262 |
| 313 | iso_pu_bacteria | 2721755556 | 2723027594 | 262 |
| 314 | iso_pu_bacteria | 2721755685 | 2723567846 | 262 |
| 315 | iso_pu_bacteria | 2721755809 | 2724039056 | 262 |
| 316 | iso_pu_bacteria | 2721755810 | 2724045400 | 262 |
| 317 | iso_pu_bacteria | 2721755819 | 2724090603 | 262 |
| 318 | iso_pu_bacteria | 2721755822 | 2724105111 | 262 |
| 319 | iso_pu_bacteria | 2721755823 | 2724110938 | 262 |
| 320 | iso_pu_bacteria | 2724679232 | 2725951142 | 262 |
| 321 | iso_pu_bacteria | 2728369352 | 2730108530 | 262 |
| 322 | iso_pu_bacteria | 2728369365 | 2730165162 | 262 |
| 323 | iso_pu_bacteria | 2728369397 | 2730299101 | 262 |
| 324 | iso_pu_bacteria | 2738541333 | 2739032968 | 262 |
| 325 | iso_pu_bacteria | 2775507266 | 2778175559 | 262 |
| 326 | iso_pu_bacteria | 2791355256 | 2793294308 | 262 |
| 327 | iso_pu_bacteria | 2791355259 | 2793315960 | 262 |
| 328 | iso_pu_bacteria | 2791355262 | 2793335348 | 262 |
| 329 | iso_pu_bacteria | 2791355263 | 2793339395 | 262 |
| 330 | iso_pu_bacteria | 2791355264 | 2793347119 | 262 |
| 331 | iso_pu_bacteria | 2791355265 | 2793351713 | 262 |
| 332 | iso_pu_bacteria | 2791355267 | 2793367764 | 262 |
| 333 | iso_pu_bacteria | 2802429605 | 2805926943 | 262 |
| 334 | iso_pu_bacteria | 2802429606 | 2805932856 | 262 |
| 335 | iso_pu_bacteria | 2802429633 | 2806045107 | 262 |
| 336 | iso_pu_bacteria | 2802429634 | 2806050099 | 262 |
| 337 | iso_pu_bacteria | 2802429635 | 2806056937 | 262 |
| 338 | iso_pu_bacteria | 2802429636 | 2806064318 | 262 |
| 339 | iso_pu_bacteria | 2802429637 | 2806071585 | 262 |
| 340 | iso_pu_bacteria | 2818991448 | 2819609267 | 262 |
| 341 | iso_pu_bacteria | 2818991453 | 2819641424 | 262 |
| 342 | iso_pu_bacteria | 2818991464 | 2819705923 | 262 |
| 343 | iso_pu_bacteria | 2838016132 | 2838021584 | 262 |
| 344 | iso_pu_bacteria | 2838022645 | 2838023724 | 262 |
| 345 | iso_pu_bacteria | 2838042994 | 2838045087 | 262 |
| 346 | iso_pu_bacteria | 2838048938 | 2838053421 | 262 |
| 347 | iso_pu_bacteria | 2838061910 | 2838065543 | 262 |
| 348 | iso_pu_bacteria | 2838068647 | 2838070020 | 262 |
| 349 | iso_pu_bacteria | 2838680041 | 2838683327 | 262 |
| 350 | iso_pu_bacteria | 2838686498 | 2838686914 | 262 |
| 351 | iso_pu_bacteria | 2838694306 | 2838697729 | 262 |
| 352 | iso_pu_bacteria | 2838707686 | 2838710845 | 262 |
| 353 | iso_pu_bacteria | 2838729681 | 2838730128 | 262 |
| 354 | iso_pu_bacteria | 2838742623 | 2838742857 | 262 |
| 355 | iso_pu_bacteria | 2841851746 | 2841852360 | 262 |
| 356 | iso_pu_bacteria | 2841864319 | 2841867084 | 262 |
| 357 | iso_pu_bacteria | 2842077413 | 2842079018 | 262 |
| 358 | iso_pu_bacteria | 2842110456 | 2842113134 | 262 |
| 359 | iso_pu_bacteria | 2842118031 | 2842118472 | 262 |
| 360 | iso_pu_bacteria | 2842156927 | 2842158182 | 262 |
| 361 | iso_pu_bacteria | 2842163707 | 2842168659 | 262 |
| 362 | iso_pu_bacteria | 2842180545 | 2842181802 | 262 |
| 363 | iso_pu_bacteria | 2842192696 | 2842198702 | 262 |
| 364 | iso_pu_bacteria | 2842198810 | 2842199238 | 262 |
| 365 | iso_pu_bacteria | 2842205361 | 2842209688 | 262 |
| 366 | iso_pu_bacteria | 2842217011 | 2842218073 | 262 |
| 367 | iso_pu_bacteria | 2842229732 | 2842230148 | 262 |
| 368 | iso_pu_bacteria | 2842237096 | 2842240383 | 262 |
| 369 | iso_pu_bacteria | 2842243621 | 2842244036 | 262 |
| 370 | iso_pu_bacteria | 2842257432 | 2842257879 | 262 |
| 371 | iso_pu_bacteria | 2842264693 | 2842270831 | 262 |
| 372 | iso_pu_bacteria | 2842271015 | 2842271548 | 262 |
| 373 | iso_pu_bacteria | 2842278818 | 2842283142 | 262 |
| 374 | iso_pu_bacteria | 2842285085 | 2842285475 | 262 |
| 375 | iso_pu_bacteria | 2842291075 | 2842292680 | 262 |
| 376 | iso_pu_bacteria | 2842298080 | 2842298109 | 262 |
| 377 | iso_pu_bacteria | 2842304105 | 2842305179 | 262 |
| 378 | iso_pu_bacteria | 2842311132 | 2842317059 | 262 |
| 379 | iso_pu_bacteria | 2842317721 | 2842320842 | 262 |
| 380 | iso_pu_bacteria | 2842357229 | 2842360291 | 262 |
| 381 | iso_pu_bacteria | 2842363717 | 2842370198 | 262 |
| 382 | iso_pu_bacteria | 2842370503 | 2842373958 | 262 |
| 383 | iso_pu_bacteria | 2842377471 | 2842379078 | 262 |
| 384 | iso_pu_bacteria | 2842384541 | 2842384982 | 262 |
| 385 | iso_pu_bacteria | 2842395702 | 2842400218 | 262 |
| 386 | iso_pu_bacteria | 2842402390 | 2842402835 | 262 |
| 387 | iso_pu_bacteria | 2842409023 | 2842409794 | 262 |
| 388 | iso_pu_bacteria | 2842415677 | 2842416443 | 262 |
| 389 | iso_pu_bacteria | 2842422224 | 2842423634 | 262 |
| 390 | iso_pu_bacteria | 2842428310 | 2842434714 | 262 |
| 391 | iso_pu_bacteria | 2842434925 | 2842441090 | 262 |
| 392 | iso_pu_bacteria | 2842441272 | 2842447708 | 262 |
| 393 | iso_pu_bacteria | 2842447887 | 2842449423 | 262 |
| 394 | iso_pu_bacteria | 2842462802 | 2842469075 | 262 |
| 395 | iso_pu_bacteria | 2842469257 | 2842475637 | 262 |
| 396 | iso_pu_bacteria | 2842495871 | 2842496622 | 262 |
| 397 | iso_pu_bacteria | 2842509118 | 2842510973 | 262 |
| 398 | iso_pu_bacteria | 2844163670 | 2844167316 | 262 |
| 399 | iso_pu_bacteria | 2844454524 | 2844458211 | 262 |
| 400 | iso_pu_bacteria | 2844665904 | 2844671667 | 262 |
| 401 | iso_pu_bacteria | 2852387548 | 2852390385 | 262 |
| 402 | iso_pu_bacteria | 2857516855 | 2857517296 | 262 |
| 403 | iso_pu_bacteria | 2917070673 | 2917074978 | 262 |
| 404 | iso_pu_bacteria | 2920822456 | 2920824470 | 262 |
| 405 | iso_pu_bacteria | 2933570622 | 2933570986 | 262 |
| 406 | iso_pu_bacteria | 2933586486 | 2933588809 | 262 |
| 407 | iso_pu_bacteria | 2933599457 | 2933600826 | 262 |
| 408 | iso_pu_bacteria | 2935353572 | 2935355034 | 262 |
| 409 | iso_pu_bacteria | 2935894831 | 2935896885 | 262 |
| 410 | iso_pu_bacteria | 2935901341 | 2935901821 | 262 |
| 411 | iso_pu_bacteria | 2936367885 | 2936371906 | 262 |
| 412 | iso_pu_bacteria | 2936375103 | 2936379741 | 262 |
| 413 | iso_pu_bacteria | 2996893221 | 2996895022 | 262 |
| 414 | iso_pu_bacteria | 639633055 | 639649308 | 262 |
| 415 | iso_pu_bacteria | 8005275841 | 8005281343 | 262 |
| 416 | iso_pu_bacteria | 8005282627 | 8005284685 | 262 |
| 417 | iso_pu_bacteria | 8005289223 | 8005295649 | 262 |
| 418 | iso_pu_bacteria | 8005301065 | 8005303259 | 262 |
| 419 | iso_pu_bacteria | 8005307578 | 8005309526 | 262 |
| 420 | iso_pu_bacteria | 8005376324 | 8005381060 | 262 |
| 421 | iso_pu_bacteria | 8005382845 | 8005388992 | 262 |
| 422 | iso_pu_bacteria | 8005395548 | 8005395976 | 262 |
| 423 | iso_pu_bacteria | 8005430974 | 8005437413 | 262 |
| 424 | iso_pu_bacteria | 8005460587 | 8005463870 | 262 |
| 425 | iso_pu_bacteria | 8005556819 | 8005556887 | 262 |
| 426 | iso_pu_bacteria | 8005563573 | 8005568129 | 262 |
| 427 | iso_pu_bacteria | 8005570704 | 8005573330 | 262 |
| 428 | iso_pu_bacteria | 8005626139 | 8005629894 | 262 |
| 429 | iso_pu_bacteria | 8005645114 | 8005649864 | 262 |
| 430 | iso_pu_bacteria | 8005688590 | 8005691968 | 262 |
| 431 | iso_pu_bacteria | 8005695170 | 8005697537 | 262 |
| 432 | iso_pu_bacteria | 8018127388 | 8018128070 | 262 |
| 433 | iso_pu_bacteria | 8018163183 | 8018164441 | 262 |
| 434 | iso_pu_bacteria | 8018176218 | 8018176921 | 262 |
| 435 | iso_pu_bacteria | 8024479707 | 8024482736 | 262 |
| 436 | iso_pu_bacteria | 8024501048 | 8024504565 | 262 |
| 437 | iso_pu_bacteria | 8046767195 | 8046771813 | 262 |
| 438 | iso_pu_bacteria | 8057575449 | 8057575571 | 262 |
| 439 | iso_pu_bacteria | 8057874678 | 8057878449 | 262 |
| 440 | 3300027111 | Ga0209281_1000621 | Ga0209281_100062119 | 263 |
| 441 | 3300031911 | Ga0307412_10220453 | Ga0307412_102204532 | 263 |
| 442 | 3300032002 | Ga0307416_100169017 | Ga0307416_1001690171 | 263 |
| 443 | 3300049823 | Ga0501044_0219884 | Ga0501044_0219884_140_1057 | 263 |
| 444 | 3300049823 | Ga0501044_0352004 | Ga0501044_0352004_398_1249 | 263 |
| 445 | iso_pu_bacteria | 2510917028 | 2511182574 | 263 |
| 446 | iso_pu_bacteria | 2513237138 | 2513869489 | 263 |
| 447 | iso_pu_bacteria | 2534681796 | 2535517011 | 263 |
| 448 | iso_pu_bacteria | 2582581867 | 2585400856 | 263 |
| 449 | iso_pu_bacteria | 2585427590 | 2585822242 | 263 |
| 450 | iso_pu_bacteria | 2599185170 | 2599417179 | 263 |
| 451 | iso_pu_bacteria | 2643221634 | 2644193655 | 263 |
| 452 | iso_pu_bacteria | 2838035591 | 2838038617 | 263 |
| 453 | iso_pu_bacteria | 2838661181 | 2838661462 | 263 |
| 454 | iso_pu_bacteria | 2923556063 | 2923559229 | 263 |
| 455 | iso_pu_bacteria | 2936381700 | 2936387495 | 263 |
| 456 | iso_pu_bacteria | 8005258706 | 8005259324 | 263 |
| 457 | iso_pu_bacteria | 8005542996 | 8005545824 | 263 |
| 458 | 3300041405 | Ga0439438_007202 | Ga0439438_007202_1766_2590 | 264 |
| 459 | iso_pu_bacteria | 2512047018 | 2512325166 | 264 |
| 460 | iso_pu_bacteria | 2582580891 | 2583793550 | 264 |
| 461 | iso_pu_bacteria | 2599185185 | 2599487863 | 264 |
| 462 | iso_pu_bacteria | 2740892503 | 2743738728 | 264 |
| 463 | iso_pu_bacteria | 2923153595 | 2923157793 | 264 |
| 464 | iso_pu_bacteria | 2984286254 | 2984288379 | 264 |
| 465 | iso_pu_bacteria | 8015687852 | 8015691864 | 264 |
| 466 | iso_pu_bacteria | 8055770955 | 8055775110 | 264 |
| 467 | 3300002773 | JGI25152J39213_1009714 | JGI25152J39213_10097142 | 265 |
| 468 | 3300002987 | JGI25159J45721_1000393 | JGI25159J45721_100039311 | 265 |
| 469 | 3300003187 | JGI25151J46595_10003303 | JGI25151J46595_100033036 | 265 |
| 470 | 3300003187 | JGI25151J46595_10019917 | JGI25151J46595_100199172 | 265 |
| 471 | 3300003187 | JGI25151J46595_10027236 | JGI25151J46595_100272362 | 265 |
| 472 | 3300003215 | JGI25153J46596_10001757 | JGI25153J46596_100017576 | 265 |
| 473 | 3300003320 | rootH2_10197019 | rootH2_101970192 | 265 |
| 474 | 3300003354 | JGI25160J50197_1013799 | JGI25160J50197_10137993 | 265 |
| 475 | 3300003374 | JGI25161J50226_1000068 | JGI25161J50226_100006867 | 265 |
| 476 | 3300003771 | Ga0055526_1001546 | Ga0055526_100154611 | 265 |
| 477 | 3300003790 | Ga0055528_1001848 | Ga0055528_10018483 | 265 |
| 478 | 3300004625 | Ga0055543_1000470 | Ga0055543_100047017 | 265 |
| 479 | 3300005262 | Ga0065165_1006900 | Ga0065165_10069003 | 265 |
| 480 | 3300005548 | Ga0070665_100219802 | Ga0070665_1002198022 | 265 |
| 481 | 3300025208 | Ga0209436_100070 | Ga0209436_10007013 | 265 |
| 482 | 3300025258 | Ga0209129_1000454 | Ga0209129_10004542 | 265 |
| 483 | 3300025258 | Ga0209129_1002985 | Ga0209129_10029853 | 265 |
| 484 | 3300025273 | Ga0209673_1003248 | Ga0209673_10032482 | 265 |
| 485 | 3300025284 | Ga0209130_1000020 | Ga0209130_1000020119 | 265 |
| 486 | 3300025294 | Ga0209025_1016097 | Ga0209025_10160973 | 265 |
| 487 | 3300025295 | Ga0209564_1000588 | Ga0209564_100058823 | 265 |
| 488 | 3300025297 | Ga0209758_1001217 | Ga0209758_10012176 | 265 |
| 489 | 3300025297 | Ga0209758_1018413 | Ga0209758_10184132 | 265 |
| 490 | 3300025297 | Ga0209758_1018414 | Ga0209758_10184142 | 265 |
| 491 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008188 | 265 |
| 492 | 3300025303 | Ga0209051_1004736 | Ga0209051_10047367 | 265 |
| 493 | 3300025972 | Ga0207668_10659881 | Ga0207668_106598811 | 265 |
| 494 | 3300046492 | Ga0495585_0004459 | Ga0495585_0004459_5473_6270 | 265 |
| 495 | 3300046501 | Ga0495607_0018504 | Ga0495607_0018504_1515_2312 | 265 |
| 496 | 3300046506 | Ga0495583_0013880 | Ga0495583_0013880_3154_3951 | 265 |
| 497 | 3300046512 | Ga0495610_0036671 | Ga0495610_0036671_815_1612 | 265 |
| 498 | 3300046513 | Ga0495616_0006680 | Ga0495616_0006680_5480_6277 | 265 |
| 499 | 3300046518 | Ga0495631_0000627 | Ga0495631_0000627_16540_17337 | 265 |
| 500 | 3300046519 | Ga0495632_0013093 | Ga0495632_0013093_1056_1853 | 265 |
| 501 | 3300046522 | Ga0495643_0017682 | Ga0495643_0017682_466_1263 | 265 |
| 502 | 3300046616 | Ga0495668_0025358 | Ga0495668_0025358_235_1032 | 265 |
| 503 | 3300046648 | Ga0495611_0009214 | Ga0495611_0009214_3101_3898 | 265 |
| 504 | 3300046694 | Ga0495649_0031399 | Ga0495649_0031399_608_1405 | 265 |
| 505 | 3300046810 | Ga0495660_0012839 | Ga0495660_0012839_1841_2638 | 265 |
| 506 | 3300048091 | Ga0495626_0061655 | Ga0495626_0061655_397_1194 | 265 |
| 507 | 3300048921 | Ga0496118_0041646 | Ga0496118_0041646_2765_3562 | 265 |
| 508 | 3300048924 | Ga0496121_0017363 | Ga0496121_0017363_4155_4952 | 265 |
| 509 | 3300048924 | Ga0496121_0191165 | Ga0496121_0191165_341_1138 | 265 |
| 510 | 3300048924 | Ga0496121_0233904 | Ga0496121_0233904_376_1173 | 265 |
| 511 | 3300048925 | Ga0496122_0039175 | Ga0496122_0039175_2772_3569 | 265 |
| 512 | 3300048925 | Ga0496122_0104215 | Ga0496122_0104215_421_1218 | 265 |
| 513 | 3300048926 | Ga0496123_0016107 | Ga0496123_0016107_2360_3157 | 265 |
| 514 | 3300048926 | Ga0496123_0107461 | Ga0496123_0107461_249_1046 | 265 |
| 515 | 3300048927 | Ga0496124_0123284 | Ga0496124_0123284_177_974 | 265 |
| 516 | 3300048929 | Ga0496126_0174171 | Ga0496126_0174171_481_1278 | 265 |
| 517 | 3300049459 | Ga0495678_060953 | Ga0495678_060953_322_1119 | 265 |
| 518 | 3300049460 | Ga0495682_0094722 | Ga0495682_0094722_205_1002 | 265 |
| 519 | 3300053104 | Ga0500556_0133097 | Ga0500556_0133097_65_862 | 265 |
| 520 | 3300053105 | Ga0500557_004893 | Ga0500557_004893_954_1751 | 265 |
| 521 | 3300053108 | Ga0500562_014636 | Ga0500562_014636_153_950 | 265 |
| 522 | 3300053108 | Ga0500562_057034 | Ga0500562_057034_240_1037 | 265 |
| 523 | 3300053109 | Ga0500569_019294 | Ga0500569_019294_65_862 | 265 |
| 524 | 3300053118 | Ga0500594_0001268 | Ga0500594_0001268_965_1762 | 265 |
| 525 | 3300053139 | Ga0500568_0001590 | Ga0500568_0001590_7643_8440 | 265 |
| 526 | 3300053139 | Ga0500568_0013202 | Ga0500568_0013202_953_1750 | 265 |
| 527 | 3300053153 | Ga0500616_0007889 | Ga0500616_0007889_150_947 | 265 |
| 528 | 3300053156 | Ga0500622_0003787 | Ga0500622_0003787_4965_5762 | 265 |
| 529 | 3300053158 | Ga0500627_0015321 | Ga0500627_0015321_103_900 | 265 |
| 530 | 3300053730 | Ga0500645_009303 | Ga0500645_009303_2162_2959 | 265 |
| 531 | iso_pu_bacteria | 2791355260 | 2793319307 | 265 |
| 532 | iso_pu_bacteria | 8019769354 | 8019775711 | 265 |
| 533 | 3300002737 | JGI25162J39368_1000081 | JGI25162J39368_100008153 | 266 |
| 534 | 3300002739 | JGI25158J39367_1003941 | JGI25158J39367_10039412 | 266 |
| 535 | 3300002771 | JGI25163J39215_1000016 | JGI25163J39215_100001618 | 266 |
| 536 | 3300002772 | JGI25164J39214_1000060 | JGI25164J39214_100006030 | 266 |
| 537 | 3300002987 | JGI25159J45721_1000029 | JGI25159J45721_100002931 | 266 |
| 538 | 3300003214 | JGI25165J46597_1000153 | JGI25165J46597_100015330 | 266 |
| 539 | 3300003316 | rootH1_10085227 | rootH1_100852274 | 266 |
| 540 | 3300003320 | rootH2_10112232 | rootH2_101122322 | 266 |
| 541 | 3300003322 | rootL2_10001966 | rootL2_100019663 | 266 |
| 542 | 3300003323 | rootH1_10033048 | rootH1_100330481 | 266 |
| 543 | 3300003354 | JGI25160J50197_1000011 | JGI25160J50197_1000011226 | 266 |
| 544 | 3300003354 | JGI25160J50197_1005624 | JGI25160J50197_10056245 | 266 |
| 545 | 3300003374 | JGI25161J50226_1000152 | JGI25161J50226_100015220 | 266 |
| 546 | 3300003374 | JGI25161J50226_1004423 | JGI25161J50226_10044232 | 266 |
| 547 | 3300003771 | Ga0055526_1002259 | Ga0055526_100225913 | 266 |
| 548 | 3300003771 | Ga0055526_1002927 | Ga0055526_10029279 | 266 |
| 549 | 3300003775 | Ga0055524_1008256 | Ga0055524_10082562 | 266 |
| 550 | 3300003775 | Ga0055524_1023545 | Ga0055524_10235452 | 266 |
| 551 | 3300003781 | Ga0055536_1000356 | Ga0055536_10003563 | 266 |
| 552 | 3300003790 | Ga0055528_1001003 | Ga0055528_100100318 | 266 |
| 553 | 3300003790 | Ga0055528_1007339 | Ga0055528_10073392 | 266 |
| 554 | 3300003790 | Ga0055528_1020168 | Ga0055528_10201682 | 266 |
| 555 | 3300003794 | Ga0055531_10002064 | Ga0055531_100020649 | 266 |
| 556 | 3300004625 | Ga0055543_1000097 | Ga0055543_100009731 | 266 |
| 557 | 3300005262 | Ga0065165_1000018 | Ga0065165_1000018226 | 266 |
| 558 | 3300005262 | Ga0065165_1061827 | Ga0065165_10618271 | 266 |
| 559 | 3300005337 | Ga0070682_100046011 | Ga0070682_1000460114 | 266 |
| 560 | 3300005339 | Ga0070660_100384467 | Ga0070660_1003844671 | 266 |
| 561 | 3300005535 | Ga0070684_100296218 | Ga0070684_1002962182 | 266 |
| 562 | 3300005563 | Ga0068855_100145188 | Ga0068855_1001451882 | 266 |
| 563 | 3300005616 | Ga0068852_100416227 | Ga0068852_1004162271 | 266 |
| 564 | 3300005834 | Ga0068851_10061411 | Ga0068851_100614112 | 266 |
| 565 | 3300005937 | Ga0081455_10410500 | Ga0081455_104105001 | 266 |
| 566 | 3300006038 | Ga0075365_10008493 | Ga0075365_100084933 | 266 |
| 567 | 3300006042 | Ga0075368_10067142 | Ga0075368_100671422 | 266 |
| 568 | 3300006177 | Ga0075362_10007517 | Ga0075362_100075173 | 266 |
| 569 | 3300006178 | Ga0075367_10085089 | Ga0075367_100850892 | 266 |
| 570 | 3300006186 | Ga0075369_10071718 | Ga0075369_100717182 | 266 |
| 571 | 3300006195 | Ga0075366_10003422 | Ga0075366_100034227 | 266 |
| 572 | 3300006353 | Ga0075370_10048128 | Ga0075370_100481282 | 266 |
| 573 | 3300009093 | Ga0105240_10000014 | Ga0105240_10000014388 | 266 |
| 574 | 3300009148 | Ga0105243_10000310 | Ga0105243_1000031021 | 266 |
| 575 | 3300009148 | Ga0105243_10687524 | Ga0105243_106875242 | 266 |
| 576 | 3300009545 | Ga0105237_10001251 | Ga0105237_100012514 | 266 |
| 577 | 3300009765 | Ga0123341_1000028 | Ga0123341_100002832 | 266 |
| 578 | 3300009766 | Ga0123342_1028435 | Ga0123342_10284352 | 266 |
| 579 | 3300013104 | Ga0157370_10000248 | Ga0157370_1000024835 | 266 |
| 580 | 3300013105 | Ga0157369_10492075 | Ga0157369_104920752 | 266 |
| 581 | 3300013249 | Ga0171463_1008 | Ga0171463_1008106 | 266 |
| 582 | 3300015262 | Ga0182007_10003611 | Ga0182007_100036116 | 266 |
| 583 | 3300015690 | Ga0183363_1112 | Ga0183363_11125 | 266 |
| 584 | 3300025208 | Ga0209436_100897 | Ga0209436_1008976 | 266 |
| 585 | 3300025245 | Ga0207425_1001479 | Ga0207425_10014793 | 266 |
| 586 | 3300025253 | Ga0209677_101078 | Ga0209677_1010782 | 266 |
| 587 | 3300025258 | Ga0209129_1004740 | Ga0209129_10047405 | 266 |
| 588 | 3300025261 | Ga0209233_1000148 | Ga0209233_10001487 | 266 |
| 589 | 3300025263 | Ga0209565_1028280 | Ga0209565_10282802 | 266 |
| 590 | 3300025273 | Ga0209673_1000025 | Ga0209673_1000025306 | 266 |
| 591 | 3300025273 | Ga0209673_1001232 | Ga0209673_10012323 | 266 |
| 592 | 3300025284 | Ga0209130_1000029 | Ga0209130_100002930 | 266 |
| 593 | 3300025292 | Ga0209676_1000438 | Ga0209676_100043833 | 266 |
| 594 | 3300025294 | Ga0209025_1000033 | Ga0209025_1000033167 | 266 |
| 595 | 3300025294 | Ga0209025_1000091 | Ga0209025_100009131 | 266 |
| 596 | 3300025295 | Ga0209564_1000275 | Ga0209564_100027569 | 266 |
| 597 | 3300025295 | Ga0209564_1000644 | Ga0209564_100064459 | 266 |
| 598 | 3300025295 | Ga0209564_1000883 | Ga0209564_100088331 | 266 |
| 599 | 3300025297 | Ga0209758_1001396 | Ga0209758_10013964 | 266 |
| 600 | 3300025298 | Ga0209050_1000516 | Ga0209050_100051631 | 266 |
| 601 | 3300025299 | Ga0209256_1000924 | Ga0209256_100092411 | 266 |
| 602 | 3300025299 | Ga0209256_1005850 | Ga0209256_10058506 | 266 |
| 603 | 3300025302 | Ga0207426_1000074 | Ga0207426_1000074267 | 266 |
| 604 | 3300025302 | Ga0207426_1000218 | Ga0207426_100021881 | 266 |
| 605 | 3300025303 | Ga0209051_1001494 | Ga0209051_100149414 | 266 |
| 606 | 3300025303 | Ga0209051_1006706 | Ga0209051_10067063 | 266 |
| 607 | 3300025304 | Ga0209257_1000569 | Ga0209257_100056923 | 266 |
| 608 | 3300025913 | Ga0207695_10000037 | Ga0207695_10000037390 | 266 |
| 609 | 3300025914 | Ga0207671_10004383 | Ga0207671_100043836 | 266 |
| 610 | 3300025944 | Ga0207661_10167251 | Ga0207661_101672513 | 266 |
| 611 | 3300025949 | Ga0207667_10038463 | Ga0207667_100384633 | 266 |
| 612 | 3300027866 | Ga0209813_10037095 | Ga0209813_100370952 | 266 |
| 613 | 3300028794 | Ga0307515_10021842 | Ga0307515_1002184211 | 266 |
| 614 | 3300041443 | Ga0451789_0788741 | Ga0451789_0788741_188_988 | 266 |
| 615 | 3300041486 | Ga0451807_0045927 | Ga0451807_0045927_181_981 | 266 |
| 616 | 3300041491 | Ga0451833_0097459 | Ga0451833_0097459_372_1172 | 266 |
| 617 | 3300041491 | Ga0451833_0097858 | Ga0451833_0097858_537_1337 | 266 |
| 618 | 3300041492 | Ga0451835_0224880 | Ga0451835_0224880_519_1319 | 266 |
| 619 | 3300041492 | Ga0451835_1237521 | Ga0451835_1237521_111_911 | 266 |
| 620 | 3300041494 | Ga0451837_0969126 | Ga0451837_0969126_745_1545 | 266 |
| 621 | 3300041496 | Ga0451839_0380119 | Ga0451839_0380119_453_1253 | 266 |
| 622 | 3300041498 | Ga0451841_0047569 | Ga0451841_0047569_654_1454 | 266 |
| 623 | 3300041503 | Ga0451847_0182853 | Ga0451847_0182853_351_1151 | 266 |
| 624 | 3300041505 | Ga0451849_1174138 | Ga0451849_1174138_111_911 | 266 |
| 625 | 3300041512 | Ga0451853_0010833 | Ga0451853_0010833_484_1284 | 266 |
| 626 | 3300041512 | Ga0451853_2734846 | Ga0451853_2734846_1041_1841 | 266 |
| 627 | 3300046460 | Ga0495638_0126249 | Ga0495638_0126249_309_1109 | 266 |
| 628 | 3300046474 | Ga0495605_0067923 | Ga0495605_0067923_203_1003 | 266 |
| 629 | 3300046501 | Ga0495607_0012593 | Ga0495607_0012593_1777_2577 | 266 |
| 630 | 3300046507 | Ga0495606_0108135 | Ga0495606_0108135_92_892 | 266 |
| 631 | 3300046512 | Ga0495610_0046222 | Ga0495610_0046222_448_1248 | 266 |
| 632 | 3300046513 | Ga0495616_0054958 | Ga0495616_0054958_133_933 | 266 |
| 633 | 3300046515 | Ga0495620_0021011 | Ga0495620_0021011_667_1467 | 266 |
| 634 | 3300046518 | Ga0495631_0034272 | Ga0495631_0034272_223_1023 | 266 |
| 635 | 3300046522 | Ga0495643_0003546 | Ga0495643_0003546_3112_3912 | 266 |
| 636 | 3300046524 | Ga0495648_0092903 | Ga0495648_0092903_362_1162 | 266 |
| 637 | 3300046538 | Ga0495609_0076261 | Ga0495609_0076261_590_1390 | 266 |
| 638 | 3300046542 | Ga0495597_0010430 | Ga0495597_0010430_3373_4173 | 266 |
| 639 | 3300046648 | Ga0495611_0046262 | Ga0495611_0046262_1081_1881 | 266 |
| 640 | 3300046660 | Ga0495625_0083670 | Ga0495625_0083670_284_1084 | 266 |
| 641 | 3300046660 | Ga0495625_0117552 | Ga0495625_0117552_702_1502 | 266 |
| 642 | 3300046692 | Ga0495671_0078996 | Ga0495671_0078996_800_1600 | 266 |
| 643 | 3300046694 | Ga0495649_0081402 | Ga0495649_0081402_724_1524 | 266 |
| 644 | 3300046810 | Ga0495660_0122000 | Ga0495660_0122000_66_866 | 266 |
| 645 | 3300046810 | Ga0495660_0138959 | Ga0495660_0138959_52_852 | 266 |
| 646 | 3300047472 | Ga0495686_0016214 | Ga0495686_0016214_3358_4158 | 266 |
| 647 | 3300048904 | Ga0496101_0014663 | Ga0496101_0014663_3525_4328 | 266 |
| 648 | 3300048905 | Ga0496102_0021862 | Ga0496102_0021862_1462_2265 | 266 |
| 649 | 3300048905 | Ga0496102_0135123 | Ga0496102_0135123_1185_1997 | 266 |
| 650 | 3300048906 | Ga0496103_0032993 | Ga0496103_0032993_1208_2011 | 266 |
| 651 | 3300048909 | Ga0496106_0105275 | Ga0496106_0105275_677_1480 | 266 |
| 652 | 3300048914 | Ga0496111_0373548 | Ga0496111_0373548_100_909 | 266 |
| 653 | 3300048916 | Ga0496113_0016669 | Ga0496113_0016669_1608_2411 | 266 |
| 654 | 3300048919 | Ga0496116_0000290 | Ga0496116_0000290_49512_50315 | 266 |
| 655 | 3300048919 | Ga0496116_0187617 | Ga0496116_0187617_27_830 | 266 |
| 656 | 3300048920 | Ga0496117_0023215 | Ga0496117_0023215_725_1528 | 266 |
| 657 | 3300048920 | Ga0496117_0023913 | Ga0496117_0023913_1005_1808 | 266 |
| 658 | 3300048921 | Ga0496118_0029235 | Ga0496118_0029235_1005_1808 | 266 |
| 659 | 3300048922 | Ga0496119_0014493 | Ga0496119_0014493_1595_2398 | 266 |
| 660 | 3300048923 | Ga0496120_0007629 | Ga0496120_0007629_2819_3622 | 266 |
| 661 | 3300048924 | Ga0496121_0000255 | Ga0496121_0000255_35528_36331 | 266 |
| 662 | 3300048924 | Ga0496121_0011982 | Ga0496121_0011982_4805_5608 | 266 |
| 663 | 3300048925 | Ga0496122_0000654 | Ga0496122_0000654_35800_36603 | 266 |
| 664 | 3300048925 | Ga0496122_0113041 | Ga0496122_0113041_261_1064 | 266 |
| 665 | 3300048926 | Ga0496123_0000688 | Ga0496123_0000688_31150_31953 | 266 |
| 666 | 3300048927 | Ga0496124_0028074 | Ga0496124_0028074_2954_3757 | 266 |
| 667 | 3300048929 | Ga0496126_0352434 | Ga0496126_0352434_374_1177 | 266 |
| 668 | 3300049572 | Ga0501036_0044152 | Ga0501036_0044152_339_1139 | 266 |
| 669 | 3300049573 | Ga0501037_0112854 | Ga0501037_0112854_1028_1828 | 266 |
| 670 | 3300049574 | Ga0501038_0034683 | Ga0501038_0034683_2181_2981 | 266 |
| 671 | 3300049575 | Ga0501039_0036784 | Ga0501039_0036784_2832_3632 | 266 |
| 672 | 3300049742 | Ga0501080_0043793 | Ga0501080_0043793_1272_2072 | 266 |
| 673 | 3300050489 | nmdc:mga03683_2591_c1 | nmdc:mga03683_2591_c1_1164_1964 | 266 |
| 674 | 3300050489 | nmdc:mga03683_36703_c1 | nmdc:mga03683_36703_c1_681_1481 | 266 |
| 675 | 3300050490 | nmdc:mga03n38_16653_c1 | nmdc:mga03n38_16653_c1_1235_2035 | 266 |
| 676 | 3300050490 | nmdc:mga03n38_40727_c1 | nmdc:mga03n38_40727_c1_846_1646 | 266 |
| 677 | 3300050492 | nmdc:mga0yw44_4173_c1 | nmdc:mga0yw44_4173_c1_2092_2892 | 266 |
| 678 | 3300050493 | nmdc:mga0k408_12228_c1 | nmdc:mga0k408_12228_c1_1024_1824 | 266 |
| 679 | 3300050495 | nmdc:mga04h51_31543_c1 | nmdc:mga04h51_31543_c1_720_1520 | 266 |
| 680 | 3300050496 | nmdc:mga07m45_3201_c1 | nmdc:mga07m45_3201_c1_3485_4285 | 266 |
| 681 | 3300053086 | Ga0500578_0010727 | Ga0500578_0010727_4635_5435 | 266 |
| 682 | 3300053109 | Ga0500569_001663 | Ga0500569_001663_931_1731 | 266 |
| 683 | 3300053125 | Ga0500618_002324 | Ga0500618_002324_3440_4243 | 266 |
| 684 | 3300053153 | Ga0500616_0009563 | Ga0500616_0009563_4677_5477 | 266 |
| 685 | 3300053158 | Ga0500627_0036194 | Ga0500627_0036194_1187_1987 | 266 |
| 686 | 3300053177 | Ga0500636_0107794 | Ga0500636_0107794_755_1558 | 266 |
| 687 | iso_pu_bacteria | 2512875026 | 2512971767 | 266 |
| 688 | iso_pu_bacteria | 2513237089 | 2513605242 | 266 |
| 689 | iso_pu_bacteria | 2513237160 | 2514005315 | 266 |
| 690 | iso_pu_bacteria | 2517487022 | 2517569573 | 266 |
| 691 | iso_pu_bacteria | 2802428858 | 2802718765 | 266 |
| 692 | iso_pu_bacteria | 2802428859 | 2802726378 | 266 |
| 693 | iso_pu_bacteria | 2802428860 | 2802732917 | 266 |
| 694 | iso_pu_bacteria | 2802428861 | 2802738273 | 266 |
| 695 | iso_pu_bacteria | 2802428862 | 2802744606 | 266 |
| 696 | iso_pu_bacteria | 2802428863 | 2802751188 | 266 |
| 697 | iso_pu_bacteria | 2915980308 | 2915985319 | 266 |
| 698 | iso_pu_bacteria | 2916061851 | 2916062338 | 266 |
| 699 | iso_pu_bacteria | 2921250672 | 2921253963 | 266 |
| 700 | iso_pu_bacteria | 2937029754 | 2937032673 | 266 |
| 701 | iso_pu_bacteria | 2937036028 | 2937042391 | 266 |
| 702 | iso_pu_bacteria | 2937078374 | 2937082613 | 266 |
| 703 | iso_pu_bacteria | 2957375807 | 2957379397 | 266 |
| 704 | iso_pu_bacteria | 2957437181 | 2957440550 | 266 |
| 705 | iso_pu_bacteria | 2960591022 | 2960596255 | 266 |
| 706 | iso_pu_bacteria | 2960631154 | 2960632671 | 266 |
| 707 | iso_pu_bacteria | 2960680706 | 2960686950 | 266 |
| 708 | iso_pu_bacteria | 2967686174 | 2967687250 | 266 |
| 709 | iso_pu_bacteria | 2967728569 | 2967734392 | 266 |
| 710 | iso_pu_bacteria | 2970026789 | 2970029276 | 266 |
| 711 | iso_pu_bacteria | 2970122695 | 2970126932 | 266 |
| 712 | iso_pu_bacteria | 2970143518 | 2970147699 | 266 |
| 713 | iso_pu_bacteria | 2977530762 | 2977535727 | 266 |
| 714 | iso_pu_bacteria | 2977544691 | 2977550466 | 266 |
| 715 | iso_pu_bacteria | 8003999396 | 8004000708 | 266 |
| 716 | 3300003775 | Ga0055524_1035939 | Ga0055524_10359391 | 267 |
| 717 | 3300005335 | Ga0070666_10051408 | Ga0070666_100514083 | 267 |
| 718 | 3300005355 | Ga0070671_100011067 | Ga0070671_1000110672 | 267 |
| 719 | 3300005455 | Ga0070663_100222403 | Ga0070663_1002224031 | 267 |
| 720 | 3300005844 | Ga0068862_100768220 | Ga0068862_1007682201 | 267 |
| 721 | 3300006186 | Ga0075369_10003366 | Ga0075369_100033662 | 267 |
| 722 | 3300009011 | Ga0105251_10004448 | Ga0105251_100044484 | 267 |
| 723 | 3300009177 | Ga0105248_10039091 | Ga0105248_100390912 | 267 |
| 724 | 3300009765 | Ga0123341_1068606 | Ga0123341_10686062 | 267 |
| 725 | 3300009766 | Ga0123342_1012989 | Ga0123342_10129897 | 267 |
| 726 | 3300022740 | Ga0228710_1000006 | Ga0228710_1000006186 | 267 |
| 727 | 3300025258 | Ga0209129_1000341 | Ga0209129_100034131 | 267 |
| 728 | 3300025273 | Ga0209673_1003720 | Ga0209673_10037204 | 267 |
| 729 | 3300025273 | Ga0209673_1024752 | Ga0209673_10247522 | 267 |
| 730 | 3300025294 | Ga0209025_1021964 | Ga0209025_10219643 | 267 |
| 731 | 3300025295 | Ga0209564_1004772 | Ga0209564_10047725 | 267 |
| 732 | 3300025295 | Ga0209564_1027103 | Ga0209564_10271032 | 267 |
| 733 | 3300025297 | Ga0209758_1040880 | Ga0209758_10408802 | 267 |
| 734 | 3300025299 | Ga0209256_1010630 | Ga0209256_10106302 | 267 |
| 735 | 3300025299 | Ga0209256_1025141 | Ga0209256_10251412 | 267 |
| 736 | 3300025931 | Ga0207644_10014715 | Ga0207644_100147155 | 267 |
| 737 | 3300025972 | Ga0207668_10060610 | Ga0207668_100606102 | 267 |
| 738 | 3300026067 | Ga0207678_10210311 | Ga0207678_102103112 | 267 |
| 739 | 3300027111 | Ga0209281_1000508 | Ga0209281_10005085 | 267 |
| 740 | 3300027666 | Ga0209282_1000116 | Ga0209282_10001165 | 267 |
| 741 | 3300028794 | Ga0307515_10019406 | Ga0307515_1001940612 | 267 |
| 742 | 3300031967 | Ga0315914_1000008 | Ga0315914_1000008185 | 267 |
| 743 | 3300033430 | Ga0315913_1002685 | Ga0315913_10026854 | 267 |
| 744 | 3300033464 | Ga0315915_1000058 | Ga0315915_100005820 | 267 |
| 745 | 3300041404 | Ga0439436_0024270 | Ga0439436_0024270_824_1627 | 267 |
| 746 | 3300046558 | Ga0495633_0042377 | Ga0495633_0042377_680_1483 | 267 |
| 747 | 3300046660 | Ga0495625_0081011 | Ga0495625_0081011_1288_2091 | 267 |
| 748 | 3300046665 | Ga0495661_0025571 | Ga0495661_0025571_1133_1936 | 267 |
| 749 | 3300047472 | Ga0495686_0126797 | Ga0495686_0126797_96_899 | 267 |
| 750 | 3300048904 | Ga0496101_0151638 | Ga0496101_0151638_88_891 | 267 |
| 751 | 3300048905 | Ga0496102_0045843 | Ga0496102_0045843_976_1779 | 267 |
| 752 | 3300048907 | Ga0496104_0019802 | Ga0496104_0019802_2196_2999 | 267 |
| 753 | 3300048908 | Ga0496105_0014556 | Ga0496105_0014556_4164_4967 | 267 |
| 754 | 3300048909 | Ga0496106_0079661 | Ga0496106_0079661_959_1762 | 267 |
| 755 | 3300048911 | Ga0496108_0040907 | Ga0496108_0040907_2210_3013 | 267 |
| 756 | 3300048912 | Ga0496109_0119319 | Ga0496109_0119319_727_1530 | 267 |
| 757 | 3300048913 | Ga0496110_0109793 | Ga0496110_0109793_838_1641 | 267 |
| 758 | 3300048914 | Ga0496111_0043867 | Ga0496111_0043867_899_1702 | 267 |
| 759 | 3300048919 | Ga0496116_0116643 | Ga0496116_0116643_577_1380 | 267 |
| 760 | 3300048921 | Ga0496118_0097248 | Ga0496118_0097248_600_1403 | 267 |
| 761 | 3300048924 | Ga0496121_0033436 | Ga0496121_0033436_1601_2404 | 267 |
| 762 | 3300048926 | Ga0496123_0035064 | Ga0496123_0035064_951_1754 | 267 |
| 763 | 3300048927 | Ga0496124_0036841 | Ga0496124_0036841_603_1406 | 267 |
| 764 | 3300048927 | Ga0496124_0097838 | Ga0496124_0097838_1520_2356 | 267 |
| 765 | 3300049569 | Ga0501032_0001541 | Ga0501032_0001541_4036_4953 | 267 |
| 766 | 3300049570 | Ga0501033_0009817 | Ga0501033_0009817_2729_3646 | 267 |
| 767 | 3300049572 | Ga0501036_0006175 | Ga0501036_0006175_2528_3445 | 267 |
| 768 | 3300049574 | Ga0501038_0017022 | Ga0501038_0017022_291_1208 | 267 |
| 769 | 3300049575 | Ga0501039_0027210 | Ga0501039_0027210_177_1094 | 267 |
| 770 | 3300049579 | Ga0501043_0037586 | Ga0501043_0037586_1289_2206 | 267 |
| 771 | 3300049742 | Ga0501080_0073626 | Ga0501080_0073626_888_1691 | 267 |
| 772 | 3300049822 | Ga0501035_0000979 | Ga0501035_0000979_12551_13468 | 267 |
| 773 | 3300049824 | Ga0501045_0305200 | Ga0501045_0305200_73_990 | 267 |
| 774 | 3300003781 | Ga0055536_1000015 | Ga0055536_10000159 | 268 |
| 775 | 3300003791 | Ga0055530_10000003 | Ga0055530_100000039 | 268 |
| 776 | 3300003792 | Ga0055540_1001929 | Ga0055540_100192910 | 268 |
| 777 | 3300025292 | Ga0209676_1000017 | Ga0209676_100001751 | 268 |
| 778 | 3300025298 | Ga0209050_1000076 | Ga0209050_100007651 | 268 |
| 779 | 3300025303 | Ga0209051_1000050 | Ga0209051_1000050181 | 268 |
| 780 | 3300053134 | Ga0500658_0006626 | Ga0500658_0006626_1873_2679 | 268 |
| 781 | 3300053139 | Ga0500568_0003502 | Ga0500568_0003502_3816_4622 | 268 |
| 782 | 3300053160 | Ga0500633_0000648 | Ga0500633_0000648_1535_2341 | 268 |
| 783 | 3300005614 | Ga0068856_100004342 | Ga0068856_10000434210 | 269 |
| 784 | 3300026078 | Ga0207702_10000165 | Ga0207702_1000016556 | 269 |
| 785 | 3300046522 | Ga0495643_0000033 | Ga0495643_0000033_1832_2740 | 269 |
| 786 | 3300046524 | Ga0495648_0000074 | Ga0495648_0000074_107978_108796 | 269 |
| 787 | 3300049569 | Ga0501032_0013623 | Ga0501032_0013623_2552_3391 | 269 |
| 788 | 3300049570 | Ga0501033_0000782 | Ga0501033_0000782_16785_17624 | 269 |
| 789 | 3300049572 | Ga0501036_0001623 | Ga0501036_0001623_4916_5749 | 269 |
| 790 | 3300049574 | Ga0501038_0023881 | Ga0501038_0023881_2423_3256 | 269 |
| 791 | 3300049574 | Ga0501038_0106280 | Ga0501038_0106280_211_1050 | 269 |
| 792 | 3300049575 | Ga0501039_0079512 | Ga0501039_0079512_681_1520 | 269 |
| 793 | 3300049579 | Ga0501043_0090908 | Ga0501043_0090908_232_1071 | 269 |
| 794 | 3300049579 | Ga0501043_0112237 | Ga0501043_0112237_855_1688 | 269 |
| 795 | 3300049581 | Ga0501047_0151717 | Ga0501047_0151717_859_1698 | 269 |
| 796 | 3300049822 | Ga0501035_0061785 | Ga0501035_0061785_2108_2944 | 269 |
| 797 | 3300049822 | Ga0501035_0208621 | Ga0501035_0208621_117_950 | 269 |
| 798 | 3300049823 | Ga0501044_0000384 | Ga0501044_0000384_21918_22751 | 269 |
| 799 | 3300049823 | Ga0501044_0033478 | Ga0501044_0033478_584_1423 | 269 |
| 800 | iso_pu_bacteria | 2585427608 | 2585898382 | 269 |
| 801 | 3300003316 | rootH1_10131537 | rootH1_101315372 | 270 |
| 802 | 3300003790 | Ga0055528_1000256 | Ga0055528_100025619 | 270 |
| 803 | 3300006048 | Ga0075363_100135800 | Ga0075363_1001358002 | 270 |
| 804 | 3300009094 | Ga0111539_10243148 | Ga0111539_102431481 | 270 |
| 805 | 3300025258 | Ga0209129_1000252 | Ga0209129_100025249 | 270 |
| 806 | 3300025273 | Ga0209673_1000010 | Ga0209673_1000010378 | 270 |
| 807 | 3300025292 | Ga0209676_1023377 | Ga0209676_10233772 | 270 |
| 808 | 3300025294 | Ga0209025_1002551 | Ga0209025_100255113 | 270 |
| 809 | 3300025295 | Ga0209564_1007448 | Ga0209564_10074484 | 270 |
| 810 | 3300025299 | Ga0209256_1002389 | Ga0209256_100238913 | 270 |
| 811 | iso_pu_bacteria | 2524023209 | 2524458761 | 270 |
| 812 | iso_pu_bacteria | 2615840698 | 2616552262 | 270 |
| 813 | iso_pu_bacteria | 2667528174 | 2671114209 | 270 |
| 814 | iso_pu_bacteria | 2842475841 | 2842477026 | 270 |
| 815 | iso_pu_bacteria | 2842502639 | 2842503823 | 270 |
| 816 | iso_pu_bacteria | 2919408235 | 2919412466 | 270 |
| 817 | iso_pu_bacteria | 3005416602 | 3005416786 | 270 |
| 818 | iso_pu_bacteria | 8005314921 | 8005320567 | 270 |
| 819 | iso_pu_bacteria | 8005484373 | 8005487585 | 270 |
| 820 | iso_pu_bacteria | 8005682033 | 8005684202 | 270 |
| 821 | 3300003775 | Ga0055524_1001331 | Ga0055524_10013317 | 271 |
| 822 | 3300025299 | Ga0209256_1000218 | Ga0209256_1000218104 | 271 |
| 823 | 3300049574 | Ga0501038_0114830 | Ga0501038_0114830_1023_1931 | 271 |
| 824 | 3300049579 | Ga0501043_0302254 | Ga0501043_0302254_250_1158 | 271 |
| 825 | 3300049823 | Ga0501044_0194596 | Ga0501044_0194596_138_1046 | 271 |
| 826 | iso_pu_bacteria | 2643221557 | 2643808696 | 271 |
| 827 | iso_pu_bacteria | 2643221610 | 2644066282 | 271 |
| 828 | iso_pu_bacteria | 2643221668 | 2644377823 | 271 |
| 829 | iso_pu_bacteria | 2643221675 | 2644415505 | 271 |
| 830 | iso_pu_bacteria | 2643221680 | 2644450093 | 271 |
| 831 | iso_pu_bacteria | 2643221689 | 2644499791 | 271 |
| 832 | iso_pu_bacteria | 2643221726 | 2644687650 | 271 |
| 833 | 3300036401 | Ga0373937_0257806 | Ga0373937_0257806_252_1070 | 272 |
| 834 | 3300001979 | JGI24740J21852_10043393 | JGI24740J21852_100433932 | 274 |
| 835 | 3300002704 | JGI25155J39150_1000003 | JGI25155J39150_100000348 | 274 |
| 836 | 3300002705 | JGI25156J39149_1000004 | JGI25156J39149_100000442 | 274 |
| 837 | 3300002737 | JGI25162J39368_1000165 | JGI25162J39368_100016554 | 274 |
| 838 | 3300002737 | JGI25162J39368_1000589 | JGI25162J39368_100058923 | 274 |
| 839 | 3300002738 | JGI25154J39366_1000013 | JGI25154J39366_1000013125 | 274 |
| 840 | 3300002741 | JGI25157J39369_1000004 | JGI25157J39369_1000004235 | 274 |
| 841 | 3300003214 | JGI25165J46597_1000068 | JGI25165J46597_1000068129 | 274 |
| 842 | 3300003214 | JGI25165J46597_1000233 | JGI25165J46597_100023359 | 274 |
| 843 | 3300025206 | Ga0209435_100006 | Ga0209435_100006233 | 274 |
| 844 | 3300025233 | Ga0209437_100040 | Ga0209437_100040174 | 274 |
| 845 | 3300025233 | Ga0209437_100067 | Ga0209437_100067201 | 274 |
| 846 | 3300025246 | Ga0209646_1000015 | Ga0209646_1000015302 | 274 |
| 847 | 3300025250 | Ga0209026_1000039 | Ga0209026_1000039233 | 274 |
| 848 | 3300025256 | Ga0209759_1000005 | Ga0209759_1000005233 | 274 |
| 849 | 3300025261 | Ga0209233_1000051 | Ga0209233_1000051175 | 274 |
| 850 | 3300025261 | Ga0209233_1000088 | Ga0209233_1000088201 | 274 |
| 851 | 3300026078 | Ga0207702_10014158 | Ga0207702_100141586 | 274 |
| 852 | 3300044694 | Ga0466963_0038589 | Ga0466963_0038589_657_1481 | 274 |
| 853 | 3300044765 | Ga0466970_0016022 | Ga0466970_0016022_1826_2650 | 274 |
| 854 | 3300044842 | Ga0466957_0036552 | Ga0466957_0036552_1827_2651 | 274 |
| 855 | 3300045049 | Ga0466959_0150878 | Ga0466959_0150878_694_1518 | 274 |
| 856 | 3300045836 | Ga0466958_0030668 | Ga0466958_0030668_783_1607 | 274 |
| 857 | 3300045976 | Ga0466967_0066790 | Ga0466967_0066790_1724_2548 | 274 |
| 858 | 3300045976 | Ga0466967_0078854 | Ga0466967_0078854_1514_2338 | 274 |
| 859 | 3300048922 | Ga0496119_0051565 | Ga0496119_0051565_592_1416 | 274 |
| 860 | 3300048923 | Ga0496120_0027978 | Ga0496120_0027978_892_1716 | 274 |
| 861 | 3300048925 | Ga0496122_0154798 | Ga0496122_0154798_324_1148 | 274 |
| 862 | 3300048928 | Ga0496125_0066200 | Ga0496125_0066200_551_1375 | 274 |
| 863 | iso_pu_bacteria | 2842482326 | 2842486972 | 274 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bp9-assembly6.cif.gz_F | oligopeptidase b from trypanosoma brucei with covalently bound antipain - closed form | 0.8117 | 16 | 48 |
| 3w0p-assembly1.cif.gz_A | crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia (d198a), ternary complex with adp and hygromycin b | 0.6888 | 8 | 265 |
| 3w0q-assembly1.cif.gz_A | crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia (n203a), ternary complex with amp-pnp and hygromycin b | 0.6886 | 4 | 265 |
| 6sun-assembly1.cif.gz_A | amicoumacin kinase hamin in complex with amp-pnp, ca2+ and ami | 0.6835 | 5 | 263 |
| 3c5i-assembly4.cif.gz_D | crystal structure of plasmodium knowlesi choline kinase, pkh_134520 | 0.6834 | 6 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4bp8A02 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain | 0.8316 | 16 | 48 | 2.130.10.120 |
| af_Q5Z417_117_462_2.130.10.120 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain | 0.7873 | 21 | 45 | 2.130.10.120 |
| af_Q03407_118_209_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7686 | 16 | 84 | 3.30.200.20 |
| af_Q8H1P3_2_91_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7516 | 9 | 82 | 3.30.200.20 |
| af_A0A0R0G3L9_89_323_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.7435 | 18 | 45 | 2.120.10.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D4P5Q7-F1-model_v4 | deleted | 0.9867 | 6 | 269 |
|
| AF-A0A6A7M7D9-F1-model_v4 | APH(6) family putative aminoglycoside O-phosphotransferase | 0.9864 | 8 | 265 |
GO:0016773
GO:0019748 |
| AF-A0A1D9BIX6-F1-model_v4 | 3'-kinase | 0.9849 | 17 | 271 |
GO:0016301
GO:0016773 GO:0019748 |
| AF-A0A2N3P430-F1-model_v4 | deleted | 0.9841 | 8 | 272 |
|
| AF-A0A377PCM8-F1-model_v4 | Aminoglycoside/hydroxyurea antibiotic resistance kinase | 0.9823 | 9 | 270 |
GO:0016301
GO:0016773 GO:0019748 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar