F483933

General Info

Members Datasets Scaffolds Average Seq Length
863 672 422 265

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221689|2644499791
Length 316
Sequence LPLRGRVGAKLRGGVSCGVYNRLWCSRWVTPTRRVAATSPLKGEVNERRAMFDRYIQAFDLVPDGSPVVTHSSHLLPVRWQGLPAMLKVATVSEEKRGALLMQWWDGLGAAKVYANDDDAVLLERAHGKLSLLSMAMSGDDDAASRIICGTVQTLHRPHTKPYPELVPLDIWFRALETASTIHGGAFATSHAVAKTLLDGPLETGALHGDIHHSNILDFEDRGWLAIDPKGLLGERGYDYANLFCNPDLPATKDAARLRRQLPIVAEVSGLAPERLLRWVIAYAGLSAAWFLEDEGDPAPALHVAEIAAAELGGGI

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
14 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
15 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
16 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
17 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
18 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
19 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
20 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
21 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
22 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
25 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
26 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
27 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
28 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
29 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
30 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
31 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
32 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
33 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
34 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
35 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
36 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
37 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
38 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
39 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
40 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
41 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
42 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
43 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
44 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
45 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
46 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
47 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
48 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
49 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
50 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
51 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
52 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
53 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
54 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
55 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
56 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
57 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
58 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
59 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
60 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
61 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
62 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
63 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
64 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
65 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
66 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
67 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
68 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
69 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
70 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
71 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
72 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
73 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
74 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
75 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
76 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
77 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
78 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
79 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
80 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
81 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
82 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
83 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
84 2643221557 Ensifer sp. Root558 Isolate Unclassified
85 2643221599 Rhizobium sp. Root708 Isolate Unclassified
86 2643221607 Rhizobium sp. Root73 Isolate Unclassified
87 2643221610 Ensifer sp. Root74 Isolate Unclassified
88 2643221618 Ensifer sp. Root231 Isolate Unclassified
89 2643221626 Ensifer sp. Root31 Isolate Unclassified
90 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
91 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
92 2643221655 Ensifer sp. Root1252 Isolate Unclassified
93 2643221659 Ensifer sp. Root127 Isolate Unclassified
94 2643221668 Ensifer sp. Root423 Isolate Unclassified
95 2643221675 Ensifer sp. Root1298 Isolate Unclassified
96 2643221680 Ensifer sp. Root1312 Isolate Unclassified
97 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
98 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
99 2643221698 Ensifer sp. Root142 Isolate Unclassified
100 2643221712 Ensifer sp. Root258 Isolate Unclassified
101 2643221723 Ensifer sp. Root278 Isolate Unclassified
102 2643221726 Ensifer sp. Root954 Isolate Unclassified
103 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
104 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
105 2718217882 Rhizobium sp. N741 Isolate Nodule
106 2718217927 Rhizobium sp. N324 Isolate Nodule
107 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
108 2718218009 Rhizobium sp. N561 Isolate Nodule
109 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
110 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
111 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
112 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
113 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
114 2718218363 Rhizobium sp. N113 Isolate Nodule
115 2718218365 Rhizobium sp. N731 Isolate Nodule
116 2718218366 Rhizobium sp. N621 Isolate Nodule
117 2718218423 Rhizobium sp. N941 Isolate Nodule
118 2721755514 Rhizobium sp. N6212 Isolate Nodule
119 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
120 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
121 2721755809 Rhizobium sp. N541 Isolate Nodule
122 2721755810 Rhizobium sp. N871 Isolate Nodule
123 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
124 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
125 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
126 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
127 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
128 2728369365 Rhizobium sp. N1341 Isolate Nodule
129 2728369397 Rhizobium sp. N1314 Isolate Nodule
130 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
131 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
132 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
133 2791355256 Rhizobium sp. M10 Isolate Nodule
134 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
135 2791355260 Rhizobium sp. L9 Isolate Nodule
136 2791355262 Rhizobium sp. M1 Isolate Nodule
137 2791355263 Rhizobium chutanense C5 Isolate Nodule
138 2791355264 Rhizobium sp. S9 Isolate Nodule
139 2791355265 Rhizobium sp. H4 Isolate Nodule
140 2791355267 Rhizobium sp. L18 Isolate Nodule
141 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
142 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
143 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
144 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
145 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
146 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
147 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
148 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
149 2802429633 Rhizobium anhuiense J3 Isolate Nodule
150 2802429634 Rhizobium anhuiense S10 Isolate Nodule
151 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
152 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
153 2802429637 Rhizobium anhuiense C15 Isolate Nodule
154 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
155 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
156 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
157 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
158 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
159 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
160 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
161 2838048938 Rhizobium pisi 27/80 Isolate Nodule
162 2838061910 Rhizobium phaseoli L15 Isolate Nodule
163 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
164 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
165 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
166 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
167 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
168 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
169 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
170 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
171 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
172 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
173 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
174 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
175 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
176 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
177 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
178 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
179 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
180 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
181 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
182 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
183 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
184 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
185 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
186 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
187 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
188 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
189 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
190 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
191 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
192 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
193 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
194 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
195 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
196 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
197 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
198 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
199 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
200 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
201 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
202 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
203 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
204 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
205 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
206 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
207 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
208 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
209 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
210 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
211 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
212 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
213 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
214 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
215 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
216 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
217 2844163670 Ensifer sp. 1H6 Isolate Unclassified
218 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
219 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
220 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
221 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
222 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
223 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
224 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
225 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
226 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
227 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
228 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
229 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
230 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
231 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
232 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
233 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
234 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
235 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
236 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
237 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
238 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
239 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
240 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
241 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
242 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
243 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
244 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
245 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
246 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
247 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
248 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
249 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
250 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
251 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
252 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
253 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
254 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
255 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
256 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
257 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
258 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
259 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
260 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
261 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
262 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
263 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
264 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
265 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
266 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
267 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
268 2933599457 Rhizobium phaseoli M3 Isolate Nodule
269 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
270 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
271 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
272 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
273 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
274 2936381700 Rhizobium chutanense C16 Isolate Unclassified
275 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
276 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
277 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
278 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
279 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
280 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
281 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
282 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
283 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
284 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
285 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
286 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
287 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
288 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
289 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
290 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
291 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
292 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
293 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
294 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
295 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
296 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
297 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
298 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
299 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
300 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
301 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
302 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
303 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
304 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
305 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
306 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
307 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
308 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
309 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
310 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
311 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
312 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
313 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
314 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
315 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
316 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
317 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
318 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
319 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
320 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
321 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
322 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
323 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
324 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
325 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
326 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
327 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
328 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
329 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
330 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
331 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
332 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
333 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
334 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
335 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
336 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
337 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
338 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
339 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
340 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
341 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
342 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
343 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
344 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
345 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
346 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
347 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
348 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
349 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
350 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
351 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
352 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
353 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
354 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
355 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
356 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
357 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
358 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
359 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
360 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
361 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
362 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
363 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
364 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
365 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
366 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
367 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
368 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
369 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
370 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
371 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
372 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
373 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
374 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
375 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
376 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
377 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
378 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
379 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
380 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
381 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
382 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
383 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
384 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
385 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
386 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
387 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
388 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
389 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
390 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
391 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
392 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
393 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
394 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
395 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
396 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
397 2996893221 Rhizobium sp. R635 Isolate Nodule
398 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
399 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
400 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
401 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
402 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
403 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
404 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
405 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
406 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
407 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
408 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
409 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
410 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
411 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
412 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
413 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
414 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
415 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
416 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
417 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
418 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
419 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
420 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
421 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
422 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
423 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
424 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
425 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
426 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
427 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
428 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
429 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
430 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
431 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
432 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
433 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
434 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
435 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
436 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
437 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
438 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
439 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
440 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
441 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
442 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
443 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
444 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
445 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
446 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
447 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
448 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
449 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
450 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
451 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
452 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
453 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
454 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
455 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
456 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
457 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
458 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
459 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
460 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
461 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
462 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
463 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
464 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
465 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
466 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
467 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
468 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
469 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
470 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
471 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
472 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
473 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
474 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
475 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
476 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
477 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
478 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
479 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
480 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
481 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
482 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
483 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
484 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
485 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
486 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
487 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
488 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
489 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
490 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
491 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
492 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
493 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
503 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
504 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
505 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
506 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
507 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
508 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
509 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
510 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
511 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
512 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
513 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
514 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
515 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
516 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
517 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
518 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
519 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
520 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
521 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
522 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
523 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
524 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
525 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
526 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
527 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
528 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
529 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
530 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
531 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
532 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
533 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
534 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
535 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
536 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
537 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
538 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
539 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
540 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
541 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
542 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
543 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
544 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
545 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
546 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
547 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
548 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
549 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
550 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
551 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
552 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
553 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
554 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
555 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
556 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
557 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
558 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
559 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
560 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
561 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
562 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
563 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
564 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
565 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
566 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
567 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
568 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
569 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
570 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
571 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
572 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
573 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
574 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
575 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
576 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
577 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
578 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
579 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
580 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
581 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
582 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
583 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
584 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
585 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
586 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
588 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
589 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
590 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
591 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
593 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
594 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
595 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
597 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
598 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
599 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
600 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
601 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
602 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
603 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
604 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
605 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
606 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
607 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
608 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
609 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
610 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
611 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
612 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
613 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
614 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
615 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
616 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
617 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
618 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
619 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
620 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
621 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
622 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
623 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
624 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
625 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
626 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
627 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
628 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
629 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
630 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
631 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
632 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
633 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
634 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
635 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
636 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
637 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
638 8005258706 Rhizobium sp. R693 Isolate Nodule
639 8005275841 Rhizobium sp. N4311 Isolate Nodule
640 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
641 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
642 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
643 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
644 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
645 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
646 8005382845 Rhizobium sp. R634 Isolate Nodule
647 8005395548 Rhizobium sp. R339 Isolate Nodule
648 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
649 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
650 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
651 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
652 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
653 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
654 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
655 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
656 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
657 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
658 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
659 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
660 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
661 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
662 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
663 8018176218 Rhizobium sp. N122 Isolate Nodule
664 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
665 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
666 8024501048 Rhizobium sp. H4 Isolate Nodule
667 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
668 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
669 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
670 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
671 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere
672 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 48.9
Metatranscriptomes 0
Isolates 51.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.73
Nodule 40.79
Rhizoplane 4.29
Rhizosphere 24.45
Stem 0
Stem Tuber 0
Unclassified 12.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10043393 3300001979 Bacteria 1341
2 JGI25155J39150_1000003 3300002704 Bacteria 279666
3 JGI25156J39149_1000004 3300002705 Bacteria 273027
4 JGI25162J39368_1000081 3300002737 Bacteria 113016
5 JGI25162J39368_1000165 3300002737 Bacteria 73081
6 JGI25162J39368_1000589 3300002737 Bacteria 26498
7 JGI25154J39366_1000013 3300002738 Bacteria 268260
8 JGI25158J39367_1003941 3300002739 Bacteria 2251
9 JGI25157J39369_1000004 3300002741 Bacteria 273009
10 JGI25163J39215_1000016 3300002771 Bacteria 82638
11 JGI25164J39214_1000060 3300002772 Bacteria 110667
12 JGI25152J39213_1009714 3300002773 Bacteria 2262
13 JGI25159J45721_1000029 3300002987 Bacteria 105868
14 JGI25159J45721_1000393 3300002987 Bacteria 20327
15 JGI25159J45721_1001256 3300002987 Bacteria 10697
16 JGI25151J46595_10003303 3300003187 Bacteria 8955
17 JGI25151J46595_10019917 3300003187 Bacteria 2837
18 JGI25151J46595_10027236 3300003187 Bacteria 2295
19 JGI25165J46597_1000068 3300003214 Bacteria 196201
20 JGI25165J46597_1000153 3300003214 Bacteria 113016
21 JGI25165J46597_1000233 3300003214 Bacteria 77242
22 JGI25153J46596_10001757 3300003215 Bacteria 12850
23 rootH1_10085227 3300003316 Bacteria 4053
24 rootH1_10131537 3300003316 Bacteria 1645
25 rootH2_10112232 3300003320 Bacteria 4889
26 rootH2_10197019 3300003320 Bacteria 2075
27 rootL2_10001966 3300003322 Bacteria 6367
28 rootH1_10033048 3300003323 Bacteria 4594
29 JGI25160J50197_1000001 3300003354 Bacteria 782301
30 JGI25160J50197_1000011 3300003354 Bacteria 275577
31 JGI25160J50197_1005624 3300003354 Bacteria 5193
32 JGI25160J50197_1013799 3300003354 Bacteria 2736
33 JGI25161J50226_1000001 3300003374 Bacteria 655036
34 JGI25161J50226_1000068 3300003374 Bacteria 90522
35 JGI25161J50226_1000152 3300003374 Bacteria 47933
36 JGI25161J50226_1004423 3300003374 Bacteria 2942
37 Ga0055526_1001546 3300003771 Bacteria 16285
38 Ga0055526_1002259 3300003771 Bacteria 13165
39 Ga0055526_1002927 3300003771 Bacteria 11210
40 Ga0055524_1001331 3300003775 Bacteria 14401
41 Ga0055524_1008256 3300003775 Bacteria 4339
42 Ga0055524_1023545 3300003775 Bacteria 1980
43 Ga0055524_1035939 3300003775 Bacteria 1342
44 Ga0055536_1000015 3300003781 Bacteria 237585
45 Ga0055536_1000356 3300003781 Bacteria 34069
46 Ga0055528_1000256 3300003790 Bacteria 45159
47 Ga0055528_1001003 3300003790 Bacteria 18727
48 Ga0055528_1001848 3300003790 Bacteria 12070
49 Ga0055528_1007339 3300003790 Bacteria 4888
50 Ga0055528_1020168 3300003790 Bacteria 2174
51 Ga0055530_10000003 3300003791 Bacteria 237585
52 Ga0055540_1001929 3300003792 Bacteria 11588
53 Ga0055531_10002064 3300003794 Bacteria 13842
54 Ga0055543_1000003 3300004625 Bacteria 358656
55 Ga0055543_1000097 3300004625 Bacteria 75364
56 Ga0055543_1000470 3300004625 Bacteria 23657
57 Ga0065165_1000018 3300005262 Bacteria 275082
58 Ga0065165_1000335 3300005262 Bacteria 77037
59 Ga0065165_1006900 3300005262 Bacteria 5770
60 Ga0065165_1061827 3300005262 Bacteria 1023
61 Ga0070658_10000047 3300005327 Bacteria 129483
62 Ga0070666_10051408 3300005335 Bacteria 2775
63 Ga0070682_100046011 3300005337 Bacteria 2707
64 Ga0070660_100384467 3300005339 Bacteria 1159
65 Ga0070671_100011067 3300005355 Bacteria 7243
66 Ga0070663_100222403 3300005455 Bacteria 1483
67 Ga0070684_100296218 3300005535 Bacteria 1484
68 Ga0070665_100219802 3300005548 Bacteria 1900
69 Ga0068855_100000360 3300005563 Bacteria 56448
70 Ga0068855_100027064 3300005563 Bacteria 6860
71 Ga0068855_100145188 3300005563 Bacteria 2702
72 Ga0068856_100004342 3300005614 Bacteria 14127
73 Ga0068856_100592914 3300005614 Bacteria 1129
74 Ga0068852_100416227 3300005616 Bacteria 1325
75 Ga0068851_10061411 3300005834 Bacteria 1926
76 Ga0068862_100768220 3300005844 Bacteria 939
77 Ga0081455_10410500 3300005937 Bacteria 937
78 Ga0075365_10008493 3300006038 Bacteria 5840
79 Ga0075368_10067142 3300006042 Bacteria 1443
80 Ga0075363_100135800 3300006048 Bacteria 1382
81 Ga0075362_10007517 3300006177 Bacteria 4130
82 Ga0075367_10085089 3300006178 Bacteria 1919
83 Ga0075369_10003366 3300006186 Bacteria 5815
84 Ga0075369_10071718 3300006186 Bacteria 1525
85 Ga0075366_10003422 3300006195 Bacteria 8362
86 Ga0075370_10048128 3300006353 Bacteria 2415
87 Ga0105251_10004448 3300009011 Bacteria 9535
88 Ga0105240_10000014 3300009093 Bacteria 482033
89 Ga0111539_10243148 3300009094 Bacteria 2095
90 Ga0105243_10000310 3300009148 Bacteria 53933
91 Ga0105243_10687524 3300009148 Unclassified 996
92 Ga0105248_10039091 3300009177 Bacteria 5312
93 Ga0105237_10001251 3300009545 Bacteria 33932
94 Ga0123341_1000028 3300009765 Bacteria 69145
95 Ga0123341_1068606 3300009765 Bacteria 1585
96 Ga0123342_1012989 3300009766 Bacteria 8481
97 Ga0123342_1028435 3300009766 Bacteria 3017
98 Ga0157371_10000264 3300013102 Bacteria 71499
99 Ga0157370_10000248 3300013104 Bacteria 68580
100 Ga0157369_10492075 3300013105 Bacteria 1269
101 Ga0171463_1008 3300013249 Bacteria 299022
102 Ga0182008_10000050 3300014497 Bacteria 103527
103 Ga0182007_10003611 3300015262 Bacteria 7256
104 Ga0183363_1112 3300015690 Bacteria 22207
105 Ga0213872_10092233 3300021361 Bacteria 1355
106 Ga0228710_1000006 3300022740 Bacteria 209134
107 Ga0209435_100006 3300025206 Bacteria 542459
108 Ga0209760_100041 3300025207 Bacteria 115995
109 Ga0209436_100070 3300025208 Bacteria 51558
110 Ga0209436_100897 3300025208 Bacteria 11815
111 Ga0207427_100104 3300025231 Bacteria 119099
112 Ga0209437_100040 3300025233 Bacteria 448096
113 Ga0209437_100067 3300025233 Bacteria 317685
114 Ga0209437_100348 3300025233 Bacteria 54213
115 Ga0207425_1001479 3300025245 Bacteria 9779
116 Ga0209646_1000015 3300025246 Bacteria 542459
117 Ga0209026_1000039 3300025250 Bacteria 280608
118 Ga0209677_101078 3300025253 Bacteria 12891
119 Ga0209759_1000005 3300025256 Bacteria 542459
120 Ga0209129_1000252 3300025258 Bacteria 55710
121 Ga0209129_1000341 3300025258 Bacteria 40242
122 Ga0209129_1000454 3300025258 Bacteria 30433
123 Ga0209129_1002985 3300025258 Bacteria 7710
124 Ga0209129_1004740 3300025258 Bacteria 5155
125 Ga0209233_1000051 3300025261 Bacteria 447617
126 Ga0209233_1000088 3300025261 Bacteria 317980
127 Ga0209233_1000148 3300025261 Bacteria 185135
128 Ga0209233_1000202 3300025261 Bacteria 119099
129 Ga0209565_1028280 3300025263 Bacteria 1109
130 Ga0209673_1000010 3300025273 Bacteria 596656
131 Ga0209673_1000025 3300025273 Bacteria 404572
132 Ga0209673_1001232 3300025273 Bacteria 26878
133 Ga0209673_1003248 3300025273 Bacteria 9821
134 Ga0209673_1003720 3300025273 Bacteria 8733
135 Ga0209673_1024752 3300025273 Bacteria 2010
136 Ga0209130_1000003 3300025284 Bacteria 677988
137 Ga0209130_1000020 3300025284 Bacteria 379297
138 Ga0209130_1000029 3300025284 Bacteria 323399
139 Ga0209676_1000017 3300025292 Bacteria 643409
140 Ga0209676_1000438 3300025292 Bacteria 71339
141 Ga0209676_1023377 3300025292 Bacteria 2025
142 Ga0209025_1000033 3300025294 Bacteria 414511
143 Ga0209025_1000091 3300025294 Bacteria 250401
144 Ga0209025_1002551 3300025294 Bacteria 19004
145 Ga0209025_1016097 3300025294 Bacteria 4449
146 Ga0209025_1021964 3300025294 Bacteria 3409
147 Ga0209564_1000275 3300025295 Bacteria 107884
148 Ga0209564_1000588 3300025295 Bacteria 57321
149 Ga0209564_1000644 3300025295 Bacteria 52727
150 Ga0209564_1000883 3300025295 Bacteria 39645
151 Ga0209564_1004772 3300025295 Bacteria 8095
152 Ga0209564_1007448 3300025295 Bacteria 5651
153 Ga0209564_1027103 3300025295 Bacteria 1870
154 Ga0209758_1001217 3300025297 Bacteria 32348
155 Ga0209758_1001396 3300025297 Bacteria 28704
156 Ga0209758_1018413 3300025297 Bacteria 3423
157 Ga0209758_1018414 3300025297 Bacteria 3423
158 Ga0209758_1040880 3300025297 Bacteria 1742
159 Ga0209050_1000076 3300025298 Bacteria 285628
160 Ga0209050_1000516 3300025298 Bacteria 64933
161 Ga0209256_1000218 3300025299 Bacteria 106228
162 Ga0209256_1000924 3300025299 Bacteria 35882
163 Ga0209256_1002389 3300025299 Bacteria 15470
164 Ga0209256_1005850 3300025299 Bacteria 6832
165 Ga0209256_1010630 3300025299 Bacteria 3822
166 Ga0209256_1025141 3300025299 Bacteria 1740
167 Ga0207426_1000008 3300025302 Bacteria 848730
168 Ga0207426_1000011 3300025302 Bacteria 791203
169 Ga0207426_1000074 3300025302 Bacteria 323399
170 Ga0207426_1000218 3300025302 Bacteria 135865
171 Ga0209051_1000050 3300025303 Bacteria 284349
172 Ga0209051_1001494 3300025303 Bacteria 19577
173 Ga0209051_1004736 3300025303 Bacteria 8241
174 Ga0209051_1006706 3300025303 Bacteria 6434
175 Ga0209257_1000569 3300025304 Bacteria 62370
176 Ga0207705_10000052 3300025909 Bacteria 168319
177 Ga0207695_10000037 3300025913 Bacteria 476303
178 Ga0207671_10004383 3300025914 Bacteria 13528
179 Ga0207644_10014715 3300025931 Bacteria 5243
180 Ga0207709_10000280 3300025935 Bacteria 58638
181 Ga0207661_10167251 3300025944 Bacteria 1912
182 Ga0207667_10000430 3300025949 Bacteria 56466
183 Ga0207667_10005189 3300025949 Bacteria 15905
184 Ga0207667_10038463 3300025949 Bacteria 5110
185 Ga0207668_10060610 3300025972 Bacteria 2657
186 Ga0207668_10659881 3300025972 Bacteria 916
187 Ga0207678_10210311 3300026067 Bacteria 1664
188 Ga0207702_10000165 3300026078 Bacteria 79066
189 Ga0207702_10014158 3300026078 Bacteria 6624
190 Ga0207702_10496715 3300026078 Bacteria 1189
191 Ga0207698_10780166 3300026142 Bacteria 956
192 Ga0209281_1000508 3300027111 Bacteria 51432
193 Ga0209281_1000621 3300027111 Bacteria 39698
194 Ga0209282_1000116 3300027666 Bacteria 51432
195 Ga0209813_10037095 3300027866 Bacteria 1467
196 Ga0307515_10019406 3300028794 Bacteria 12244
197 Ga0307515_10021842 3300028794 Bacteria 11320
198 Ga0307412_10220453 3300031911 Bacteria 1454
199 Ga0315914_1000008 3300031967 Bacteria 209133
200 Ga0307416_100169017 3300032002 Bacteria 2033
201 Ga0315913_1002685 3300033430 Bacteria 21084
202 Ga0315915_1000058 3300033464 Bacteria 72461
203 Ga0373937_0257806 3300036401 Bacteria 1644
204 Ga0395905_0000435 3300037471 Bacteria 58317
205 Ga0436361_0082179 3300039447 Bacteria 5869
206 Ga0439436_0024270 3300041404 Bacteria 1791
207 Ga0439438_007202 3300041405 Bacteria 3827
208 Ga0451787_506080 3300041441 Bacteria 2449
209 Ga0451789_0788741 3300041443 Bacteria 1043
210 Ga0451807_0045927 3300041486 Bacteria 1382
211 Ga0451833_0097459 3300041491 Bacteria 3501
212 Ga0451833_0097858 3300041491 Bacteria 1684
213 Ga0451835_0224880 3300041492 Bacteria 1997
214 Ga0451835_1237521 3300041492 Bacteria 1740
215 Ga0451837_0969126 3300041494 Bacteria 1710
216 Ga0451839_0380119 3300041496 Bacteria 1880
217 Ga0451841_0047569 3300041498 Bacteria 2227
218 Ga0451847_0182853 3300041503 Bacteria 2096
219 Ga0451849_1174138 3300041505 Bacteria 930
220 Ga0451853_0010833 3300041512 Bacteria 2244
221 Ga0451853_2734846 3300041512 Bacteria 3159
222 Ga0439456_030539 3300042013 Bacteria 1153
223 Ga0466963_0038589 3300044694 Bacteria 3124
224 Ga0466970_0016022 3300044765 Bacteria 3860
225 Ga0466957_0036552 3300044842 Bacteria 2953
226 Ga0466959_0150878 3300045049 Bacteria 1638
227 Ga0466958_0030668 3300045836 Bacteria 3195
228 Ga0466967_0066790 3300045976 Bacteria 3206
229 Ga0466967_0078854 3300045976 Bacteria 2968
230 Ga0495638_0126249 3300046460 Bacteria 1507
231 Ga0495605_0067923 3300046474 Bacteria 1690
232 Ga0495585_0004459 3300046492 Bacteria 9076
233 Ga0495607_0012593 3300046501 Bacteria 5574
234 Ga0495607_0018504 3300046501 Bacteria 4440
235 Ga0495583_0013880 3300046506 Bacteria 4467
236 Ga0495606_0108135 3300046507 Bacteria 1681
237 Ga0495610_0036671 3300046512 Bacteria 2503
238 Ga0495610_0046222 3300046512 Bacteria 2149
239 Ga0495616_0006680 3300046513 Bacteria 6962
240 Ga0495616_0054958 3300046513 Bacteria 1973
241 Ga0495620_0021011 3300046515 Bacteria 3177
242 Ga0495631_0000627 3300046518 Bacteria 23229
243 Ga0495631_0034272 3300046518 Bacteria 2277
244 Ga0495632_0013093 3300046519 Bacteria 4750
245 Ga0495643_0000033 3300046522 Bacteria 251940
246 Ga0495643_0003546 3300046522 Bacteria 11343
247 Ga0495643_0017682 3300046522 Bacteria 4162
248 Ga0495643_0023729 3300046522 Bacteria 3484
249 Ga0495648_0000074 3300046524 Bacteria 129886
250 Ga0495648_0092903 3300046524 Bacteria 1684
251 Ga0495609_0076261 3300046538 Bacteria 1469
252 Ga0495597_0010430 3300046542 Bacteria 4544
253 Ga0495633_0042377 3300046558 Bacteria 2162
254 Ga0495668_0025358 3300046616 Bacteria 3369
255 Ga0495611_0009214 3300046648 Bacteria 4167
256 Ga0495611_0046262 3300046648 Bacteria 1951
257 Ga0495625_0081011 3300046660 Bacteria 2260
258 Ga0495625_0083670 3300046660 Bacteria 2217
259 Ga0495625_0117552 3300046660 Bacteria 1812
260 Ga0495661_0025571 3300046665 Bacteria 3812
261 Ga0495671_0078996 3300046692 Bacteria 1613
262 Ga0495649_0031399 3300046694 Bacteria 2929
263 Ga0495649_0081402 3300046694 Bacteria 1731
264 Ga0495660_0012839 3300046810 Bacteria 4859
265 Ga0495660_0122000 3300046810 Bacteria 1317
266 Ga0495660_0138959 3300046810 Bacteria 1211
267 Ga0495673_0113262 3300047469 Bacteria 1082
268 Ga0495686_0016214 3300047472 Bacteria 5058
269 Ga0495686_0126797 3300047472 Bacteria 1517
270 Ga0495626_0061655 3300048091 Bacteria 1705
271 Ga0496101_0014663 3300048904 Bacteria 5272
272 Ga0496101_0151638 3300048904 Bacteria 1773
273 Ga0496102_0021862 3300048905 Bacteria 5662
274 Ga0496102_0045843 3300048905 Bacteria 3969
275 Ga0496102_0135123 3300048905 Unclassified 2311
276 Ga0496103_0032993 3300048906 Bacteria 3162
277 Ga0496104_0019802 3300048907 Bacteria 6161
278 Ga0496105_0014556 3300048908 Bacteria 6263
279 Ga0496106_0079661 3300048909 Bacteria 2515
280 Ga0496106_0105275 3300048909 Bacteria 2192
281 Ga0496108_0040907 3300048911 Bacteria 3867
282 Ga0496109_0119319 3300048912 Bacteria 2456
283 Ga0496110_0109793 3300048913 Bacteria 2477
284 Ga0496111_0043867 3300048914 Bacteria 3215
285 Ga0496111_0373548 3300048914 Bacteria 1055
286 Ga0496113_0016669 3300048916 Bacteria 5080
287 Ga0496116_0000290 3300048919 Bacteria 85274
288 Ga0496116_0116643 3300048919 Bacteria 1555
289 Ga0496116_0187617 3300048919 Bacteria 1098
290 Ga0496117_0000307 3300048920 Bacteria 85437
291 Ga0496117_0023215 3300048920 Bacteria 4952
292 Ga0496117_0023913 3300048920 Bacteria 4851
293 Ga0496118_0000277 3300048921 Bacteria 89996
294 Ga0496118_0029235 3300048921 Bacteria 4626
295 Ga0496118_0041646 3300048921 Bacteria 3633
296 Ga0496118_0097248 3300048921 Bacteria 2004
297 Ga0496119_0014493 3300048922 Bacteria 6161
298 Ga0496119_0051565 3300048922 Bacteria 2528
299 Ga0496120_0007629 3300048923 Bacteria 8017
300 Ga0496120_0027978 3300048923 Bacteria 3461
301 Ga0496120_0094168 3300048923 Bacteria 1595
302 Ga0496121_0000255 3300048924 Bacteria 113201
303 Ga0496121_0011982 3300048924 Bacteria 9533
304 Ga0496121_0017363 3300048924 Bacteria 7357
305 Ga0496121_0033436 3300048924 Bacteria 4652
306 Ga0496121_0043649 3300048924 Bacteria 3879
307 Ga0496121_0191165 3300048924 Bacteria 1467
308 Ga0496121_0233904 3300048924 Bacteria 1285
309 Ga0496122_0000654 3300048925 Bacteria 69918
310 Ga0496122_0039175 3300048925 Bacteria 3782
311 Ga0496122_0104215 3300048925 Bacteria 1885
312 Ga0496122_0113041 3300048925 Bacteria 1775
313 Ga0496122_0154798 3300048925 Bacteria 1408
314 Ga0496123_0000688 3300048926 Bacteria 55759
315 Ga0496123_0016107 3300048926 Bacteria 6091
316 Ga0496123_0035064 3300048926 Bacteria 3582
317 Ga0496123_0107461 3300048926 Bacteria 1605
318 Ga0496124_0028074 3300048927 Bacteria 5037
319 Ga0496124_0036841 3300048927 Bacteria 4260
320 Ga0496124_0097838 3300048927 Bacteria 2382
321 Ga0496124_0123284 3300048927 Bacteria 2068
322 Ga0496125_0066200 3300048928 Bacteria 2857
323 Ga0496126_0174171 3300048929 Bacteria 1831
324 Ga0496126_0352434 3300048929 Bacteria 1203
325 Ga0495678_060953 3300049459 Bacteria 1417
326 Ga0495682_0094722 3300049460 Bacteria 1072
327 Ga0501031_0008929 3300049568 Bacteria 6517
328 Ga0501031_0247519 3300049568 Bacteria 1158
329 Ga0501032_0001541 3300049569 Bacteria 18385
330 Ga0501032_0007637 3300049569 Bacteria 7885
331 Ga0501032_0013623 3300049569 Bacteria 5776
332 Ga0501033_0000782 3300049570 Bacteria 29254
333 Ga0501033_0009817 3300049570 Bacteria 7346
334 Ga0501033_0226720 3300049570 Bacteria 1328
335 Ga0501036_0001623 3300049572 Bacteria 17387
336 Ga0501036_0006175 3300049572 Bacteria 9725
337 Ga0501036_0044152 3300049572 Bacteria 3775
338 Ga0501036_0049651 3300049572 Bacteria 3553
339 Ga0501037_0008624 3300049573 Bacteria 7473
340 Ga0501037_0040707 3300049573 Bacteria 3418
341 Ga0501037_0112854 3300049573 Bacteria 1957
342 Ga0501038_0001112 3300049574 Bacteria 24380
343 Ga0501038_0002883 3300049574 Bacteria 16045
344 Ga0501038_0017022 3300049574 Bacteria 6576
345 Ga0501038_0023881 3300049574 Bacteria 5460
346 Ga0501038_0034683 3300049574 Bacteria 4436
347 Ga0501038_0055141 3300049574 Bacteria 3415
348 Ga0501038_0106280 3300049574 Bacteria 2330
349 Ga0501038_0114830 3300049574 Unclassified 2226
350 Ga0501039_0005852 3300049575 Bacteria 9312
351 Ga0501039_0027210 3300049575 Bacteria 4397
352 Ga0501039_0036784 3300049575 Bacteria 3778
353 Ga0501039_0079512 3300049575 Bacteria 2551
354 Ga0501042_0244600 3300049578 Bacteria 1294
355 Ga0501043_0007628 3300049579 Bacteria 8573
356 Ga0501043_0037586 3300049579 Bacteria 3807
357 Ga0501043_0090908 3300049579 Bacteria 2400
358 Ga0501043_0112237 3300049579 Bacteria 2140
359 Ga0501043_0298466 3300049579 Bacteria 1231
360 Ga0501043_0302254 3300049579 Bacteria 1222
361 Ga0501046_0007998 3300049580 Bacteria 9244
362 Ga0501046_0012416 3300049580 Bacteria 7252
363 Ga0501047_0045590 3300049581 Bacteria 4239
364 Ga0501047_0151717 3300049581 Bacteria 2193
365 Ga0501048_0016225 3300049582 Bacteria 5491
366 Ga0501048_0080727 3300049582 Bacteria 2294
367 Ga0501067_0005814 3300049583 Bacteria 6843
368 Ga0501068_0001323 3300049584 Bacteria 13146
369 Ga0501068_0017736 3300049584 Bacteria 4120
370 Ga0501072_0005614 3300049588 Bacteria 9545
371 Ga0501073_0005075 3300049589 Bacteria 9872
372 Ga0501074_0004103 3300049590 Bacteria 10392
373 Ga0501076_0023666 3300049592 Bacteria 4737
374 Ga0501077_0066059 3300049593 Unclassified 2294
375 Ga0501079_0002305 3300049741 Bacteria 13808
376 Ga0501080_0029821 3300049742 Bacteria 5077
377 Ga0501080_0043793 3300049742 Bacteria 4168
378 Ga0501080_0073626 3300049742 Bacteria 3178
379 Ga0501035_0000979 3300049822 Bacteria 30237
380 Ga0501035_0005403 3300049822 Bacteria 12077
381 Ga0501035_0061785 3300049822 Bacteria 3333
382 Ga0501035_0208621 3300049822 Bacteria 1672
383 Ga0501044_0000384 3300049823 Bacteria 54969
384 Ga0501044_0005482 3300049823 Bacteria 14095
385 Ga0501044_0033478 3300049823 Bacteria 5401
386 Ga0501044_0071140 3300049823 Bacteria 3537
387 Ga0501044_0194596 3300049823 Bacteria 1988
388 Ga0501044_0219884 3300049823 Bacteria 1850
389 Ga0501044_0352004 3300049823 Bacteria 1392
390 Ga0501045_0000581 3300049824 Bacteria 22931
391 Ga0501045_0305200 3300049824 Bacteria 1185
392 nmdc:mga03683_2591_c1 3300050489 Bacteria 5645
393 nmdc:mga03683_36703_c1 3300050489 Bacteria 1994
394 nmdc:mga03n38_16653_c1 3300050490 Bacteria 2864
395 nmdc:mga03n38_40727_c1 3300050490 Bacteria 2020
396 nmdc:mga0yw44_4173_c1 3300050492 Bacteria 6571
397 nmdc:mga0k408_12228_c1 3300050493 Bacteria 4691
398 nmdc:mga04h51_31543_c1 3300050495 Bacteria 1675
399 nmdc:mga07m45_3201_c1 3300050496 Bacteria 7851
400 Ga0500578_0010727 3300053086 Bacteria 5919
401 Ga0500556_0133097 3300053104 Bacteria 975
402 Ga0500557_004893 3300053105 Bacteria 2871
403 Ga0500562_014636 3300053108 Bacteria 2010
404 Ga0500562_057034 3300053108 Bacteria 1047
405 Ga0500569_001663 3300053109 Bacteria 4238
406 Ga0500569_019294 3300053109 Bacteria 1772
407 Ga0500594_0001268 3300053118 Bacteria 5482
408 Ga0500618_002324 3300053125 Bacteria 7295
409 Ga0500658_0006626 3300053134 Bacteria 4292
410 Ga0500568_0001590 3300053139 Bacteria 14359
411 Ga0500568_0003502 3300053139 Bacteria 8713
412 Ga0500568_0013202 3300053139 Bacteria 3770
413 Ga0500616_0007889 3300053153 Bacteria 6691
414 Ga0500616_0009563 3300053153 Bacteria 5888
415 Ga0500622_0003787 3300053156 Bacteria 9863
416 Ga0500627_0015321 3300053158 Bacteria 2960
417 Ga0500627_0036194 3300053158 Bacteria 2101
418 Ga0500633_0000648 3300053160 Bacteria 5809
419 Ga0500636_0107794 3300053177 Bacteria 1577
420 Ga0500645_009303 3300053730 Bacteria 3306
421 Ga0501084_0000733 3300054114 Bacteria 25011
422 Ga0501082_0019608 3300060353 Bacteria 5831

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0247519 Ga0501031_0247519_14_745 223
2 3300049823 Ga0501044_0071140 Ga0501044_0071140_14_745 223
3 3300005563 Ga0068855_100027064 Ga0068855_1000270647 226
4 3300025949 Ga0207667_10005189 Ga0207667_100051892 226
5 3300048920 Ga0496117_0000307 Ga0496117_0000307_71949_72638 228
6 3300048921 Ga0496118_0000277 Ga0496118_0000277_72132_72821 228
7 3300026142 Ga0207698_10780166 Ga0207698_107801661 230
8 3300021361 Ga0213872_10092233 Ga0213872_100922331 247
9 3300039447 Ga0436361_0082179 Ga0436361_0082179_1418_2164 247
10 3300049579 Ga0501043_0298466 Ga0501043_0298466_414_1217 247
11 3300002987 JGI25159J45721_1001256 JGI25159J45721_10012561 254
12 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001493 254
13 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001264 254
14 3300004625 Ga0055543_1000003 Ga0055543_1000003280 254
15 3300005262 Ga0065165_1000335 Ga0065165_100033543 254
16 3300025284 Ga0209130_1000003 Ga0209130_1000003281 254
17 3300025302 Ga0207426_1000011 Ga0207426_1000011494 254
18 3300046522 Ga0495643_0023729 Ga0495643_0023729_903_1703 254
19 3300047469 Ga0495673_0113262 Ga0495673_0113262_212_1012 254
20 3300048923 Ga0496120_0094168 Ga0496120_0094168_697_1497 254
21 3300048924 Ga0496121_0043649 Ga0496121_0043649_56_856 254
22 3300049574 Ga0501038_0055141 Ga0501038_0055141_414_1247 257
23 iso_pu_bacteria 637000220 637321450 257
24 3300049568 Ga0501031_0008929 Ga0501031_0008929_3006_3854 258
25 3300049570 Ga0501033_0226720 Ga0501033_0226720_69_905 258
26 3300049572 Ga0501036_0049651 Ga0501036_0049651_2170_3006 258
27 3300049573 Ga0501037_0040707 Ga0501037_0040707_414_1250 258
28 3300049578 Ga0501042_0244600 Ga0501042_0244600_391_1227 258
29 3300049581 Ga0501047_0045590 Ga0501047_0045590_2846_3682 258
30 3300049582 Ga0501048_0080727 Ga0501048_0080727_517_1353 258
31 3300049584 Ga0501068_0017736 Ga0501068_0017736_2204_3040 258
32 3300049824 Ga0501045_0000581 Ga0501045_0000581_19384_20220 258
33 3300005327 Ga0070658_10000047 Ga0070658_1000004751 259
34 3300025909 Ga0207705_10000052 Ga0207705_1000005251 259
35 3300049569 Ga0501032_0007637 Ga0501032_0007637_3081_3860 259
36 3300049573 Ga0501037_0008624 Ga0501037_0008624_2586_3365 259
37 3300049574 Ga0501038_0001112 Ga0501038_0001112_19705_20484 259
38 3300049575 Ga0501039_0005852 Ga0501039_0005852_4682_5461 259
39 3300049579 Ga0501043_0007628 Ga0501043_0007628_5711_6490 259
40 3300049580 Ga0501046_0007998 Ga0501046_0007998_6902_7681 259
41 3300049582 Ga0501048_0016225 Ga0501048_0016225_1142_1921 259
42 3300049583 Ga0501067_0005814 Ga0501067_0005814_3897_4676 259
43 3300049584 Ga0501068_0001323 Ga0501068_0001323_8136_8915 259
44 3300049588 Ga0501072_0005614 Ga0501072_0005614_5437_6216 259
45 3300049589 Ga0501073_0005075 Ga0501073_0005075_3383_4162 259
46 3300049590 Ga0501074_0004103 Ga0501074_0004103_3903_4682 259
47 3300049592 Ga0501076_0023666 Ga0501076_0023666_17_796 259
48 3300049593 Ga0501077_0066059 Ga0501077_0066059_1388_2167 259
49 3300049741 Ga0501079_0002305 Ga0501079_0002305_3897_4676 259
50 3300049742 Ga0501080_0029821 Ga0501080_0029821_1065_1844 259
51 3300049822 Ga0501035_0005403 Ga0501035_0005403_9607_10386 259
52 3300049823 Ga0501044_0005482 Ga0501044_0005482_6086_6865 259
53 3300054114 Ga0501084_0000733 Ga0501084_0000733_8277_9056 259
54 3300060353 Ga0501082_0019608 Ga0501082_0019608_3361_4140 259
55 iso_pu_bacteria 2510065057 2510306219 259
56 iso_pu_bacteria 2511231052 2511501481 259
57 iso_pu_bacteria 2513237086 2513583012 259
58 iso_pu_bacteria 2513237091 2513617934 259
59 iso_pu_bacteria 2513237140 2513884920 259
60 iso_pu_bacteria 2513237143 2513905932 259
61 iso_pu_bacteria 2516653046 2516892797 259
62 iso_pu_bacteria 2524023207 2524453635 259
63 iso_pu_bacteria 2551306084 2551674227 259
64 iso_pu_bacteria 2551306084 2551680379 259
65 iso_pu_bacteria 2551306085 2551687012 259
66 iso_pu_bacteria 2551306086 2551694273 259
67 iso_pu_bacteria 2551306090 2551719896 259
68 iso_pu_bacteria 2551306092 2551732830 259
69 iso_pu_bacteria 2551306093 2551740070 259
70 iso_pu_bacteria 2855825444 2855825577 259
71 iso_pu_bacteria 2855839649 2855840954 259
72 iso_pu_bacteria 2858800743 2858801493 259
73 iso_pu_bacteria 2915986958 2915992809 259
74 iso_pu_bacteria 2915993759 2915994160 259
75 iso_pu_bacteria 2916000859 2916007488 259
76 iso_pu_bacteria 2916014648 2916016801 259
77 iso_pu_bacteria 2916021584 2916025106 259
78 iso_pu_bacteria 2916028427 2916029043 259
79 iso_pu_bacteria 2916035215 2916041699 259
80 iso_pu_bacteria 2916041962 2916044102 259
81 iso_pu_bacteria 2916048683 2916054139 259
82 iso_pu_bacteria 2916055098 2916061657 259
83 iso_pu_bacteria 2916068649 2916073570 259
84 iso_pu_bacteria 2921201388 2921202902 259
85 iso_pu_bacteria 2921208531 2921213550 259
86 iso_pu_bacteria 2921237296 2921239076 259
87 iso_pu_bacteria 2921244191 2921250382 259
88 iso_pu_bacteria 2921257292 2921257402 259
89 iso_pu_bacteria 2921263974 2921264626 259
90 iso_pu_bacteria 2921282425 2921283055 259
91 iso_pu_bacteria 2921289301 2921293243 259
92 iso_pu_bacteria 2921296804 2921301593 259
93 iso_pu_bacteria 2924144063 2924149638 259
94 iso_pu_bacteria 2924150972 2924156004 259
95 iso_pu_bacteria 2924158325 2924159028 259
96 iso_pu_bacteria 2924165586 2924167793 259
97 iso_pu_bacteria 2924172951 2924175469 259
98 iso_pu_bacteria 2924179722 2924182200 259
99 iso_pu_bacteria 2924186466 2924187574 259
100 iso_pu_bacteria 2924193448 2924198910 259
101 iso_pu_bacteria 2924200457 2924205378 259
102 iso_pu_bacteria 2924207177 2924213829 259
103 iso_pu_bacteria 2924214083 2924216554 259
104 iso_pu_bacteria 2924221636 2924225459 259
105 iso_pu_bacteria 2936996657 2936997989 259
106 iso_pu_bacteria 2937002841 2937007408 259
107 iso_pu_bacteria 2937009748 2937012624 259
108 iso_pu_bacteria 2937016420 2937019749 259
109 iso_pu_bacteria 2937023124 2937029319 259
110 iso_pu_bacteria 2937042894 2937044994 259
111 iso_pu_bacteria 2937049772 2937050515 259
112 iso_pu_bacteria 2937056579 2937057743 259
113 iso_pu_bacteria 2937063883 2937065646 259
114 iso_pu_bacteria 2937071275 2937076514 259
115 iso_pu_bacteria 2937091812 2937095896 259
116 iso_pu_bacteria 2937098957 2937100152 259
117 iso_pu_bacteria 2937106411 2937107395 259
118 iso_pu_bacteria 2937113482 2937118381 259
119 iso_pu_bacteria 2937119839 2937122394 259
120 iso_pu_bacteria 2937126314 2937130367 259
121 iso_pu_bacteria 2957382221 2957386408 259
122 iso_pu_bacteria 2957388812 2957389806 259
123 iso_pu_bacteria 2957395598 2957399935 259
124 iso_pu_bacteria 2957402308 2957406780 259
125 iso_pu_bacteria 2957408893 2957410185 259
126 iso_pu_bacteria 2957415311 2957420243 259
127 iso_pu_bacteria 2957422303 2957423444 259
128 iso_pu_bacteria 2957430029 2957433068 259
129 iso_pu_bacteria 2957443900 2957445486 259
130 iso_pu_bacteria 2957450854 2957453859 259
131 iso_pu_bacteria 2957457609 2957459770 259
132 iso_pu_bacteria 2957464669 2957465763 259
133 iso_pu_bacteria 2957471148 2957476580 259
134 iso_pu_bacteria 2957478035 2957478587 259
135 iso_pu_bacteria 2957484790 2957490061 259
136 iso_pu_bacteria 2957491536 2957494820 259
137 iso_pu_bacteria 2957498199 2957502555 259
138 iso_pu_bacteria 2957505466 2957511711 259
139 iso_pu_bacteria 2960584000 2960588904 259
140 iso_pu_bacteria 2960603979 2960605326 259
141 iso_pu_bacteria 2960610863 2960616502 259
142 iso_pu_bacteria 2960617483 2960618852 259
143 iso_pu_bacteria 2960624210 2960629636 259
144 iso_pu_bacteria 2960637947 2960645169 259
145 iso_pu_bacteria 2960645483 2960648566 259
146 iso_pu_bacteria 2960652885 2960655230 259
147 iso_pu_bacteria 2960660292 2960664190 259
148 iso_pu_bacteria 2960667422 2960669568 259
149 iso_pu_bacteria 2960674078 2960679524 259
150 iso_pu_bacteria 2960687367 2960688787 259
151 iso_pu_bacteria 2964607997 2964614069 259
152 iso_pu_bacteria 2964615318 2964616125 259
153 iso_pu_bacteria 2964621998 2964627565 259
154 iso_pu_bacteria 2964628898 2964632123 259
155 iso_pu_bacteria 2964636051 2964639282 259
156 iso_pu_bacteria 2964643177 2964648864 259
157 iso_pu_bacteria 2964649959 2964652113 259
158 iso_pu_bacteria 2964656573 2964662765 259
159 iso_pu_bacteria 2964663802 2964665070 259
160 iso_pu_bacteria 2964670856 2964677348 259
161 iso_pu_bacteria 2964678106 2964679823 259
162 iso_pu_bacteria 2964691889 2964694670 259
163 iso_pu_bacteria 2964698721 2964704111 259
164 iso_pu_bacteria 2964705432 2964708992 259
165 iso_pu_bacteria 2964712639 2964716179 259
166 iso_pu_bacteria 2964719344 2964724348 259
167 iso_pu_bacteria 2967664464 2967667102 259
168 iso_pu_bacteria 2967671571 2967672939 259
169 iso_pu_bacteria 2967678726 2967683872 259
170 iso_pu_bacteria 2967693043 2967693537 259
171 iso_pu_bacteria 2967706974 2967711680 259
172 iso_pu_bacteria 2967714385 2967715675 259
173 iso_pu_bacteria 2967721400 2967726818 259
174 iso_pu_bacteria 2967735183 2967736488 259
175 iso_pu_bacteria 2967742019 2967746917 259
176 iso_pu_bacteria 2967748971 2967749988 259
177 iso_pu_bacteria 2967755722 2967761052 259
178 iso_pu_bacteria 2967769361 2967770653 259
179 iso_pu_bacteria 2967775926 2967780835 259
180 iso_pu_bacteria 2970019648 2970022504 259
181 iso_pu_bacteria 2970033650 2970035807 259
182 iso_pu_bacteria 2970040964 2970041611 259
183 iso_pu_bacteria 2970047711 2970052500 259
184 iso_pu_bacteria 2970054988 2970061325 259
185 iso_pu_bacteria 2970061556 2970062478 259
186 iso_pu_bacteria 2970068827 2970070659 259
187 iso_pu_bacteria 2970076120 2970077353 259
188 iso_pu_bacteria 2970082768 2970085208 259
189 iso_pu_bacteria 2970088815 2970092227 259
190 iso_pu_bacteria 2970095765 2970102364 259
191 iso_pu_bacteria 2970102677 2970104213 259
192 iso_pu_bacteria 2970109326 2970115012 259
193 iso_pu_bacteria 2970116247 2970120127 259
194 iso_pu_bacteria 2970129317 2970130236 259
195 iso_pu_bacteria 2970136068 2970137153 259
196 iso_pu_bacteria 2970149975 2970151252 259
197 iso_pu_bacteria 2970156795 2970158727 259
198 iso_pu_bacteria 2970164137 2970170469 259
199 iso_pu_bacteria 2970170962 2970172137 259
200 iso_pu_bacteria 2970177841 2970181599 259
201 iso_pu_bacteria 2970184632 2970185581 259
202 iso_pu_bacteria 2970191845 2970193884 259
203 iso_pu_bacteria 2977516862 2977521155 259
204 iso_pu_bacteria 2977523885 2977526776 259
205 iso_pu_bacteria 2977537788 2977541742 259
206 iso_pu_bacteria 2977551784 2977554463 259
207 iso_pu_bacteria 2977558990 2977562605 259
208 iso_pu_bacteria 2977565890 2977571108 259
209 iso_pu_bacteria 2977572785 2977577357 259
210 iso_pu_bacteria 2977579622 2977583667 259
211 iso_pu_bacteria 648276728 648738951 259
212 iso_pu_bacteria 8003992118 8003993447 259
213 3300013102 Ga0157371_10000264 Ga0157371_1000026430 260
214 iso_pu_bacteria 8055693939 8055694446 260
215 3300005563 Ga0068855_100000360 Ga0068855_10000036064 261
216 3300005614 Ga0068856_100592914 Ga0068856_1005929141 261
217 3300014497 Ga0182008_10000050 Ga0182008_1000005030 261
218 3300025207 Ga0209760_100041 Ga0209760_10004130 261
219 3300025231 Ga0207427_100104 Ga0207427_10010456 261
220 3300025233 Ga0209437_100348 Ga0209437_10034819 261
221 3300025261 Ga0209233_1000202 Ga0209233_100020256 261
222 3300025935 Ga0207709_10000280 Ga0207709_1000028023 261
223 3300025949 Ga0207667_10000430 Ga0207667_1000043064 261
224 3300026078 Ga0207702_10496715 Ga0207702_104967151 261
225 3300037471 Ga0395905_0000435 Ga0395905_0000435_12765_13571 261
226 3300042013 Ga0439456_030539 Ga0439456_030539_103_918 261
227 iso_pu_bacteria 2510917030 2511199159 261
228 iso_pu_bacteria 2582581298 2585222989 261
229 iso_pu_bacteria 2585427529 2585545572 261
230 iso_pu_bacteria 2643221599 2644007129 261
231 iso_pu_bacteria 2919100787 2919106327 261
232 iso_pu_bacteria 3005445848 3005448584 261
233 iso_pu_bacteria 3005452660 3005454817 261
234 iso_pu_bacteria 8057798959 8057801576 261
235 3300041441 Ga0451787_506080 Ga0451787_506080_1114_1902 262
236 3300049574 Ga0501038_0002883 Ga0501038_0002883_3431_4270 262
237 3300049580 Ga0501046_0012416 Ga0501046_0012416_1212_2129 262
238 iso_pu_bacteria 2509276033 2509447246 262
239 iso_pu_bacteria 2510065019 2510134084 262
240 iso_pu_bacteria 2510461076 2510895510 262
241 iso_pu_bacteria 2510917022 2511136752 262
242 iso_pu_bacteria 2513237084 2513567843 262
243 iso_pu_bacteria 2513237085 2513577083 262
244 iso_pu_bacteria 2513237093 2513633250 262
245 iso_pu_bacteria 2513237103 2513707744 262
246 iso_pu_bacteria 2515075009 2515113187 262
247 iso_pu_bacteria 2515154114 2515645794 262
248 iso_pu_bacteria 2515154116 2515655218 262
249 iso_pu_bacteria 2515154134 2515739617 262
250 iso_pu_bacteria 2516653077 2517036849 262
251 iso_pu_bacteria 2516653085 2517077213 262
252 iso_pu_bacteria 2517093000 2517095961 262
253 iso_pu_bacteria 2517287029 2517407584 262
254 iso_pu_bacteria 2529292951 2530646668 262
255 iso_pu_bacteria 2554235341 2555671117 262
256 iso_pu_bacteria 2582581283 2585167362 262
257 iso_pu_bacteria 2582581294 2585202081 262
258 iso_pu_bacteria 2582581306 2585265584 262
259 iso_pu_bacteria 2582581307 2585271258 262
260 iso_pu_bacteria 2582581308 2585279196 262
261 iso_pu_bacteria 2582581315 2585323201 262
262 iso_pu_bacteria 2582581316 2585331306 262
263 iso_pu_bacteria 2582581865 2585388789 262
264 iso_pu_bacteria 2585427526 2585524640 262
265 iso_pu_bacteria 2585427527 2585531319 262
266 iso_pu_bacteria 2585427530 2585552758 262
267 iso_pu_bacteria 2585427531 2585559003 262
268 iso_pu_bacteria 2585427593 2585836281 262
269 iso_pu_bacteria 2585427609 2585904050 262
270 iso_pu_bacteria 2585428125 2587980832 262
271 iso_pu_bacteria 2599185160 2599358396 262
272 iso_pu_bacteria 2599185161 2599364734 262
273 iso_pu_bacteria 2599185162 2599371055 262
274 iso_pu_bacteria 2599185163 2599377434 262
275 iso_pu_bacteria 2599185164 2599383741 262
276 iso_pu_bacteria 2599185165 2599390008 262
277 iso_pu_bacteria 2599185166 2599396288 262
278 iso_pu_bacteria 2599185168 2599408475 262
279 iso_pu_bacteria 2599185181 2599465390 262
280 iso_pu_bacteria 2599185182 2599471697 262
281 iso_pu_bacteria 2599185186 2599494234 262
282 iso_pu_bacteria 2599185352 2600197150 262
283 iso_pu_bacteria 2599185356 2600211624 262
284 iso_pu_bacteria 2600255313 2601771780 262
285 iso_pu_bacteria 2615840624 2616293229 262
286 iso_pu_bacteria 2615840626 2616311363 262
287 iso_pu_bacteria 2617270742 2617383680 262
288 iso_pu_bacteria 2643221607 2644050313 262
289 iso_pu_bacteria 2643221618 2644107948 262
290 iso_pu_bacteria 2643221626 2644148380 262
291 iso_pu_bacteria 2643221636 2644204625 262
292 iso_pu_bacteria 2643221655 2644309342 262
293 iso_pu_bacteria 2643221659 2644333168 262
294 iso_pu_bacteria 2643221686 2644483233 262
295 iso_pu_bacteria 2643221698 2644545660 262
296 iso_pu_bacteria 2643221712 2644615284 262
297 iso_pu_bacteria 2643221723 2644673596 262
298 iso_pu_bacteria 2667528171 2671100914 262
299 iso_pu_bacteria 2718217882 2719181927 262
300 iso_pu_bacteria 2718217927 2719386539 262
301 iso_pu_bacteria 2718217997 2719666286 262
302 iso_pu_bacteria 2718218009 2719732644 262
303 iso_pu_bacteria 2718218199 2720492706 262
304 iso_pu_bacteria 2718218232 2720614176 262
305 iso_pu_bacteria 2718218233 2720620944 262
306 iso_pu_bacteria 2718218235 2720632268 262
307 iso_pu_bacteria 2718218269 2720775996 262
308 iso_pu_bacteria 2718218363 2721148018 262
309 iso_pu_bacteria 2718218365 2721159469 262
310 iso_pu_bacteria 2718218366 2721164854 262
311 iso_pu_bacteria 2718218423 2721400243 262
312 iso_pu_bacteria 2721755514 2722841024 262
313 iso_pu_bacteria 2721755556 2723027594 262
314 iso_pu_bacteria 2721755685 2723567846 262
315 iso_pu_bacteria 2721755809 2724039056 262
316 iso_pu_bacteria 2721755810 2724045400 262
317 iso_pu_bacteria 2721755819 2724090603 262
318 iso_pu_bacteria 2721755822 2724105111 262
319 iso_pu_bacteria 2721755823 2724110938 262
320 iso_pu_bacteria 2724679232 2725951142 262
321 iso_pu_bacteria 2728369352 2730108530 262
322 iso_pu_bacteria 2728369365 2730165162 262
323 iso_pu_bacteria 2728369397 2730299101 262
324 iso_pu_bacteria 2738541333 2739032968 262
325 iso_pu_bacteria 2775507266 2778175559 262
326 iso_pu_bacteria 2791355256 2793294308 262
327 iso_pu_bacteria 2791355259 2793315960 262
328 iso_pu_bacteria 2791355262 2793335348 262
329 iso_pu_bacteria 2791355263 2793339395 262
330 iso_pu_bacteria 2791355264 2793347119 262
331 iso_pu_bacteria 2791355265 2793351713 262
332 iso_pu_bacteria 2791355267 2793367764 262
333 iso_pu_bacteria 2802429605 2805926943 262
334 iso_pu_bacteria 2802429606 2805932856 262
335 iso_pu_bacteria 2802429633 2806045107 262
336 iso_pu_bacteria 2802429634 2806050099 262
337 iso_pu_bacteria 2802429635 2806056937 262
338 iso_pu_bacteria 2802429636 2806064318 262
339 iso_pu_bacteria 2802429637 2806071585 262
340 iso_pu_bacteria 2818991448 2819609267 262
341 iso_pu_bacteria 2818991453 2819641424 262
342 iso_pu_bacteria 2818991464 2819705923 262
343 iso_pu_bacteria 2838016132 2838021584 262
344 iso_pu_bacteria 2838022645 2838023724 262
345 iso_pu_bacteria 2838042994 2838045087 262
346 iso_pu_bacteria 2838048938 2838053421 262
347 iso_pu_bacteria 2838061910 2838065543 262
348 iso_pu_bacteria 2838068647 2838070020 262
349 iso_pu_bacteria 2838680041 2838683327 262
350 iso_pu_bacteria 2838686498 2838686914 262
351 iso_pu_bacteria 2838694306 2838697729 262
352 iso_pu_bacteria 2838707686 2838710845 262
353 iso_pu_bacteria 2838729681 2838730128 262
354 iso_pu_bacteria 2838742623 2838742857 262
355 iso_pu_bacteria 2841851746 2841852360 262
356 iso_pu_bacteria 2841864319 2841867084 262
357 iso_pu_bacteria 2842077413 2842079018 262
358 iso_pu_bacteria 2842110456 2842113134 262
359 iso_pu_bacteria 2842118031 2842118472 262
360 iso_pu_bacteria 2842156927 2842158182 262
361 iso_pu_bacteria 2842163707 2842168659 262
362 iso_pu_bacteria 2842180545 2842181802 262
363 iso_pu_bacteria 2842192696 2842198702 262
364 iso_pu_bacteria 2842198810 2842199238 262
365 iso_pu_bacteria 2842205361 2842209688 262
366 iso_pu_bacteria 2842217011 2842218073 262
367 iso_pu_bacteria 2842229732 2842230148 262
368 iso_pu_bacteria 2842237096 2842240383 262
369 iso_pu_bacteria 2842243621 2842244036 262
370 iso_pu_bacteria 2842257432 2842257879 262
371 iso_pu_bacteria 2842264693 2842270831 262
372 iso_pu_bacteria 2842271015 2842271548 262
373 iso_pu_bacteria 2842278818 2842283142 262
374 iso_pu_bacteria 2842285085 2842285475 262
375 iso_pu_bacteria 2842291075 2842292680 262
376 iso_pu_bacteria 2842298080 2842298109 262
377 iso_pu_bacteria 2842304105 2842305179 262
378 iso_pu_bacteria 2842311132 2842317059 262
379 iso_pu_bacteria 2842317721 2842320842 262
380 iso_pu_bacteria 2842357229 2842360291 262
381 iso_pu_bacteria 2842363717 2842370198 262
382 iso_pu_bacteria 2842370503 2842373958 262
383 iso_pu_bacteria 2842377471 2842379078 262
384 iso_pu_bacteria 2842384541 2842384982 262
385 iso_pu_bacteria 2842395702 2842400218 262
386 iso_pu_bacteria 2842402390 2842402835 262
387 iso_pu_bacteria 2842409023 2842409794 262
388 iso_pu_bacteria 2842415677 2842416443 262
389 iso_pu_bacteria 2842422224 2842423634 262
390 iso_pu_bacteria 2842428310 2842434714 262
391 iso_pu_bacteria 2842434925 2842441090 262
392 iso_pu_bacteria 2842441272 2842447708 262
393 iso_pu_bacteria 2842447887 2842449423 262
394 iso_pu_bacteria 2842462802 2842469075 262
395 iso_pu_bacteria 2842469257 2842475637 262
396 iso_pu_bacteria 2842495871 2842496622 262
397 iso_pu_bacteria 2842509118 2842510973 262
398 iso_pu_bacteria 2844163670 2844167316 262
399 iso_pu_bacteria 2844454524 2844458211 262
400 iso_pu_bacteria 2844665904 2844671667 262
401 iso_pu_bacteria 2852387548 2852390385 262
402 iso_pu_bacteria 2857516855 2857517296 262
403 iso_pu_bacteria 2917070673 2917074978 262
404 iso_pu_bacteria 2920822456 2920824470 262
405 iso_pu_bacteria 2933570622 2933570986 262
406 iso_pu_bacteria 2933586486 2933588809 262
407 iso_pu_bacteria 2933599457 2933600826 262
408 iso_pu_bacteria 2935353572 2935355034 262
409 iso_pu_bacteria 2935894831 2935896885 262
410 iso_pu_bacteria 2935901341 2935901821 262
411 iso_pu_bacteria 2936367885 2936371906 262
412 iso_pu_bacteria 2936375103 2936379741 262
413 iso_pu_bacteria 2996893221 2996895022 262
414 iso_pu_bacteria 639633055 639649308 262
415 iso_pu_bacteria 8005275841 8005281343 262
416 iso_pu_bacteria 8005282627 8005284685 262
417 iso_pu_bacteria 8005289223 8005295649 262
418 iso_pu_bacteria 8005301065 8005303259 262
419 iso_pu_bacteria 8005307578 8005309526 262
420 iso_pu_bacteria 8005376324 8005381060 262
421 iso_pu_bacteria 8005382845 8005388992 262
422 iso_pu_bacteria 8005395548 8005395976 262
423 iso_pu_bacteria 8005430974 8005437413 262
424 iso_pu_bacteria 8005460587 8005463870 262
425 iso_pu_bacteria 8005556819 8005556887 262
426 iso_pu_bacteria 8005563573 8005568129 262
427 iso_pu_bacteria 8005570704 8005573330 262
428 iso_pu_bacteria 8005626139 8005629894 262
429 iso_pu_bacteria 8005645114 8005649864 262
430 iso_pu_bacteria 8005688590 8005691968 262
431 iso_pu_bacteria 8005695170 8005697537 262
432 iso_pu_bacteria 8018127388 8018128070 262
433 iso_pu_bacteria 8018163183 8018164441 262
434 iso_pu_bacteria 8018176218 8018176921 262
435 iso_pu_bacteria 8024479707 8024482736 262
436 iso_pu_bacteria 8024501048 8024504565 262
437 iso_pu_bacteria 8046767195 8046771813 262
438 iso_pu_bacteria 8057575449 8057575571 262
439 iso_pu_bacteria 8057874678 8057878449 262
440 3300027111 Ga0209281_1000621 Ga0209281_100062119 263
441 3300031911 Ga0307412_10220453 Ga0307412_102204532 263
442 3300032002 Ga0307416_100169017 Ga0307416_1001690171 263
443 3300049823 Ga0501044_0219884 Ga0501044_0219884_140_1057 263
444 3300049823 Ga0501044_0352004 Ga0501044_0352004_398_1249 263
445 iso_pu_bacteria 2510917028 2511182574 263
446 iso_pu_bacteria 2513237138 2513869489 263
447 iso_pu_bacteria 2534681796 2535517011 263
448 iso_pu_bacteria 2582581867 2585400856 263
449 iso_pu_bacteria 2585427590 2585822242 263
450 iso_pu_bacteria 2599185170 2599417179 263
451 iso_pu_bacteria 2643221634 2644193655 263
452 iso_pu_bacteria 2838035591 2838038617 263
453 iso_pu_bacteria 2838661181 2838661462 263
454 iso_pu_bacteria 2923556063 2923559229 263
455 iso_pu_bacteria 2936381700 2936387495 263
456 iso_pu_bacteria 8005258706 8005259324 263
457 iso_pu_bacteria 8005542996 8005545824 263
458 3300041405 Ga0439438_007202 Ga0439438_007202_1766_2590 264
459 iso_pu_bacteria 2512047018 2512325166 264
460 iso_pu_bacteria 2582580891 2583793550 264
461 iso_pu_bacteria 2599185185 2599487863 264
462 iso_pu_bacteria 2740892503 2743738728 264
463 iso_pu_bacteria 2923153595 2923157793 264
464 iso_pu_bacteria 2984286254 2984288379 264
465 iso_pu_bacteria 8015687852 8015691864 264
466 iso_pu_bacteria 8055770955 8055775110 264
467 3300002773 JGI25152J39213_1009714 JGI25152J39213_10097142 265
468 3300002987 JGI25159J45721_1000393 JGI25159J45721_100039311 265
469 3300003187 JGI25151J46595_10003303 JGI25151J46595_100033036 265
470 3300003187 JGI25151J46595_10019917 JGI25151J46595_100199172 265
471 3300003187 JGI25151J46595_10027236 JGI25151J46595_100272362 265
472 3300003215 JGI25153J46596_10001757 JGI25153J46596_100017576 265
473 3300003320 rootH2_10197019 rootH2_101970192 265
474 3300003354 JGI25160J50197_1013799 JGI25160J50197_10137993 265
475 3300003374 JGI25161J50226_1000068 JGI25161J50226_100006867 265
476 3300003771 Ga0055526_1001546 Ga0055526_100154611 265
477 3300003790 Ga0055528_1001848 Ga0055528_10018483 265
478 3300004625 Ga0055543_1000470 Ga0055543_100047017 265
479 3300005262 Ga0065165_1006900 Ga0065165_10069003 265
480 3300005548 Ga0070665_100219802 Ga0070665_1002198022 265
481 3300025208 Ga0209436_100070 Ga0209436_10007013 265
482 3300025258 Ga0209129_1000454 Ga0209129_10004542 265
483 3300025258 Ga0209129_1002985 Ga0209129_10029853 265
484 3300025273 Ga0209673_1003248 Ga0209673_10032482 265
485 3300025284 Ga0209130_1000020 Ga0209130_1000020119 265
486 3300025294 Ga0209025_1016097 Ga0209025_10160973 265
487 3300025295 Ga0209564_1000588 Ga0209564_100058823 265
488 3300025297 Ga0209758_1001217 Ga0209758_10012176 265
489 3300025297 Ga0209758_1018413 Ga0209758_10184132 265
490 3300025297 Ga0209758_1018414 Ga0209758_10184142 265
491 3300025302 Ga0207426_1000008 Ga0207426_1000008188 265
492 3300025303 Ga0209051_1004736 Ga0209051_10047367 265
493 3300025972 Ga0207668_10659881 Ga0207668_106598811 265
494 3300046492 Ga0495585_0004459 Ga0495585_0004459_5473_6270 265
495 3300046501 Ga0495607_0018504 Ga0495607_0018504_1515_2312 265
496 3300046506 Ga0495583_0013880 Ga0495583_0013880_3154_3951 265
497 3300046512 Ga0495610_0036671 Ga0495610_0036671_815_1612 265
498 3300046513 Ga0495616_0006680 Ga0495616_0006680_5480_6277 265
499 3300046518 Ga0495631_0000627 Ga0495631_0000627_16540_17337 265
500 3300046519 Ga0495632_0013093 Ga0495632_0013093_1056_1853 265
501 3300046522 Ga0495643_0017682 Ga0495643_0017682_466_1263 265
502 3300046616 Ga0495668_0025358 Ga0495668_0025358_235_1032 265
503 3300046648 Ga0495611_0009214 Ga0495611_0009214_3101_3898 265
504 3300046694 Ga0495649_0031399 Ga0495649_0031399_608_1405 265
505 3300046810 Ga0495660_0012839 Ga0495660_0012839_1841_2638 265
506 3300048091 Ga0495626_0061655 Ga0495626_0061655_397_1194 265
507 3300048921 Ga0496118_0041646 Ga0496118_0041646_2765_3562 265
508 3300048924 Ga0496121_0017363 Ga0496121_0017363_4155_4952 265
509 3300048924 Ga0496121_0191165 Ga0496121_0191165_341_1138 265
510 3300048924 Ga0496121_0233904 Ga0496121_0233904_376_1173 265
511 3300048925 Ga0496122_0039175 Ga0496122_0039175_2772_3569 265
512 3300048925 Ga0496122_0104215 Ga0496122_0104215_421_1218 265
513 3300048926 Ga0496123_0016107 Ga0496123_0016107_2360_3157 265
514 3300048926 Ga0496123_0107461 Ga0496123_0107461_249_1046 265
515 3300048927 Ga0496124_0123284 Ga0496124_0123284_177_974 265
516 3300048929 Ga0496126_0174171 Ga0496126_0174171_481_1278 265
517 3300049459 Ga0495678_060953 Ga0495678_060953_322_1119 265
518 3300049460 Ga0495682_0094722 Ga0495682_0094722_205_1002 265
519 3300053104 Ga0500556_0133097 Ga0500556_0133097_65_862 265
520 3300053105 Ga0500557_004893 Ga0500557_004893_954_1751 265
521 3300053108 Ga0500562_014636 Ga0500562_014636_153_950 265
522 3300053108 Ga0500562_057034 Ga0500562_057034_240_1037 265
523 3300053109 Ga0500569_019294 Ga0500569_019294_65_862 265
524 3300053118 Ga0500594_0001268 Ga0500594_0001268_965_1762 265
525 3300053139 Ga0500568_0001590 Ga0500568_0001590_7643_8440 265
526 3300053139 Ga0500568_0013202 Ga0500568_0013202_953_1750 265
527 3300053153 Ga0500616_0007889 Ga0500616_0007889_150_947 265
528 3300053156 Ga0500622_0003787 Ga0500622_0003787_4965_5762 265
529 3300053158 Ga0500627_0015321 Ga0500627_0015321_103_900 265
530 3300053730 Ga0500645_009303 Ga0500645_009303_2162_2959 265
531 iso_pu_bacteria 2791355260 2793319307 265
532 iso_pu_bacteria 8019769354 8019775711 265
533 3300002737 JGI25162J39368_1000081 JGI25162J39368_100008153 266
534 3300002739 JGI25158J39367_1003941 JGI25158J39367_10039412 266
535 3300002771 JGI25163J39215_1000016 JGI25163J39215_100001618 266
536 3300002772 JGI25164J39214_1000060 JGI25164J39214_100006030 266
537 3300002987 JGI25159J45721_1000029 JGI25159J45721_100002931 266
538 3300003214 JGI25165J46597_1000153 JGI25165J46597_100015330 266
539 3300003316 rootH1_10085227 rootH1_100852274 266
540 3300003320 rootH2_10112232 rootH2_101122322 266
541 3300003322 rootL2_10001966 rootL2_100019663 266
542 3300003323 rootH1_10033048 rootH1_100330481 266
543 3300003354 JGI25160J50197_1000011 JGI25160J50197_1000011226 266
544 3300003354 JGI25160J50197_1005624 JGI25160J50197_10056245 266
545 3300003374 JGI25161J50226_1000152 JGI25161J50226_100015220 266
546 3300003374 JGI25161J50226_1004423 JGI25161J50226_10044232 266
547 3300003771 Ga0055526_1002259 Ga0055526_100225913 266
548 3300003771 Ga0055526_1002927 Ga0055526_10029279 266
549 3300003775 Ga0055524_1008256 Ga0055524_10082562 266
550 3300003775 Ga0055524_1023545 Ga0055524_10235452 266
551 3300003781 Ga0055536_1000356 Ga0055536_10003563 266
552 3300003790 Ga0055528_1001003 Ga0055528_100100318 266
553 3300003790 Ga0055528_1007339 Ga0055528_10073392 266
554 3300003790 Ga0055528_1020168 Ga0055528_10201682 266
555 3300003794 Ga0055531_10002064 Ga0055531_100020649 266
556 3300004625 Ga0055543_1000097 Ga0055543_100009731 266
557 3300005262 Ga0065165_1000018 Ga0065165_1000018226 266
558 3300005262 Ga0065165_1061827 Ga0065165_10618271 266
559 3300005337 Ga0070682_100046011 Ga0070682_1000460114 266
560 3300005339 Ga0070660_100384467 Ga0070660_1003844671 266
561 3300005535 Ga0070684_100296218 Ga0070684_1002962182 266
562 3300005563 Ga0068855_100145188 Ga0068855_1001451882 266
563 3300005616 Ga0068852_100416227 Ga0068852_1004162271 266
564 3300005834 Ga0068851_10061411 Ga0068851_100614112 266
565 3300005937 Ga0081455_10410500 Ga0081455_104105001 266
566 3300006038 Ga0075365_10008493 Ga0075365_100084933 266
567 3300006042 Ga0075368_10067142 Ga0075368_100671422 266
568 3300006177 Ga0075362_10007517 Ga0075362_100075173 266
569 3300006178 Ga0075367_10085089 Ga0075367_100850892 266
570 3300006186 Ga0075369_10071718 Ga0075369_100717182 266
571 3300006195 Ga0075366_10003422 Ga0075366_100034227 266
572 3300006353 Ga0075370_10048128 Ga0075370_100481282 266
573 3300009093 Ga0105240_10000014 Ga0105240_10000014388 266
574 3300009148 Ga0105243_10000310 Ga0105243_1000031021 266
575 3300009148 Ga0105243_10687524 Ga0105243_106875242 266
576 3300009545 Ga0105237_10001251 Ga0105237_100012514 266
577 3300009765 Ga0123341_1000028 Ga0123341_100002832 266
578 3300009766 Ga0123342_1028435 Ga0123342_10284352 266
579 3300013104 Ga0157370_10000248 Ga0157370_1000024835 266
580 3300013105 Ga0157369_10492075 Ga0157369_104920752 266
581 3300013249 Ga0171463_1008 Ga0171463_1008106 266
582 3300015262 Ga0182007_10003611 Ga0182007_100036116 266
583 3300015690 Ga0183363_1112 Ga0183363_11125 266
584 3300025208 Ga0209436_100897 Ga0209436_1008976 266
585 3300025245 Ga0207425_1001479 Ga0207425_10014793 266
586 3300025253 Ga0209677_101078 Ga0209677_1010782 266
587 3300025258 Ga0209129_1004740 Ga0209129_10047405 266
588 3300025261 Ga0209233_1000148 Ga0209233_10001487 266
589 3300025263 Ga0209565_1028280 Ga0209565_10282802 266
590 3300025273 Ga0209673_1000025 Ga0209673_1000025306 266
591 3300025273 Ga0209673_1001232 Ga0209673_10012323 266
592 3300025284 Ga0209130_1000029 Ga0209130_100002930 266
593 3300025292 Ga0209676_1000438 Ga0209676_100043833 266
594 3300025294 Ga0209025_1000033 Ga0209025_1000033167 266
595 3300025294 Ga0209025_1000091 Ga0209025_100009131 266
596 3300025295 Ga0209564_1000275 Ga0209564_100027569 266
597 3300025295 Ga0209564_1000644 Ga0209564_100064459 266
598 3300025295 Ga0209564_1000883 Ga0209564_100088331 266
599 3300025297 Ga0209758_1001396 Ga0209758_10013964 266
600 3300025298 Ga0209050_1000516 Ga0209050_100051631 266
601 3300025299 Ga0209256_1000924 Ga0209256_100092411 266
602 3300025299 Ga0209256_1005850 Ga0209256_10058506 266
603 3300025302 Ga0207426_1000074 Ga0207426_1000074267 266
604 3300025302 Ga0207426_1000218 Ga0207426_100021881 266
605 3300025303 Ga0209051_1001494 Ga0209051_100149414 266
606 3300025303 Ga0209051_1006706 Ga0209051_10067063 266
607 3300025304 Ga0209257_1000569 Ga0209257_100056923 266
608 3300025913 Ga0207695_10000037 Ga0207695_10000037390 266
609 3300025914 Ga0207671_10004383 Ga0207671_100043836 266
610 3300025944 Ga0207661_10167251 Ga0207661_101672513 266
611 3300025949 Ga0207667_10038463 Ga0207667_100384633 266
612 3300027866 Ga0209813_10037095 Ga0209813_100370952 266
613 3300028794 Ga0307515_10021842 Ga0307515_1002184211 266
614 3300041443 Ga0451789_0788741 Ga0451789_0788741_188_988 266
615 3300041486 Ga0451807_0045927 Ga0451807_0045927_181_981 266
616 3300041491 Ga0451833_0097459 Ga0451833_0097459_372_1172 266
617 3300041491 Ga0451833_0097858 Ga0451833_0097858_537_1337 266
618 3300041492 Ga0451835_0224880 Ga0451835_0224880_519_1319 266
619 3300041492 Ga0451835_1237521 Ga0451835_1237521_111_911 266
620 3300041494 Ga0451837_0969126 Ga0451837_0969126_745_1545 266
621 3300041496 Ga0451839_0380119 Ga0451839_0380119_453_1253 266
622 3300041498 Ga0451841_0047569 Ga0451841_0047569_654_1454 266
623 3300041503 Ga0451847_0182853 Ga0451847_0182853_351_1151 266
624 3300041505 Ga0451849_1174138 Ga0451849_1174138_111_911 266
625 3300041512 Ga0451853_0010833 Ga0451853_0010833_484_1284 266
626 3300041512 Ga0451853_2734846 Ga0451853_2734846_1041_1841 266
627 3300046460 Ga0495638_0126249 Ga0495638_0126249_309_1109 266
628 3300046474 Ga0495605_0067923 Ga0495605_0067923_203_1003 266
629 3300046501 Ga0495607_0012593 Ga0495607_0012593_1777_2577 266
630 3300046507 Ga0495606_0108135 Ga0495606_0108135_92_892 266
631 3300046512 Ga0495610_0046222 Ga0495610_0046222_448_1248 266
632 3300046513 Ga0495616_0054958 Ga0495616_0054958_133_933 266
633 3300046515 Ga0495620_0021011 Ga0495620_0021011_667_1467 266
634 3300046518 Ga0495631_0034272 Ga0495631_0034272_223_1023 266
635 3300046522 Ga0495643_0003546 Ga0495643_0003546_3112_3912 266
636 3300046524 Ga0495648_0092903 Ga0495648_0092903_362_1162 266
637 3300046538 Ga0495609_0076261 Ga0495609_0076261_590_1390 266
638 3300046542 Ga0495597_0010430 Ga0495597_0010430_3373_4173 266
639 3300046648 Ga0495611_0046262 Ga0495611_0046262_1081_1881 266
640 3300046660 Ga0495625_0083670 Ga0495625_0083670_284_1084 266
641 3300046660 Ga0495625_0117552 Ga0495625_0117552_702_1502 266
642 3300046692 Ga0495671_0078996 Ga0495671_0078996_800_1600 266
643 3300046694 Ga0495649_0081402 Ga0495649_0081402_724_1524 266
644 3300046810 Ga0495660_0122000 Ga0495660_0122000_66_866 266
645 3300046810 Ga0495660_0138959 Ga0495660_0138959_52_852 266
646 3300047472 Ga0495686_0016214 Ga0495686_0016214_3358_4158 266
647 3300048904 Ga0496101_0014663 Ga0496101_0014663_3525_4328 266
648 3300048905 Ga0496102_0021862 Ga0496102_0021862_1462_2265 266
649 3300048905 Ga0496102_0135123 Ga0496102_0135123_1185_1997 266
650 3300048906 Ga0496103_0032993 Ga0496103_0032993_1208_2011 266
651 3300048909 Ga0496106_0105275 Ga0496106_0105275_677_1480 266
652 3300048914 Ga0496111_0373548 Ga0496111_0373548_100_909 266
653 3300048916 Ga0496113_0016669 Ga0496113_0016669_1608_2411 266
654 3300048919 Ga0496116_0000290 Ga0496116_0000290_49512_50315 266
655 3300048919 Ga0496116_0187617 Ga0496116_0187617_27_830 266
656 3300048920 Ga0496117_0023215 Ga0496117_0023215_725_1528 266
657 3300048920 Ga0496117_0023913 Ga0496117_0023913_1005_1808 266
658 3300048921 Ga0496118_0029235 Ga0496118_0029235_1005_1808 266
659 3300048922 Ga0496119_0014493 Ga0496119_0014493_1595_2398 266
660 3300048923 Ga0496120_0007629 Ga0496120_0007629_2819_3622 266
661 3300048924 Ga0496121_0000255 Ga0496121_0000255_35528_36331 266
662 3300048924 Ga0496121_0011982 Ga0496121_0011982_4805_5608 266
663 3300048925 Ga0496122_0000654 Ga0496122_0000654_35800_36603 266
664 3300048925 Ga0496122_0113041 Ga0496122_0113041_261_1064 266
665 3300048926 Ga0496123_0000688 Ga0496123_0000688_31150_31953 266
666 3300048927 Ga0496124_0028074 Ga0496124_0028074_2954_3757 266
667 3300048929 Ga0496126_0352434 Ga0496126_0352434_374_1177 266
668 3300049572 Ga0501036_0044152 Ga0501036_0044152_339_1139 266
669 3300049573 Ga0501037_0112854 Ga0501037_0112854_1028_1828 266
670 3300049574 Ga0501038_0034683 Ga0501038_0034683_2181_2981 266
671 3300049575 Ga0501039_0036784 Ga0501039_0036784_2832_3632 266
672 3300049742 Ga0501080_0043793 Ga0501080_0043793_1272_2072 266
673 3300050489 nmdc:mga03683_2591_c1 nmdc:mga03683_2591_c1_1164_1964 266
674 3300050489 nmdc:mga03683_36703_c1 nmdc:mga03683_36703_c1_681_1481 266
675 3300050490 nmdc:mga03n38_16653_c1 nmdc:mga03n38_16653_c1_1235_2035 266
676 3300050490 nmdc:mga03n38_40727_c1 nmdc:mga03n38_40727_c1_846_1646 266
677 3300050492 nmdc:mga0yw44_4173_c1 nmdc:mga0yw44_4173_c1_2092_2892 266
678 3300050493 nmdc:mga0k408_12228_c1 nmdc:mga0k408_12228_c1_1024_1824 266
679 3300050495 nmdc:mga04h51_31543_c1 nmdc:mga04h51_31543_c1_720_1520 266
680 3300050496 nmdc:mga07m45_3201_c1 nmdc:mga07m45_3201_c1_3485_4285 266
681 3300053086 Ga0500578_0010727 Ga0500578_0010727_4635_5435 266
682 3300053109 Ga0500569_001663 Ga0500569_001663_931_1731 266
683 3300053125 Ga0500618_002324 Ga0500618_002324_3440_4243 266
684 3300053153 Ga0500616_0009563 Ga0500616_0009563_4677_5477 266
685 3300053158 Ga0500627_0036194 Ga0500627_0036194_1187_1987 266
686 3300053177 Ga0500636_0107794 Ga0500636_0107794_755_1558 266
687 iso_pu_bacteria 2512875026 2512971767 266
688 iso_pu_bacteria 2513237089 2513605242 266
689 iso_pu_bacteria 2513237160 2514005315 266
690 iso_pu_bacteria 2517487022 2517569573 266
691 iso_pu_bacteria 2802428858 2802718765 266
692 iso_pu_bacteria 2802428859 2802726378 266
693 iso_pu_bacteria 2802428860 2802732917 266
694 iso_pu_bacteria 2802428861 2802738273 266
695 iso_pu_bacteria 2802428862 2802744606 266
696 iso_pu_bacteria 2802428863 2802751188 266
697 iso_pu_bacteria 2915980308 2915985319 266
698 iso_pu_bacteria 2916061851 2916062338 266
699 iso_pu_bacteria 2921250672 2921253963 266
700 iso_pu_bacteria 2937029754 2937032673 266
701 iso_pu_bacteria 2937036028 2937042391 266
702 iso_pu_bacteria 2937078374 2937082613 266
703 iso_pu_bacteria 2957375807 2957379397 266
704 iso_pu_bacteria 2957437181 2957440550 266
705 iso_pu_bacteria 2960591022 2960596255 266
706 iso_pu_bacteria 2960631154 2960632671 266
707 iso_pu_bacteria 2960680706 2960686950 266
708 iso_pu_bacteria 2967686174 2967687250 266
709 iso_pu_bacteria 2967728569 2967734392 266
710 iso_pu_bacteria 2970026789 2970029276 266
711 iso_pu_bacteria 2970122695 2970126932 266
712 iso_pu_bacteria 2970143518 2970147699 266
713 iso_pu_bacteria 2977530762 2977535727 266
714 iso_pu_bacteria 2977544691 2977550466 266
715 iso_pu_bacteria 8003999396 8004000708 266
716 3300003775 Ga0055524_1035939 Ga0055524_10359391 267
717 3300005335 Ga0070666_10051408 Ga0070666_100514083 267
718 3300005355 Ga0070671_100011067 Ga0070671_1000110672 267
719 3300005455 Ga0070663_100222403 Ga0070663_1002224031 267
720 3300005844 Ga0068862_100768220 Ga0068862_1007682201 267
721 3300006186 Ga0075369_10003366 Ga0075369_100033662 267
722 3300009011 Ga0105251_10004448 Ga0105251_100044484 267
723 3300009177 Ga0105248_10039091 Ga0105248_100390912 267
724 3300009765 Ga0123341_1068606 Ga0123341_10686062 267
725 3300009766 Ga0123342_1012989 Ga0123342_10129897 267
726 3300022740 Ga0228710_1000006 Ga0228710_1000006186 267
727 3300025258 Ga0209129_1000341 Ga0209129_100034131 267
728 3300025273 Ga0209673_1003720 Ga0209673_10037204 267
729 3300025273 Ga0209673_1024752 Ga0209673_10247522 267
730 3300025294 Ga0209025_1021964 Ga0209025_10219643 267
731 3300025295 Ga0209564_1004772 Ga0209564_10047725 267
732 3300025295 Ga0209564_1027103 Ga0209564_10271032 267
733 3300025297 Ga0209758_1040880 Ga0209758_10408802 267
734 3300025299 Ga0209256_1010630 Ga0209256_10106302 267
735 3300025299 Ga0209256_1025141 Ga0209256_10251412 267
736 3300025931 Ga0207644_10014715 Ga0207644_100147155 267
737 3300025972 Ga0207668_10060610 Ga0207668_100606102 267
738 3300026067 Ga0207678_10210311 Ga0207678_102103112 267
739 3300027111 Ga0209281_1000508 Ga0209281_10005085 267
740 3300027666 Ga0209282_1000116 Ga0209282_10001165 267
741 3300028794 Ga0307515_10019406 Ga0307515_1001940612 267
742 3300031967 Ga0315914_1000008 Ga0315914_1000008185 267
743 3300033430 Ga0315913_1002685 Ga0315913_10026854 267
744 3300033464 Ga0315915_1000058 Ga0315915_100005820 267
745 3300041404 Ga0439436_0024270 Ga0439436_0024270_824_1627 267
746 3300046558 Ga0495633_0042377 Ga0495633_0042377_680_1483 267
747 3300046660 Ga0495625_0081011 Ga0495625_0081011_1288_2091 267
748 3300046665 Ga0495661_0025571 Ga0495661_0025571_1133_1936 267
749 3300047472 Ga0495686_0126797 Ga0495686_0126797_96_899 267
750 3300048904 Ga0496101_0151638 Ga0496101_0151638_88_891 267
751 3300048905 Ga0496102_0045843 Ga0496102_0045843_976_1779 267
752 3300048907 Ga0496104_0019802 Ga0496104_0019802_2196_2999 267
753 3300048908 Ga0496105_0014556 Ga0496105_0014556_4164_4967 267
754 3300048909 Ga0496106_0079661 Ga0496106_0079661_959_1762 267
755 3300048911 Ga0496108_0040907 Ga0496108_0040907_2210_3013 267
756 3300048912 Ga0496109_0119319 Ga0496109_0119319_727_1530 267
757 3300048913 Ga0496110_0109793 Ga0496110_0109793_838_1641 267
758 3300048914 Ga0496111_0043867 Ga0496111_0043867_899_1702 267
759 3300048919 Ga0496116_0116643 Ga0496116_0116643_577_1380 267
760 3300048921 Ga0496118_0097248 Ga0496118_0097248_600_1403 267
761 3300048924 Ga0496121_0033436 Ga0496121_0033436_1601_2404 267
762 3300048926 Ga0496123_0035064 Ga0496123_0035064_951_1754 267
763 3300048927 Ga0496124_0036841 Ga0496124_0036841_603_1406 267
764 3300048927 Ga0496124_0097838 Ga0496124_0097838_1520_2356 267
765 3300049569 Ga0501032_0001541 Ga0501032_0001541_4036_4953 267
766 3300049570 Ga0501033_0009817 Ga0501033_0009817_2729_3646 267
767 3300049572 Ga0501036_0006175 Ga0501036_0006175_2528_3445 267
768 3300049574 Ga0501038_0017022 Ga0501038_0017022_291_1208 267
769 3300049575 Ga0501039_0027210 Ga0501039_0027210_177_1094 267
770 3300049579 Ga0501043_0037586 Ga0501043_0037586_1289_2206 267
771 3300049742 Ga0501080_0073626 Ga0501080_0073626_888_1691 267
772 3300049822 Ga0501035_0000979 Ga0501035_0000979_12551_13468 267
773 3300049824 Ga0501045_0305200 Ga0501045_0305200_73_990 267
774 3300003781 Ga0055536_1000015 Ga0055536_10000159 268
775 3300003791 Ga0055530_10000003 Ga0055530_100000039 268
776 3300003792 Ga0055540_1001929 Ga0055540_100192910 268
777 3300025292 Ga0209676_1000017 Ga0209676_100001751 268
778 3300025298 Ga0209050_1000076 Ga0209050_100007651 268
779 3300025303 Ga0209051_1000050 Ga0209051_1000050181 268
780 3300053134 Ga0500658_0006626 Ga0500658_0006626_1873_2679 268
781 3300053139 Ga0500568_0003502 Ga0500568_0003502_3816_4622 268
782 3300053160 Ga0500633_0000648 Ga0500633_0000648_1535_2341 268
783 3300005614 Ga0068856_100004342 Ga0068856_10000434210 269
784 3300026078 Ga0207702_10000165 Ga0207702_1000016556 269
785 3300046522 Ga0495643_0000033 Ga0495643_0000033_1832_2740 269
786 3300046524 Ga0495648_0000074 Ga0495648_0000074_107978_108796 269
787 3300049569 Ga0501032_0013623 Ga0501032_0013623_2552_3391 269
788 3300049570 Ga0501033_0000782 Ga0501033_0000782_16785_17624 269
789 3300049572 Ga0501036_0001623 Ga0501036_0001623_4916_5749 269
790 3300049574 Ga0501038_0023881 Ga0501038_0023881_2423_3256 269
791 3300049574 Ga0501038_0106280 Ga0501038_0106280_211_1050 269
792 3300049575 Ga0501039_0079512 Ga0501039_0079512_681_1520 269
793 3300049579 Ga0501043_0090908 Ga0501043_0090908_232_1071 269
794 3300049579 Ga0501043_0112237 Ga0501043_0112237_855_1688 269
795 3300049581 Ga0501047_0151717 Ga0501047_0151717_859_1698 269
796 3300049822 Ga0501035_0061785 Ga0501035_0061785_2108_2944 269
797 3300049822 Ga0501035_0208621 Ga0501035_0208621_117_950 269
798 3300049823 Ga0501044_0000384 Ga0501044_0000384_21918_22751 269
799 3300049823 Ga0501044_0033478 Ga0501044_0033478_584_1423 269
800 iso_pu_bacteria 2585427608 2585898382 269
801 3300003316 rootH1_10131537 rootH1_101315372 270
802 3300003790 Ga0055528_1000256 Ga0055528_100025619 270
803 3300006048 Ga0075363_100135800 Ga0075363_1001358002 270
804 3300009094 Ga0111539_10243148 Ga0111539_102431481 270
805 3300025258 Ga0209129_1000252 Ga0209129_100025249 270
806 3300025273 Ga0209673_1000010 Ga0209673_1000010378 270
807 3300025292 Ga0209676_1023377 Ga0209676_10233772 270
808 3300025294 Ga0209025_1002551 Ga0209025_100255113 270
809 3300025295 Ga0209564_1007448 Ga0209564_10074484 270
810 3300025299 Ga0209256_1002389 Ga0209256_100238913 270
811 iso_pu_bacteria 2524023209 2524458761 270
812 iso_pu_bacteria 2615840698 2616552262 270
813 iso_pu_bacteria 2667528174 2671114209 270
814 iso_pu_bacteria 2842475841 2842477026 270
815 iso_pu_bacteria 2842502639 2842503823 270
816 iso_pu_bacteria 2919408235 2919412466 270
817 iso_pu_bacteria 3005416602 3005416786 270
818 iso_pu_bacteria 8005314921 8005320567 270
819 iso_pu_bacteria 8005484373 8005487585 270
820 iso_pu_bacteria 8005682033 8005684202 270
821 3300003775 Ga0055524_1001331 Ga0055524_10013317 271
822 3300025299 Ga0209256_1000218 Ga0209256_1000218104 271
823 3300049574 Ga0501038_0114830 Ga0501038_0114830_1023_1931 271
824 3300049579 Ga0501043_0302254 Ga0501043_0302254_250_1158 271
825 3300049823 Ga0501044_0194596 Ga0501044_0194596_138_1046 271
826 iso_pu_bacteria 2643221557 2643808696 271
827 iso_pu_bacteria 2643221610 2644066282 271
828 iso_pu_bacteria 2643221668 2644377823 271
829 iso_pu_bacteria 2643221675 2644415505 271
830 iso_pu_bacteria 2643221680 2644450093 271
831 iso_pu_bacteria 2643221689 2644499791 271
832 iso_pu_bacteria 2643221726 2644687650 271
833 3300036401 Ga0373937_0257806 Ga0373937_0257806_252_1070 272
834 3300001979 JGI24740J21852_10043393 JGI24740J21852_100433932 274
835 3300002704 JGI25155J39150_1000003 JGI25155J39150_100000348 274
836 3300002705 JGI25156J39149_1000004 JGI25156J39149_100000442 274
837 3300002737 JGI25162J39368_1000165 JGI25162J39368_100016554 274
838 3300002737 JGI25162J39368_1000589 JGI25162J39368_100058923 274
839 3300002738 JGI25154J39366_1000013 JGI25154J39366_1000013125 274
840 3300002741 JGI25157J39369_1000004 JGI25157J39369_1000004235 274
841 3300003214 JGI25165J46597_1000068 JGI25165J46597_1000068129 274
842 3300003214 JGI25165J46597_1000233 JGI25165J46597_100023359 274
843 3300025206 Ga0209435_100006 Ga0209435_100006233 274
844 3300025233 Ga0209437_100040 Ga0209437_100040174 274
845 3300025233 Ga0209437_100067 Ga0209437_100067201 274
846 3300025246 Ga0209646_1000015 Ga0209646_1000015302 274
847 3300025250 Ga0209026_1000039 Ga0209026_1000039233 274
848 3300025256 Ga0209759_1000005 Ga0209759_1000005233 274
849 3300025261 Ga0209233_1000051 Ga0209233_1000051175 274
850 3300025261 Ga0209233_1000088 Ga0209233_1000088201 274
851 3300026078 Ga0207702_10014158 Ga0207702_100141586 274
852 3300044694 Ga0466963_0038589 Ga0466963_0038589_657_1481 274
853 3300044765 Ga0466970_0016022 Ga0466970_0016022_1826_2650 274
854 3300044842 Ga0466957_0036552 Ga0466957_0036552_1827_2651 274
855 3300045049 Ga0466959_0150878 Ga0466959_0150878_694_1518 274
856 3300045836 Ga0466958_0030668 Ga0466958_0030668_783_1607 274
857 3300045976 Ga0466967_0066790 Ga0466967_0066790_1724_2548 274
858 3300045976 Ga0466967_0078854 Ga0466967_0078854_1514_2338 274
859 3300048922 Ga0496119_0051565 Ga0496119_0051565_592_1416 274
860 3300048923 Ga0496120_0027978 Ga0496120_0027978_892_1716 274
861 3300048925 Ga0496122_0154798 Ga0496122_0154798_324_1148 274
862 3300048928 Ga0496125_0066200 Ga0496125_0066200_551_1375 274
863 iso_pu_bacteria 2842482326 2842486972 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04655

APH_6_hur

Aminoglycoside/hydroxyurea antibiotic resistance kinase

58

295

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bp9-assembly6.cif.gz_F oligopeptidase b from trypanosoma brucei with covalently bound antipain - closed form 0.8117 16 48
3w0p-assembly1.cif.gz_A crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia (d198a), ternary complex with adp and hygromycin b 0.6888 8 265
3w0q-assembly1.cif.gz_A crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia (n203a), ternary complex with amp-pnp and hygromycin b 0.6886 4 265
6sun-assembly1.cif.gz_A amicoumacin kinase hamin in complex with amp-pnp, ca2+ and ami 0.6835 5 263
3c5i-assembly4.cif.gz_D crystal structure of plasmodium knowlesi choline kinase, pkh_134520 0.6834 6 273
ID Description Score Start End Superfamily
4bp8A02 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain 0.8316 16 48 2.130.10.120
af_Q5Z417_117_462_2.130.10.120 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Prolyl oligopeptidase, N-terminal domain 0.7873 21 45 2.130.10.120
af_Q03407_118_209_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7686 16 84 3.30.200.20
af_Q8H1P3_2_91_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7516 9 82 3.30.200.20
af_A0A0R0G3L9_89_323_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7435 18 45 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A7D4P5Q7-F1-model_v4 deleted 0.9867 6 269
AF-A0A6A7M7D9-F1-model_v4 APH(6) family putative aminoglycoside O-phosphotransferase 0.9864 8 265 GO:0016773
GO:0019748
AF-A0A1D9BIX6-F1-model_v4 3'-kinase 0.9849 17 271 GO:0016301
GO:0016773
GO:0019748
AF-A0A2N3P430-F1-model_v4 deleted 0.9841 8 272
AF-A0A377PCM8-F1-model_v4 Aminoglycoside/hydroxyurea antibiotic resistance kinase 0.9823 9 270 GO:0016301
GO:0016773
GO:0019748

Feature Viewer

pLDDT pTM Quality
94.51 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map