F483935
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 863 | 506 | 748 | 146 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8056681323|8056685492 |
| Length | 143 |
| Sequence | SALIAAMLAVLLGAPMACAQSAAADPSGVWQTQAGDARVKISKCGGGICGVIVSLREPIDPATSRPQFDNKNPNPALTTRPIIGLPLFSGMRPAGGKWTGQIYNADDGGTYASNISLAGPDTLRVEGCVGALCGGETWTRVRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 2 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 3 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 4 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 5 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 6 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 7 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 8 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 9 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 10 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 11 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 12 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 13 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 14 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 15 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 16 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 17 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 18 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 19 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 20 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 21 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 22 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 23 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 24 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 25 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 26 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 27 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 28 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 29 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 30 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 31 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 32 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 33 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 34 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 35 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 36 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 37 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 38 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 39 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 40 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 41 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 42 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 43 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 44 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 45 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 46 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 47 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 48 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 49 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 50 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 51 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 52 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 53 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 54 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 55 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 56 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 57 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 58 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 59 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 60 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 61 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 62 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 63 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 64 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 65 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 66 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 67 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 68 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 69 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 70 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 71 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 72 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 73 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 74 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 75 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 76 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 77 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 78 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 79 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 80 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 81 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 82 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 83 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 84 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 85 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 86 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 87 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 88 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 89 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 90 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 91 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 92 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 93 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 94 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 95 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 96 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 97 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 98 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 99 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 100 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 101 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 102 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 103 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 104 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 105 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 106 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 109 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 111 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 113 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 121 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 135 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 136 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 138 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 139 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 141 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 143 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 144 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 148 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 150 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 151 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 152 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 154 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 155 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 156 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 157 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 158 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 159 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 160 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 161 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 162 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 163 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 164 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 165 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 166 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 167 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 169 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 170 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 171 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 172 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 173 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 175 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 176 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 177 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 178 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 179 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 181 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 182 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 183 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 184 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 185 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 187 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 204 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 214 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 216 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 220 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 280 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 284 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 285 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 286 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 287 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 288 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 289 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 290 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 291 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 292 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 293 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 294 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 295 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 296 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 297 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 298 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 299 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 300 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 301 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 302 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 303 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 304 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 305 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 306 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 307 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 309 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 310 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 311 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 312 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 313 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 316 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 317 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 318 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 319 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 320 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 321 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 380 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 392 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 393 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 394 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 395 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 396 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 397 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 398 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 399 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 400 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 401 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 431 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 432 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 433 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 434 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 435 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 436 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 437 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 438 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 443 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 444 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 446 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 447 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 449 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 450 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 451 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 452 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 453 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 454 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 455 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 456 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 457 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 458 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 459 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 460 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 461 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 462 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 463 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 464 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 465 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 466 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 467 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 468 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 469 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 470 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 471 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 472 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 473 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 474 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 475 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 476 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 477 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 478 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 479 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 480 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 481 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 482 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 483 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 485 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 486 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 487 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 489 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 490 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 491 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 492 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 495 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 496 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 497 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 498 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 499 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 500 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 501 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 502 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 503 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 504 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 505 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 506 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.67 |
| Metatranscriptomes | 0 |
| Isolates | 13.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.99 |
| Nodule | 8.81 |
| Rhizoplane | 3.48 |
| Rhizosphere | 60.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1051047 | 3300002070 | Bacteria | 646 |
| 2 | JGI25404J52841_10019690 | 3300003659 | Bacteria | 1462 |
| 3 | Ga0070676_10541668 | 3300005328 | Bacteria | 832 |
| 4 | Ga0070676_10598651 | 3300005328 | Bacteria | 795 |
| 5 | Ga0070676_10763867 | 3300005328 | Bacteria | 710 |
| 6 | Ga0070670_100221633 | 3300005331 | Bacteria | 1646 |
| 7 | Ga0070670_100684830 | 3300005331 | Bacteria | 921 |
| 8 | Ga0068869_100191727 | 3300005334 | Bacteria | 1607 |
| 9 | Ga0068869_100518389 | 3300005334 | Bacteria | 997 |
| 10 | Ga0070666_11132787 | 3300005335 | Bacteria | 582 |
| 11 | Ga0068868_100061118 | 3300005338 | Bacteria | 2984 |
| 12 | Ga0068868_100141546 | 3300005338 | Bacteria | 1975 |
| 13 | Ga0068868_100797478 | 3300005338 | Bacteria | 852 |
| 14 | Ga0068868_100887071 | 3300005338 | Bacteria | 810 |
| 15 | Ga0070660_100232836 | 3300005339 | Bacteria | 1499 |
| 16 | Ga0070660_100454544 | 3300005339 | Bacteria | 1063 |
| 17 | Ga0070689_100116708 | 3300005340 | Bacteria | 2128 |
| 18 | Ga0070689_101189751 | 3300005340 | Bacteria | 684 |
| 19 | Ga0070661_101323105 | 3300005344 | Bacteria | 605 |
| 20 | Ga0070668_100033559 | 3300005347 | Bacteria | 3909 |
| 21 | Ga0070668_100045692 | 3300005347 | Bacteria | 3360 |
| 22 | Ga0070668_100071734 | 3300005347 | Bacteria | 2698 |
| 23 | Ga0070668_100114651 | 3300005347 | Bacteria | 2147 |
| 24 | Ga0070668_100417909 | 3300005347 | Bacteria | 1148 |
| 25 | Ga0070668_100607425 | 3300005347 | Bacteria | 957 |
| 26 | Ga0070669_100165185 | 3300005353 | Bacteria | 1722 |
| 27 | Ga0070675_100661982 | 3300005354 | Bacteria | 949 |
| 28 | Ga0070671_100976432 | 3300005355 | Bacteria | 741 |
| 29 | Ga0070674_100050603 | 3300005356 | Bacteria | 2860 |
| 30 | Ga0070673_100610327 | 3300005364 | Bacteria | 996 |
| 31 | Ga0070673_101426930 | 3300005364 | Bacteria | 652 |
| 32 | Ga0070688_100442997 | 3300005365 | Bacteria | 970 |
| 33 | Ga0070688_100727558 | 3300005365 | Bacteria | 771 |
| 34 | Ga0070688_100847227 | 3300005365 | Bacteria | 718 |
| 35 | Ga0070659_100098791 | 3300005366 | Bacteria | 2347 |
| 36 | Ga0070659_101155302 | 3300005366 | Bacteria | 684 |
| 37 | Ga0070667_101086539 | 3300005367 | Bacteria | 748 |
| 38 | Ga0070714_100019687 | 3300005435 | Bacteria | 5502 |
| 39 | Ga0070714_101499796 | 3300005435 | Bacteria | 659 |
| 40 | Ga0070713_100042782 | 3300005436 | Bacteria | 3699 |
| 41 | Ga0070713_100145429 | 3300005436 | Bacteria | 2104 |
| 42 | Ga0070710_10004296 | 3300005437 | Bacteria | 6755 |
| 43 | Ga0070701_10483351 | 3300005438 | Bacteria | 801 |
| 44 | Ga0070711_100069627 | 3300005439 | Bacteria | 2475 |
| 45 | Ga0070700_100022185 | 3300005441 | Bacteria | 3699 |
| 46 | Ga0070700_100699770 | 3300005441 | Bacteria | 806 |
| 47 | Ga0070694_100790158 | 3300005444 | Bacteria | 777 |
| 48 | Ga0070708_101778090 | 3300005445 | Bacteria | 572 |
| 49 | Ga0070663_100052019 | 3300005455 | Bacteria | 2920 |
| 50 | Ga0070663_100063341 | 3300005455 | Bacteria | 2669 |
| 51 | Ga0070663_100083973 | 3300005455 | Bacteria | 2346 |
| 52 | Ga0070663_100088376 | 3300005455 | Bacteria | 2291 |
| 53 | Ga0070663_100103811 | 3300005455 | Bacteria | 2125 |
| 54 | Ga0070663_100213913 | 3300005455 | Bacteria | 1511 |
| 55 | Ga0070678_100029628 | 3300005456 | Bacteria | 3750 |
| 56 | Ga0070678_100361057 | 3300005456 | Bacteria | 1252 |
| 57 | Ga0070678_101322955 | 3300005456 | Bacteria | 671 |
| 58 | Ga0070662_100569355 | 3300005457 | Bacteria | 951 |
| 59 | Ga0070662_100583940 | 3300005457 | Bacteria | 939 |
| 60 | Ga0070681_10123853 | 3300005458 | Bacteria | 2518 |
| 61 | Ga0068867_100031241 | 3300005459 | Bacteria | 3843 |
| 62 | Ga0070706_101037429 | 3300005467 | Bacteria | 756 |
| 63 | Ga0070698_100612347 | 3300005471 | Bacteria | 1030 |
| 64 | Ga0070679_100659573 | 3300005530 | Bacteria | 989 |
| 65 | Ga0070684_100453306 | 3300005535 | Bacteria | 1186 |
| 66 | Ga0068853_100088438 | 3300005539 | Bacteria | 2719 |
| 67 | Ga0068853_100615527 | 3300005539 | Bacteria | 1032 |
| 68 | Ga0070672_100187893 | 3300005543 | Bacteria | 1724 |
| 69 | Ga0070672_102062954 | 3300005543 | Bacteria | 514 |
| 70 | Ga0070686_100596444 | 3300005544 | Bacteria | 870 |
| 71 | Ga0070695_100487693 | 3300005545 | Bacteria | 951 |
| 72 | Ga0070693_100425058 | 3300005547 | Bacteria | 927 |
| 73 | Ga0070665_100005416 | 3300005548 | Bacteria | 13166 |
| 74 | Ga0070665_100062245 | 3300005548 | Bacteria | 3742 |
| 75 | Ga0070665_100067150 | 3300005548 | Bacteria | 3596 |
| 76 | Ga0070665_100178369 | 3300005548 | Bacteria | 2125 |
| 77 | Ga0070665_100276754 | 3300005548 | Bacteria | 1680 |
| 78 | Ga0070665_101020155 | 3300005548 | Bacteria | 839 |
| 79 | Ga0070665_101508262 | 3300005548 | Bacteria | 681 |
| 80 | Ga0070665_101758782 | 3300005548 | Bacteria | 627 |
| 81 | Ga0070704_100367501 | 3300005549 | Bacteria | 1219 |
| 82 | Ga0068855_100087580 | 3300005563 | Bacteria | 3598 |
| 83 | Ga0068855_101239547 | 3300005563 | Bacteria | 774 |
| 84 | Ga0070664_100099136 | 3300005564 | Bacteria | 2532 |
| 85 | Ga0070664_100465619 | 3300005564 | Bacteria | 1162 |
| 86 | Ga0070664_101288438 | 3300005564 | Bacteria | 690 |
| 87 | Ga0068857_100053817 | 3300005577 | Bacteria | 3570 |
| 88 | Ga0068857_100229566 | 3300005577 | Bacteria | 1697 |
| 89 | Ga0068854_100034950 | 3300005578 | Bacteria | 3515 |
| 90 | Ga0068854_100053678 | 3300005578 | Bacteria | 2895 |
| 91 | Ga0068856_100024284 | 3300005614 | Bacteria | 5899 |
| 92 | Ga0068856_100640009 | 3300005614 | Bacteria | 1084 |
| 93 | Ga0068856_100823095 | 3300005614 | Bacteria | 948 |
| 94 | Ga0070702_100864815 | 3300005615 | Bacteria | 705 |
| 95 | Ga0068852_100104864 | 3300005616 | Bacteria | 2560 |
| 96 | Ga0068852_100740967 | 3300005616 | Bacteria | 994 |
| 97 | Ga0068859_100455890 | 3300005617 | Bacteria | 1375 |
| 98 | Ga0068859_100723974 | 3300005617 | Bacteria | 1085 |
| 99 | Ga0068864_100043821 | 3300005618 | Bacteria | 3832 |
| 100 | Ga0068866_10089935 | 3300005718 | Bacteria | 1669 |
| 101 | Ga0068866_10679370 | 3300005718 | Bacteria | 704 |
| 102 | Ga0068861_100046781 | 3300005719 | Bacteria | 3263 |
| 103 | Ga0068861_100175720 | 3300005719 | Bacteria | 1778 |
| 104 | Ga0068861_100486804 | 3300005719 | Bacteria | 1112 |
| 105 | Ga0068861_100810059 | 3300005719 | Bacteria | 880 |
| 106 | Ga0068851_10007476 | 3300005834 | Bacteria | 5017 |
| 107 | Ga0068870_10025221 | 3300005840 | Bacteria | 2949 |
| 108 | Ga0068863_100234805 | 3300005841 | Bacteria | 1769 |
| 109 | Ga0068858_100319919 | 3300005842 | Bacteria | 1483 |
| 110 | Ga0068858_100631037 | 3300005842 | Bacteria | 1040 |
| 111 | Ga0068858_101064066 | 3300005842 | Bacteria | 794 |
| 112 | Ga0068860_100020185 | 3300005843 | Bacteria | 6457 |
| 113 | Ga0068860_100176736 | 3300005843 | Bacteria | 2063 |
| 114 | Ga0068860_100182832 | 3300005843 | Bacteria | 2026 |
| 115 | Ga0068862_100085607 | 3300005844 | Bacteria | 2739 |
| 116 | Ga0068862_100151664 | 3300005844 | Bacteria | 2063 |
| 117 | Ga0068862_100286072 | 3300005844 | Bacteria | 1512 |
| 118 | Ga0068862_100559965 | 3300005844 | Bacteria | 1092 |
| 119 | Ga0068862_100567472 | 3300005844 | Bacteria | 1086 |
| 120 | Ga0068862_100711904 | 3300005844 | Bacteria | 973 |
| 121 | Ga0081455_10145350 | 3300005937 | Bacteria | 1835 |
| 122 | Ga0081538_10096616 | 3300005981 | Bacteria | 1504 |
| 123 | Ga0081540_1006920 | 3300005983 | Bacteria | 8174 |
| 124 | Ga0081540_1009239 | 3300005983 | Bacteria | 6799 |
| 125 | Ga0081540_1017740 | 3300005983 | Bacteria | 4396 |
| 126 | Ga0081540_1029072 | 3300005983 | Bacteria | 3088 |
| 127 | Ga0070717_10143799 | 3300006028 | Bacteria | 2059 |
| 128 | Ga0075365_10033503 | 3300006038 | Bacteria | 3311 |
| 129 | Ga0075365_10282263 | 3300006038 | Bacteria | 1168 |
| 130 | Ga0075365_10928355 | 3300006038 | Bacteria | 613 |
| 131 | Ga0075368_10057590 | 3300006042 | Bacteria | 1551 |
| 132 | Ga0075368_10128665 | 3300006042 | Bacteria | 1051 |
| 133 | Ga0075363_100002282 | 3300006048 | Bacteria | 7776 |
| 134 | Ga0075363_100106464 | 3300006048 | Bacteria | 1556 |
| 135 | Ga0075363_100714333 | 3300006048 | Bacteria | 606 |
| 136 | Ga0075364_10550331 | 3300006051 | Bacteria | 789 |
| 137 | Ga0075364_10556531 | 3300006051 | Bacteria | 784 |
| 138 | Ga0075364_10591138 | 3300006051 | Bacteria | 758 |
| 139 | Ga0070715_10000876 | 3300006163 | Bacteria | 8328 |
| 140 | Ga0070716_100002220 | 3300006173 | Bacteria | 8943 |
| 141 | Ga0070712_100095599 | 3300006175 | Bacteria | 2186 |
| 142 | Ga0070712_100811953 | 3300006175 | Bacteria | 803 |
| 143 | Ga0075362_10206452 | 3300006177 | Bacteria | 957 |
| 144 | Ga0075367_10012050 | 3300006178 | Bacteria | 4595 |
| 145 | Ga0075367_10073711 | 3300006178 | Bacteria | 2057 |
| 146 | Ga0075367_10152725 | 3300006178 | Bacteria | 1433 |
| 147 | Ga0075367_10206156 | 3300006178 | Bacteria | 1229 |
| 148 | Ga0075367_10249824 | 3300006178 | Bacteria | 1112 |
| 149 | Ga0075369_10032107 | 3300006186 | Bacteria | 2220 |
| 150 | Ga0075369_10084795 | 3300006186 | Bacteria | 1408 |
| 151 | Ga0075366_10074104 | 3300006195 | Bacteria | 2029 |
| 152 | Ga0075366_10078044 | 3300006195 | Bacteria | 1976 |
| 153 | Ga0097621_100549798 | 3300006237 | Bacteria | 1051 |
| 154 | Ga0097621_100831619 | 3300006237 | Bacteria | 857 |
| 155 | Ga0097621_100993400 | 3300006237 | Bacteria | 785 |
| 156 | Ga0097621_101405606 | 3300006237 | Bacteria | 661 |
| 157 | Ga0075370_10109857 | 3300006353 | Bacteria | 1601 |
| 158 | Ga0075370_10206875 | 3300006353 | Bacteria | 1158 |
| 159 | Ga0075370_10373789 | 3300006353 | Bacteria | 853 |
| 160 | Ga0075370_10389353 | 3300006353 | Bacteria | 835 |
| 161 | Ga0075370_10474906 | 3300006353 | Bacteria | 753 |
| 162 | Ga0068871_100180601 | 3300006358 | Bacteria | 1813 |
| 163 | Ga0068871_100500593 | 3300006358 | Bacteria | 1095 |
| 164 | Ga0068871_101335164 | 3300006358 | Bacteria | 675 |
| 165 | Ga0075429_100656618 | 3300006880 | Bacteria | 919 |
| 166 | Ga0068865_101068316 | 3300006881 | Bacteria | 710 |
| 167 | Ga0075436_100264123 | 3300006914 | Bacteria | 1228 |
| 168 | Ga0097620_100455882 | 3300006931 | Bacteria | 1375 |
| 169 | Ga0097620_100723877 | 3300006931 | Bacteria | 1085 |
| 170 | Ga0099795_10027007 | 3300007788 | Bacteria | 1939 |
| 171 | Ga0105251_10376511 | 3300009011 | Bacteria | 650 |
| 172 | Ga0105250_10330281 | 3300009092 | Bacteria | 664 |
| 173 | Ga0105240_10542999 | 3300009093 | Bacteria | 1287 |
| 174 | Ga0105240_11749686 | 3300009093 | Bacteria | 648 |
| 175 | Ga0111539_10065388 | 3300009094 | Bacteria | 4297 |
| 176 | Ga0111539_10562174 | 3300009094 | Bacteria | 1328 |
| 177 | Ga0105245_10045538 | 3300009098 | Bacteria | 3918 |
| 178 | Ga0105245_10423459 | 3300009098 | Bacteria | 1335 |
| 179 | Ga0105245_11213268 | 3300009098 | Bacteria | 802 |
| 180 | Ga0105247_10002364 | 3300009101 | Bacteria | 12856 |
| 181 | Ga0105247_10050933 | 3300009101 | Bacteria | 2549 |
| 182 | Ga0105247_10327813 | 3300009101 | Bacteria | 1070 |
| 183 | Ga0105247_10373738 | 3300009101 | Bacteria | 1009 |
| 184 | Ga0105247_11382191 | 3300009101 | Bacteria | 569 |
| 185 | Ga0114129_10190202 | 3300009147 | Bacteria | 2788 |
| 186 | Ga0105243_10036133 | 3300009148 | Bacteria | 3832 |
| 187 | Ga0105243_10429279 | 3300009148 | Bacteria | 1235 |
| 188 | Ga0105243_11468920 | 3300009148 | Bacteria | 704 |
| 189 | Ga0105241_10060020 | 3300009174 | Bacteria | 2925 |
| 190 | Ga0105241_10166738 | 3300009174 | Bacteria | 1816 |
| 191 | Ga0105241_11342152 | 3300009174 | Bacteria | 683 |
| 192 | Ga0105242_10100161 | 3300009176 | Bacteria | 2453 |
| 193 | Ga0105242_11266338 | 3300009176 | Bacteria | 760 |
| 194 | Ga0105248_10112195 | 3300009177 | Bacteria | 3075 |
| 195 | Ga0105248_10685392 | 3300009177 | Bacteria | 1156 |
| 196 | Ga0105237_10006596 | 3300009545 | Bacteria | 12834 |
| 197 | Ga0105237_10219668 | 3300009545 | Bacteria | 1901 |
| 198 | Ga0105237_10382696 | 3300009545 | Bacteria | 1412 |
| 199 | Ga0105238_10119909 | 3300009551 | Bacteria | 2610 |
| 200 | Ga0105238_10244320 | 3300009551 | Bacteria | 1773 |
| 201 | Ga0105238_10676304 | 3300009551 | Bacteria | 1043 |
| 202 | Ga0105249_10022801 | 3300009553 | Bacteria | 5612 |
| 203 | Ga0105239_10466331 | 3300010375 | Bacteria | 1434 |
| 204 | Ga0105239_10470643 | 3300010375 | Bacteria | 1427 |
| 205 | Ga0105239_12075194 | 3300010375 | Bacteria | 660 |
| 206 | Ga0105246_10008882 | 3300011119 | Bacteria | 6184 |
| 207 | Ga0105246_10178515 | 3300011119 | Bacteria | 1633 |
| 208 | Ga0157342_1065633 | 3300012507 | Bacteria | 542 |
| 209 | Ga0157370_10119131 | 3300013104 | Bacteria | 2465 |
| 210 | Ga0157374_10443271 | 3300013296 | Bacteria | 1299 |
| 211 | Ga0157378_10180184 | 3300013297 | Bacteria | 1987 |
| 212 | Ga0157378_10455125 | 3300013297 | Bacteria | 1271 |
| 213 | Ga0163162_10056995 | 3300013306 | Bacteria | 3935 |
| 214 | Ga0163162_10737348 | 3300013306 | Bacteria | 1105 |
| 215 | Ga0163162_10761920 | 3300013306 | Bacteria | 1087 |
| 216 | Ga0163162_11050788 | 3300013306 | Bacteria | 922 |
| 217 | Ga0163162_11391809 | 3300013306 | Bacteria | 798 |
| 218 | Ga0157372_10791173 | 3300013307 | Bacteria | 1102 |
| 219 | Ga0157375_10863399 | 3300013308 | Bacteria | 1051 |
| 220 | Ga0157375_11945064 | 3300013308 | Bacteria | 698 |
| 221 | Ga0157375_12772073 | 3300013308 | Bacteria | 586 |
| 222 | Ga0163163_10033108 | 3300014325 | Bacteria | 4997 |
| 223 | Ga0163163_10503827 | 3300014325 | Bacteria | 1273 |
| 224 | Ga0163163_10581913 | 3300014325 | Bacteria | 1183 |
| 225 | Ga0157380_10321470 | 3300014326 | Bacteria | 1435 |
| 226 | Ga0157380_10368038 | 3300014326 | Bacteria | 1351 |
| 227 | Ga0157380_11009685 | 3300014326 | Bacteria | 866 |
| 228 | Ga0157376_11115185 | 3300014969 | Bacteria | 815 |
| 229 | Ga0182007_10393072 | 3300015262 | Bacteria | 527 |
| 230 | Ga0163161_10056068 | 3300017792 | Bacteria | 2861 |
| 231 | Ga0163161_10645981 | 3300017792 | Bacteria | 876 |
| 232 | Ga0213876_10001108 | 3300021384 | Bacteria | 17232 |
| 233 | Ga0209677_100501 | 3300025253 | Bacteria | 22041 |
| 234 | Ga0209233_1013851 | 3300025261 | Bacteria | 2292 |
| 235 | Ga0209455_1002295 | 3300025272 | Bacteria | 7521 |
| 236 | Ga0209455_1046062 | 3300025272 | Bacteria | 635 |
| 237 | Ga0209564_1038632 | 3300025295 | Bacteria | 1324 |
| 238 | Ga0209758_1041827 | 3300025297 | Bacteria | 1707 |
| 239 | Ga0207697_10061062 | 3300025315 | Bacteria | 1568 |
| 240 | Ga0207656_10013890 | 3300025321 | Bacteria | 3090 |
| 241 | Ga0207692_10001396 | 3300025898 | Bacteria | 9039 |
| 242 | Ga0207642_10113408 | 3300025899 | Bacteria | 1385 |
| 243 | Ga0207710_10135162 | 3300025900 | Bacteria | 1187 |
| 244 | Ga0207710_10187867 | 3300025900 | Bacteria | 1016 |
| 245 | Ga0207710_10236786 | 3300025900 | Bacteria | 910 |
| 246 | Ga0207710_10311967 | 3300025900 | Bacteria | 796 |
| 247 | Ga0207680_10142121 | 3300025903 | Bacteria | 1592 |
| 248 | Ga0207680_10968038 | 3300025903 | Bacteria | 610 |
| 249 | Ga0207685_10011404 | 3300025905 | Bacteria | 2670 |
| 250 | Ga0207685_10058143 | 3300025905 | Bacteria | 1520 |
| 251 | Ga0207699_10021630 | 3300025906 | Bacteria | 3470 |
| 252 | Ga0207645_10223884 | 3300025907 | Bacteria | 1240 |
| 253 | Ga0207643_10181684 | 3300025908 | Bacteria | 1273 |
| 254 | Ga0207643_10327286 | 3300025908 | Bacteria | 958 |
| 255 | Ga0207654_10021180 | 3300025911 | Bacteria | 3454 |
| 256 | Ga0207654_10111194 | 3300025911 | Bacteria | 1705 |
| 257 | Ga0207707_10141119 | 3300025912 | Bacteria | 2106 |
| 258 | Ga0207695_10002042 | 3300025913 | Bacteria | 30945 |
| 259 | Ga0207695_10868482 | 3300025913 | Bacteria | 782 |
| 260 | Ga0207671_10024690 | 3300025914 | Bacteria | 4515 |
| 261 | Ga0207671_10389553 | 3300025914 | Bacteria | 1108 |
| 262 | Ga0207671_10718274 | 3300025914 | Bacteria | 794 |
| 263 | Ga0207693_10002986 | 3300025915 | Bacteria | 14649 |
| 264 | Ga0207663_10001112 | 3300025916 | Bacteria | 12359 |
| 265 | Ga0207663_11192703 | 3300025916 | Bacteria | 613 |
| 266 | Ga0207660_10005383 | 3300025917 | Bacteria | 8310 |
| 267 | Ga0207657_10116605 | 3300025919 | Bacteria | 2200 |
| 268 | Ga0207657_10454447 | 3300025919 | Bacteria | 1005 |
| 269 | Ga0207649_10290018 | 3300025920 | Bacteria | 1193 |
| 270 | Ga0207649_11400429 | 3300025920 | Bacteria | 553 |
| 271 | Ga0207652_10899432 | 3300025921 | Bacteria | 782 |
| 272 | Ga0207646_11290971 | 3300025922 | Bacteria | 638 |
| 273 | Ga0207681_10297862 | 3300025923 | Bacteria | 1275 |
| 274 | Ga0207681_10995163 | 3300025923 | Bacteria | 703 |
| 275 | Ga0207694_10001415 | 3300025924 | Bacteria | 20567 |
| 276 | Ga0207694_10050943 | 3300025924 | Bacteria | 3209 |
| 277 | Ga0207694_10270457 | 3300025924 | Bacteria | 1394 |
| 278 | Ga0207694_10298106 | 3300025924 | Bacteria | 1327 |
| 279 | Ga0207694_10387726 | 3300025924 | Bacteria | 1160 |
| 280 | Ga0207650_10324969 | 3300025925 | Bacteria | 1261 |
| 281 | Ga0207650_10341254 | 3300025925 | Bacteria | 1230 |
| 282 | Ga0207687_10181316 | 3300025927 | Bacteria | 1632 |
| 283 | Ga0207700_10054664 | 3300025928 | Bacteria | 2998 |
| 284 | Ga0207664_10081551 | 3300025929 | Bacteria | 2632 |
| 285 | Ga0207664_10857942 | 3300025929 | Bacteria | 816 |
| 286 | Ga0207644_10226888 | 3300025931 | Bacteria | 1483 |
| 287 | Ga0207690_10012826 | 3300025932 | Bacteria | 5021 |
| 288 | Ga0207690_10056253 | 3300025932 | Bacteria | 2653 |
| 289 | Ga0207706_10060816 | 3300025933 | Bacteria | 3327 |
| 290 | Ga0207670_10390419 | 3300025936 | Bacteria | 1111 |
| 291 | Ga0207669_11020395 | 3300025937 | Bacteria | 696 |
| 292 | Ga0207704_10421655 | 3300025938 | Bacteria | 1058 |
| 293 | Ga0207665_10000703 | 3300025939 | Bacteria | 22673 |
| 294 | Ga0207691_10047902 | 3300025940 | Bacteria | 3920 |
| 295 | Ga0207691_10150618 | 3300025940 | Bacteria | 2045 |
| 296 | Ga0207691_11429772 | 3300025940 | Bacteria | 567 |
| 297 | Ga0207711_10073347 | 3300025941 | Bacteria | 2975 |
| 298 | Ga0207711_10758256 | 3300025941 | Bacteria | 904 |
| 299 | Ga0207689_10151626 | 3300025942 | Bacteria | 1911 |
| 300 | Ga0207689_10209278 | 3300025942 | Bacteria | 1611 |
| 301 | Ga0207689_10211999 | 3300025942 | Bacteria | 1600 |
| 302 | Ga0207679_10406249 | 3300025945 | Bacteria | 1199 |
| 303 | Ga0207679_11185763 | 3300025945 | Bacteria | 701 |
| 304 | Ga0207667_10011130 | 3300025949 | Bacteria | 10474 |
| 305 | Ga0207651_10944470 | 3300025960 | Bacteria | 769 |
| 306 | Ga0207651_11064643 | 3300025960 | Bacteria | 724 |
| 307 | Ga0207712_10106344 | 3300025961 | Bacteria | 2096 |
| 308 | Ga0207668_10099508 | 3300025972 | Bacteria | 2157 |
| 309 | Ga0207668_10127442 | 3300025972 | Bacteria | 1938 |
| 310 | Ga0207668_10170030 | 3300025972 | Bacteria | 1708 |
| 311 | Ga0207668_10182308 | 3300025972 | Bacteria | 1657 |
| 312 | Ga0207640_10217736 | 3300025981 | Bacteria | 1459 |
| 313 | Ga0207640_10553339 | 3300025981 | Bacteria | 967 |
| 314 | Ga0207658_10123641 | 3300025986 | Bacteria | 2067 |
| 315 | Ga0207677_10302867 | 3300026023 | Bacteria | 1321 |
| 316 | Ga0207677_10715139 | 3300026023 | Bacteria | 890 |
| 317 | Ga0207677_11289134 | 3300026023 | Bacteria | 671 |
| 318 | Ga0207703_10034795 | 3300026035 | Bacteria | 3999 |
| 319 | Ga0207703_10095078 | 3300026035 | Bacteria | 2513 |
| 320 | Ga0207639_10152849 | 3300026041 | Bacteria | 1935 |
| 321 | Ga0207639_10252278 | 3300026041 | Bacteria | 1539 |
| 322 | Ga0207678_10011116 | 3300026067 | Bacteria | 7907 |
| 323 | Ga0207678_10156831 | 3300026067 | Bacteria | 1943 |
| 324 | Ga0207678_10256820 | 3300026067 | Bacteria | 1497 |
| 325 | Ga0207678_10301007 | 3300026067 | Bacteria | 1378 |
| 326 | Ga0207678_10331066 | 3300026067 | Bacteria | 1311 |
| 327 | Ga0207678_10405442 | 3300026067 | Bacteria | 1181 |
| 328 | Ga0207678_10787199 | 3300026067 | Bacteria | 839 |
| 329 | Ga0207708_10057294 | 3300026075 | Bacteria | 2973 |
| 330 | Ga0207708_10498592 | 3300026075 | Bacteria | 1020 |
| 331 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 332 | Ga0207702_10062440 | 3300026078 | Bacteria | 3182 |
| 333 | Ga0207702_10665328 | 3300026078 | Bacteria | 1025 |
| 334 | Ga0207641_10888368 | 3300026088 | Bacteria | 884 |
| 335 | Ga0207648_10014415 | 3300026089 | Bacteria | 7304 |
| 336 | Ga0207676_10098150 | 3300026095 | Bacteria | 2421 |
| 337 | Ga0207674_10036904 | 3300026116 | Bacteria | 5086 |
| 338 | Ga0207674_10740130 | 3300026116 | Bacteria | 949 |
| 339 | Ga0207674_11238141 | 3300026116 | Bacteria | 716 |
| 340 | Ga0207675_100041106 | 3300026118 | Bacteria | 4318 |
| 341 | Ga0207675_100268752 | 3300026118 | Bacteria | 1654 |
| 342 | Ga0207675_100276616 | 3300026118 | Bacteria | 1630 |
| 343 | Ga0207675_100546237 | 3300026118 | Bacteria | 1157 |
| 344 | Ga0207683_10041381 | 3300026121 | Bacteria | 4024 |
| 345 | Ga0207683_10252994 | 3300026121 | Bacteria | 1608 |
| 346 | Ga0207683_10560401 | 3300026121 | Bacteria | 1057 |
| 347 | Ga0207683_11770198 | 3300026121 | Bacteria | 567 |
| 348 | Ga0207698_10253567 | 3300026142 | Bacteria | 1612 |
| 349 | Ga0207698_10475177 | 3300026142 | Bacteria | 1211 |
| 350 | Ga0209813_10038085 | 3300027866 | Bacteria | 1451 |
| 351 | Ga0209813_10219759 | 3300027866 | Bacteria | 711 |
| 352 | Ga0207428_10083833 | 3300027907 | Bacteria | 2485 |
| 353 | Ga0268266_10001796 | 3300028379 | Bacteria | 24309 |
| 354 | Ga0268266_10006533 | 3300028379 | Bacteria | 10670 |
| 355 | Ga0268266_10028563 | 3300028379 | Bacteria | 4740 |
| 356 | Ga0268266_10098652 | 3300028379 | Bacteria | 2571 |
| 357 | Ga0268266_10180897 | 3300028379 | Bacteria | 1919 |
| 358 | Ga0268266_10237638 | 3300028379 | Bacteria | 1680 |
| 359 | Ga0268266_10551735 | 3300028379 | Bacteria | 1104 |
| 360 | Ga0268266_10647462 | 3300028379 | Bacteria | 1017 |
| 361 | Ga0268265_10118620 | 3300028380 | Bacteria | 2175 |
| 362 | Ga0268265_10216649 | 3300028380 | Bacteria | 1672 |
| 363 | Ga0268265_10485371 | 3300028380 | Bacteria | 1161 |
| 364 | Ga0268265_11003586 | 3300028380 | Bacteria | 824 |
| 365 | Ga0268264_10167444 | 3300028381 | Bacteria | 1985 |
| 366 | Ga0268264_10506443 | 3300028381 | Bacteria | 1178 |
| 367 | Ga0307515_10786597 | 3300028794 | Bacteria | 573 |
| 368 | Ga0265330_10002550 | 3300031235 | Bacteria | 9898 |
| 369 | Ga0265330_10015820 | 3300031235 | Bacteria | 3486 |
| 370 | Ga0265325_10003674 | 3300031241 | Bacteria | 9936 |
| 371 | Ga0265340_10037021 | 3300031247 | Bacteria | 2418 |
| 372 | Ga0265339_10007436 | 3300031249 | Bacteria | 7079 |
| 373 | Ga0265331_10019625 | 3300031250 | Bacteria | 3488 |
| 374 | Ga0265316_10053947 | 3300031344 | Bacteria | 3148 |
| 375 | Ga0307513_10234817 | 3300031456 | Bacteria | 1644 |
| 376 | Ga0307513_10342522 | 3300031456 | Bacteria | 1245 |
| 377 | Ga0307509_10040531 | 3300031507 | Bacteria | 5065 |
| 378 | Ga0307509_10319157 | 3300031507 | Bacteria | 1291 |
| 379 | Ga0307408_100168937 | 3300031548 | Bacteria | 1745 |
| 380 | Ga0307408_100279318 | 3300031548 | Bacteria | 1390 |
| 381 | Ga0307508_10127761 | 3300031616 | Bacteria | 2145 |
| 382 | Ga0307508_10165454 | 3300031616 | Bacteria | 1815 |
| 383 | Ga0307516_10074830 | 3300031730 | Bacteria | 3241 |
| 384 | Ga0307516_10078356 | 3300031730 | Bacteria | 3151 |
| 385 | Ga0307405_10488682 | 3300031731 | Bacteria | 984 |
| 386 | Ga0307413_10197700 | 3300031824 | Bacteria | 1449 |
| 387 | Ga0307413_10750133 | 3300031824 | Bacteria | 816 |
| 388 | Ga0307518_10178990 | 3300031838 | Bacteria | 1436 |
| 389 | Ga0307410_10217170 | 3300031852 | Bacteria | 1469 |
| 390 | Ga0307410_10838822 | 3300031852 | Bacteria | 784 |
| 391 | Ga0307406_10226633 | 3300031901 | Bacteria | 1393 |
| 392 | Ga0307406_10854271 | 3300031901 | Bacteria | 772 |
| 393 | Ga0307412_10059879 | 3300031911 | Bacteria | 2554 |
| 394 | Ga0307412_10079025 | 3300031911 | Bacteria | 2268 |
| 395 | Ga0307412_10178719 | 3300031911 | Bacteria | 1594 |
| 396 | Ga0307409_100523584 | 3300031995 | Bacteria | 1159 |
| 397 | Ga0307409_101123334 | 3300031995 | Bacteria | 808 |
| 398 | Ga0307409_101638543 | 3300031995 | Bacteria | 672 |
| 399 | Ga0307416_100525496 | 3300032002 | Bacteria | 1252 |
| 400 | Ga0307416_100602952 | 3300032002 | Bacteria | 1178 |
| 401 | Ga0307414_10088792 | 3300032004 | Bacteria | 2289 |
| 402 | Ga0307411_11767693 | 3300032005 | Bacteria | 573 |
| 403 | Ga0307411_11877617 | 3300032005 | Bacteria | 557 |
| 404 | Ga0307510_10011129 | 3300033180 | Bacteria | 10696 |
| 405 | Ga0307510_10018329 | 3300033180 | Bacteria | 8239 |
| 406 | Ga0307510_10069015 | 3300033180 | Bacteria | 3543 |
| 407 | Ga0307510_10098798 | 3300033180 | Bacteria | 2721 |
| 408 | Ga0373936_0139993 | 3300035113 | Bacteria | 1044 |
| 409 | Ga0373942_0035731 | 3300035207 | Bacteria | 1335 |
| 410 | Ga0373947_0527347 | 3300035725 | Bacteria | 803 |
| 411 | Ga0395905_0071917 | 3300037471 | Bacteria | 3242 |
| 412 | Ga0395905_0185780 | 3300037471 | Bacteria | 1951 |
| 413 | Ga0395905_1130254 | 3300037471 | Bacteria | 687 |
| 414 | Ga0395901_0088921 | 3300038443 | Bacteria | 3232 |
| 415 | Ga0436365_0122301 | 3300039437 | Bacteria | 13111 |
| 416 | Ga0436365_1394541 | 3300039437 | Bacteria | 2634 |
| 417 | Ga0436365_1539897 | 3300039437 | Bacteria | 702 |
| 418 | Ga0436363_1129876 | 3300039450 | Bacteria | 993 |
| 419 | Ga0451793_1818322 | 3300041452 | Bacteria | 1253 |
| 420 | Ga0451807_1865263 | 3300041486 | Bacteria | 1066 |
| 421 | Ga0451853_1431665 | 3300041512 | Bacteria | 886 |
| 422 | Ga0439431_0047286 | 3300041997 | Bacteria | 1109 |
| 423 | Ga0466966_0000720 | 3300044684 | Bacteria | 20983 |
| 424 | Ga0466961_0000136 | 3300044693 | Bacteria | 49049 |
| 425 | Ga0466971_0639603 | 3300044719 | Bacteria | 532 |
| 426 | Ga0466958_0118098 | 3300045836 | Bacteria | 1659 |
| 427 | Ga0495617_051855 | 3300046452 | Bacteria | 1363 |
| 428 | Ga0495617_270213 | 3300046452 | Bacteria | 522 |
| 429 | Ga0495603_0022671 | 3300046455 | Bacteria | 3799 |
| 430 | Ga0495603_0061397 | 3300046455 | Bacteria | 2219 |
| 431 | Ga0495603_0551565 | 3300046455 | Bacteria | 660 |
| 432 | Ga0495629_0055561 | 3300046459 | Bacteria | 2768 |
| 433 | Ga0495638_0069191 | 3300046460 | Bacteria | 2163 |
| 434 | Ga0495638_0109260 | 3300046460 | Bacteria | 1644 |
| 435 | Ga0495638_0137016 | 3300046460 | Bacteria | 1432 |
| 436 | Ga0495638_0366263 | 3300046460 | Bacteria | 757 |
| 437 | Ga0495651_0086807 | 3300046462 | Bacteria | 2353 |
| 438 | Ga0495605_0178681 | 3300046474 | Bacteria | 934 |
| 439 | Ga0495605_0203080 | 3300046474 | Bacteria | 863 |
| 440 | Ga0495639_0087029 | 3300046475 | Bacteria | 1462 |
| 441 | Ga0495584_0070687 | 3300046491 | Bacteria | 1754 |
| 442 | Ga0495584_0315369 | 3300046491 | Bacteria | 794 |
| 443 | Ga0495585_0036277 | 3300046492 | Bacteria | 2782 |
| 444 | Ga0495594_0028295 | 3300046499 | Bacteria | 3024 |
| 445 | Ga0495594_0436328 | 3300046499 | Bacteria | 745 |
| 446 | Ga0495596_0349182 | 3300046500 | Bacteria | 576 |
| 447 | Ga0495607_0028665 | 3300046501 | Bacteria | 3433 |
| 448 | Ga0495583_0096872 | 3300046506 | Bacteria | 1263 |
| 449 | Ga0495583_0143150 | 3300046506 | Bacteria | 994 |
| 450 | Ga0495606_0267711 | 3300046507 | Bacteria | 940 |
| 451 | Ga0495606_0284679 | 3300046507 | Bacteria | 902 |
| 452 | Ga0495606_0289786 | 3300046507 | Bacteria | 891 |
| 453 | Ga0495610_0188311 | 3300046512 | Bacteria | 853 |
| 454 | Ga0495610_0307151 | 3300046512 | Bacteria | 610 |
| 455 | Ga0495610_0320281 | 3300046512 | Bacteria | 592 |
| 456 | Ga0495616_0471223 | 3300046513 | Bacteria | 506 |
| 457 | Ga0495620_0038259 | 3300046515 | Bacteria | 2130 |
| 458 | Ga0495620_0079650 | 3300046515 | Bacteria | 1327 |
| 459 | Ga0495628_0526830 | 3300046516 | Bacteria | 851 |
| 460 | Ga0495631_0037832 | 3300046518 | Bacteria | 2148 |
| 461 | Ga0495631_0354160 | 3300046518 | Bacteria | 625 |
| 462 | Ga0495632_0263489 | 3300046519 | Bacteria | 770 |
| 463 | Ga0495637_0008884 | 3300046520 | Bacteria | 4918 |
| 464 | Ga0495637_0265153 | 3300046520 | Bacteria | 616 |
| 465 | Ga0495643_0047303 | 3300046522 | Bacteria | 2330 |
| 466 | Ga0495644_0233770 | 3300046523 | Bacteria | 712 |
| 467 | Ga0495648_0002080 | 3300046524 | Bacteria | 18945 |
| 468 | Ga0495648_0034457 | 3300046524 | Bacteria | 3294 |
| 469 | Ga0495648_0044716 | 3300046524 | Bacteria | 2761 |
| 470 | Ga0495648_0065206 | 3300046524 | Bacteria | 2142 |
| 471 | Ga0495652_0103154 | 3300046529 | Bacteria | 2309 |
| 472 | Ga0495654_0116993 | 3300046530 | Bacteria | 1210 |
| 473 | Ga0495665_0200725 | 3300046531 | Bacteria | 1034 |
| 474 | Ga0495587_0285163 | 3300046536 | Bacteria | 925 |
| 475 | Ga0495609_0324196 | 3300046538 | Bacteria | 624 |
| 476 | Ga0495609_0441646 | 3300046538 | Bacteria | 517 |
| 477 | Ga0495621_0079926 | 3300046539 | Bacteria | 1218 |
| 478 | Ga0495597_0054897 | 3300046542 | Bacteria | 1748 |
| 479 | Ga0495597_0145070 | 3300046542 | Bacteria | 977 |
| 480 | Ga0495622_0009680 | 3300046557 | Bacteria | 4457 |
| 481 | Ga0495622_0293396 | 3300046557 | Bacteria | 709 |
| 482 | Ga0495633_0139985 | 3300046558 | Bacteria | 1119 |
| 483 | Ga0495656_0012433 | 3300046615 | Bacteria | 3141 |
| 484 | Ga0495656_0080275 | 3300046615 | Bacteria | 1471 |
| 485 | Ga0495656_0094907 | 3300046615 | Bacteria | 1370 |
| 486 | Ga0495656_0116191 | 3300046615 | Bacteria | 1257 |
| 487 | Ga0495668_0035543 | 3300046616 | Bacteria | 2793 |
| 488 | Ga0495668_0156688 | 3300046616 | Bacteria | 1247 |
| 489 | Ga0495668_0201223 | 3300046616 | Bacteria | 1090 |
| 490 | Ga0495668_0278872 | 3300046616 | Bacteria | 916 |
| 491 | Ga0495611_0439127 | 3300046648 | Bacteria | 595 |
| 492 | Ga0495611_0492072 | 3300046648 | Bacteria | 557 |
| 493 | Ga0495625_0083627 | 3300046660 | Bacteria | 2218 |
| 494 | Ga0495625_0520661 | 3300046660 | Bacteria | 724 |
| 495 | Ga0495625_0525645 | 3300046660 | Bacteria | 720 |
| 496 | Ga0495635_0135785 | 3300046663 | Bacteria | 1677 |
| 497 | Ga0495635_0284145 | 3300046663 | Bacteria | 1111 |
| 498 | Ga0495659_0004777 | 3300046664 | Bacteria | 4267 |
| 499 | Ga0495659_0061185 | 3300046664 | Bacteria | 1391 |
| 500 | Ga0495661_0114119 | 3300046665 | Bacteria | 1501 |
| 501 | Ga0495588_0039553 | 3300046674 | Bacteria | 2403 |
| 502 | Ga0495623_0238640 | 3300046679 | Bacteria | 1028 |
| 503 | Ga0495669_0027733 | 3300046684 | Bacteria | 2478 |
| 504 | Ga0495669_0051935 | 3300046684 | Bacteria | 1840 |
| 505 | Ga0495589_0144672 | 3300046794 | Bacteria | 1137 |
| 506 | Ga0495600_0156354 | 3300046809 | Bacteria | 1475 |
| 507 | Ga0495660_0085628 | 3300046810 | Bacteria | 1646 |
| 508 | Ga0495581_0112266 | 3300047315 | Bacteria | 1585 |
| 509 | Ga0495581_0298185 | 3300047315 | Bacteria | 942 |
| 510 | Ga0495581_0762835 | 3300047315 | Bacteria | 556 |
| 511 | Ga0495672_0338751 | 3300047320 | Bacteria | 701 |
| 512 | Ga0495672_0415460 | 3300047320 | Bacteria | 613 |
| 513 | Ga0495676_0980734 | 3300047321 | Bacteria | 540 |
| 514 | Ga0495683_0030240 | 3300047323 | Bacteria | 2764 |
| 515 | Ga0495677_0062877 | 3300047445 | Bacteria | 1378 |
| 516 | Ga0495673_0118238 | 3300047469 | Bacteria | 1052 |
| 517 | Ga0495673_0131519 | 3300047469 | Bacteria | 983 |
| 518 | Ga0495673_0206617 | 3300047469 | Bacteria | 732 |
| 519 | Ga0495681_0040040 | 3300047470 | Bacteria | 2284 |
| 520 | Ga0495686_0032221 | 3300047472 | Bacteria | 3393 |
| 521 | Ga0495686_0349194 | 3300047472 | Bacteria | 804 |
| 522 | Ga0495686_0402037 | 3300047472 | Unclassified | 735 |
| 523 | Ga0495593_0069686 | 3300047673 | Bacteria | 1828 |
| 524 | Ga0495602_0364194 | 3300048088 | Bacteria | 1040 |
| 525 | Ga0496100_0874408 | 3300048903 | Bacteria | 705 |
| 526 | Ga0496100_1140196 | 3300048903 | Bacteria | 615 |
| 527 | Ga0496101_0218386 | 3300048904 | Bacteria | 1479 |
| 528 | Ga0496102_0201366 | 3300048905 | Bacteria | 1877 |
| 529 | Ga0496102_0414441 | 3300048905 | Bacteria | 1265 |
| 530 | Ga0496102_0420187 | 3300048905 | Bacteria | 1256 |
| 531 | Ga0496102_0530193 | 3300048905 | Bacteria | 1100 |
| 532 | Ga0496102_0988114 | 3300048905 | Bacteria | 762 |
| 533 | Ga0496103_0141235 | 3300048906 | Bacteria | 1540 |
| 534 | Ga0496103_0368634 | 3300048906 | Bacteria | 923 |
| 535 | Ga0496103_0916114 | 3300048906 | Bacteria | 549 |
| 536 | Ga0496106_0001280 | 3300048909 | Bacteria | 18862 |
| 537 | Ga0496106_0326642 | 3300048909 | Bacteria | 1231 |
| 538 | Ga0496107_0153876 | 3300048910 | Bacteria | 1702 |
| 539 | Ga0496108_0143185 | 3300048911 | Bacteria | 2060 |
| 540 | Ga0496109_0373253 | 3300048912 | Bacteria | 1347 |
| 541 | Ga0496109_0531987 | 3300048912 | Bacteria | 1109 |
| 542 | Ga0496110_0327980 | 3300048913 | Bacteria | 1394 |
| 543 | Ga0496110_1061011 | 3300048913 | Bacteria | 718 |
| 544 | Ga0496111_0987228 | 3300048914 | Bacteria | 604 |
| 545 | Ga0496112_0061648 | 3300048915 | Bacteria | 3698 |
| 546 | Ga0496113_0105768 | 3300048916 | Bacteria | 2185 |
| 547 | Ga0496114_1210087 | 3300048917 | Bacteria | 641 |
| 548 | Ga0496115_0010296 | 3300048918 | Bacteria | 6981 |
| 549 | Ga0496115_0184549 | 3300048918 | Bacteria | 1724 |
| 550 | Ga0496115_0327108 | 3300048918 | Bacteria | 1253 |
| 551 | Ga0496115_1248126 | 3300048918 | Bacteria | 556 |
| 552 | Ga0496116_0020084 | 3300048919 | Bacteria | 5086 |
| 553 | Ga0496116_0104835 | 3300048919 | Bacteria | 1679 |
| 554 | Ga0496117_0008319 | 3300048920 | Bacteria | 9873 |
| 555 | Ga0496117_0050653 | 3300048920 | Bacteria | 2943 |
| 556 | Ga0496117_0165289 | 3300048920 | Bacteria | 1291 |
| 557 | Ga0496117_0313375 | 3300048920 | Bacteria | 825 |
| 558 | Ga0496118_0001458 | 3300048921 | Bacteria | 35562 |
| 559 | Ga0496118_0018352 | 3300048921 | Bacteria | 6316 |
| 560 | Ga0496118_0035734 | 3300048921 | Bacteria | 4028 |
| 561 | Ga0496118_0238641 | 3300048921 | Bacteria | 1043 |
| 562 | Ga0496119_0037240 | 3300048922 | Bacteria | 3163 |
| 563 | Ga0496119_0048668 | 3300048922 | Bacteria | 2627 |
| 564 | Ga0496119_0058578 | 3300048922 | Bacteria | 2320 |
| 565 | Ga0496119_0465018 | 3300048922 | Bacteria | 594 |
| 566 | Ga0496120_0058355 | 3300048923 | Bacteria | 2168 |
| 567 | Ga0496120_0269523 | 3300048923 | Bacteria | 791 |
| 568 | Ga0496120_0377552 | 3300048923 | Bacteria | 631 |
| 569 | Ga0496121_0000146 | 3300048924 | Bacteria | 154459 |
| 570 | Ga0496121_0000254 | 3300048924 | Bacteria | 113314 |
| 571 | Ga0496121_0001525 | 3300048924 | Bacteria | 38839 |
| 572 | Ga0496121_0002100 | 3300048924 | Bacteria | 31362 |
| 573 | Ga0496121_0078360 | 3300048924 | Bacteria | 2627 |
| 574 | Ga0496121_0085939 | 3300048924 | Bacteria | 2473 |
| 575 | Ga0496121_0093283 | 3300048924 | Bacteria | 2344 |
| 576 | Ga0496121_0382581 | 3300048924 | Bacteria | 927 |
| 577 | Ga0496121_0565601 | 3300048924 | Bacteria | 708 |
| 578 | Ga0496123_0005070 | 3300048926 | Bacteria | 13458 |
| 579 | Ga0496124_0009204 | 3300048927 | Bacteria | 10188 |
| 580 | Ga0496124_0138488 | 3300048927 | Bacteria | 1924 |
| 581 | Ga0496125_0017943 | 3300048928 | Bacteria | 6728 |
| 582 | Ga0496125_0166685 | 3300048928 | Bacteria | 1487 |
| 583 | Ga0496125_0291557 | 3300048928 | Bacteria | 1004 |
| 584 | Ga0496126_0003212 | 3300048929 | Bacteria | 20945 |
| 585 | Ga0496126_0015212 | 3300048929 | Bacteria | 7747 |
| 586 | Ga0496126_0016838 | 3300048929 | Bacteria | 7297 |
| 587 | Ga0496126_0043920 | 3300048929 | Bacteria | 4119 |
| 588 | Ga0496126_0102678 | 3300048929 | Bacteria | 2499 |
| 589 | Ga0496126_0185463 | 3300048929 | Bacteria | 1764 |
| 590 | Ga0496126_0375826 | 3300048929 | Bacteria | 1158 |
| 591 | Ga0496126_0517341 | 3300048929 | Bacteria | 951 |
| 592 | Ga0496126_0524488 | 3300048929 | Bacteria | 943 |
| 593 | Ga0496126_0717016 | 3300048929 | Bacteria | 775 |
| 594 | Ga0496126_0874033 | 3300048929 | Bacteria | 684 |
| 595 | Ga0495682_0053776 | 3300049460 | Bacteria | 1462 |
| 596 | Ga0495682_0055990 | 3300049460 | Bacteria | 1430 |
| 597 | Ga0495682_0075980 | 3300049460 | Bacteria | 1208 |
| 598 | Ga0495682_0195331 | 3300049460 | Bacteria | 718 |
| 599 | Ga0501032_0000196 | 3300049569 | Bacteria | 50261 |
| 600 | Ga0501033_0001104 | 3300049570 | Bacteria | 24475 |
| 601 | Ga0501034_0001151 | 3300049571 | Bacteria | 36663 |
| 602 | Ga0501036_0000323 | 3300049572 | Bacteria | 33256 |
| 603 | Ga0501036_1626208 | 3300049572 | Bacteria | 521 |
| 604 | Ga0501037_0001204 | 3300049573 | Bacteria | 19110 |
| 605 | Ga0501038_0002973 | 3300049574 | Bacteria | 15796 |
| 606 | Ga0501038_0798311 | 3300049574 | Bacteria | 701 |
| 607 | Ga0501039_0000705 | 3300049575 | Bacteria | 24064 |
| 608 | Ga0501040_0197847 | 3300049576 | Bacteria | 1427 |
| 609 | Ga0501040_0285972 | 3300049576 | Bacteria | 1178 |
| 610 | Ga0501041_0174158 | 3300049577 | Bacteria | 1347 |
| 611 | Ga0501042_0032152 | 3300049578 | Bacteria | 3715 |
| 612 | Ga0501043_0000409 | 3300049579 | Bacteria | 38657 |
| 613 | Ga0501043_1265979 | 3300049579 | Bacteria | 516 |
| 614 | Ga0501046_0000181 | 3300049580 | Bacteria | 64035 |
| 615 | Ga0501047_0000419 | 3300049581 | Bacteria | 47535 |
| 616 | Ga0501048_0000057 | 3300049582 | Bacteria | 56138 |
| 617 | Ga0501048_1089564 | 3300049582 | Bacteria | 575 |
| 618 | Ga0501067_0000145 | 3300049583 | Bacteria | 39277 |
| 619 | Ga0501068_0001512 | 3300049584 | Bacteria | 12380 |
| 620 | Ga0501069_0001180 | 3300049585 | Bacteria | 12685 |
| 621 | Ga0501070_0019419 | 3300049586 | Bacteria | 5698 |
| 622 | Ga0501070_0024463 | 3300049586 | Bacteria | 5065 |
| 623 | Ga0501070_0706112 | 3300049586 | Bacteria | 797 |
| 624 | Ga0501071_0026796 | 3300049587 | Bacteria | 4049 |
| 625 | Ga0501071_0173294 | 3300049587 | Bacteria | 1616 |
| 626 | Ga0501072_0000643 | 3300049588 | Bacteria | 25050 |
| 627 | Ga0501073_0000027 | 3300049589 | Bacteria | 121860 |
| 628 | Ga0501074_0000081 | 3300049590 | Bacteria | 46487 |
| 629 | Ga0501079_0013675 | 3300049741 | Bacteria | 6189 |
| 630 | Ga0501080_0000883 | 3300049742 | Bacteria | 24535 |
| 631 | Ga0501080_0538795 | 3300049742 | Bacteria | 1040 |
| 632 | Ga0501083_0004050 | 3300049744 | Bacteria | 10311 |
| 633 | Ga0501035_0003158 | 3300049822 | Bacteria | 15827 |
| 634 | Ga0501044_0001511 | 3300049823 | Bacteria | 27265 |
| 635 | Ga0501045_0007967 | 3300049824 | Bacteria | 7379 |
| 636 | nmdc:mga03683_58498_c1 | 3300050489 | Bacteria | 1624 |
| 637 | nmdc:mga03n38_61610_c1 | 3300050490 | Bacteria | 1709 |
| 638 | nmdc:mga03n38_640_c1 | 3300050490 | Bacteria | 8984 |
| 639 | nmdc:mga00v17_36643_c1 | 3300050491 | Bacteria | 2925 |
| 640 | nmdc:mga00v17_486919_c1 | 3300050491 | Bacteria | 800 |
| 641 | nmdc:mga0yw44_23931_c1 | 3300050492 | Bacteria | 3448 |
| 642 | nmdc:mga0k408_273329_c1 | 3300050493 | Bacteria | 1009 |
| 643 | nmdc:mga0k408_322557_c1 | 3300050493 | Bacteria | 922 |
| 644 | nmdc:mga0k408_708906_c1 | 3300050493 | Bacteria | 589 |
| 645 | nmdc:mga06z11_249403_c1 | 3300050494 | Bacteria | 1045 |
| 646 | nmdc:mga06z11_43089_c1 | 3300050494 | Bacteria | 2268 |
| 647 | nmdc:mga06z11_54839_c1 | 3300050494 | Bacteria | 2056 |
| 648 | nmdc:mga06z11_662578_c1 | 3300050494 | Bacteria | 635 |
| 649 | nmdc:mga04h51_239633_c1 | 3300050495 | Bacteria | 724 |
| 650 | nmdc:mga04h51_46550_c1 | 3300050495 | Bacteria | 1438 |
| 651 | nmdc:mga07m45_15864_c1 | 3300050496 | Bacteria | 4027 |
| 652 | nmdc:mga07m45_221268_c1 | 3300050496 | Bacteria | 1101 |
| 653 | nmdc:mga07m45_40684_c1 | 3300050496 | Bacteria | 2601 |
| 654 | nmdc:mga07m45_79576_c1 | 3300050496 | Bacteria | 1871 |
| 655 | nmdc:mga07m45_99476_c1 | 3300050496 | Bacteria | 1670 |
| 656 | nmdc:mga05p37_14625_c1 | 3300050507 | Bacteria | 9428 |
| 657 | nmdc:mga09592_526452_c1 | 3300050508 | Bacteria | 1016 |
| 658 | nmdc:mga08y16_217968_c1 | 3300050511 | Bacteria | 1976 |
| 659 | nmdc:mga08x19_411861_c1 | 3300050514 | Bacteria | 949 |
| 660 | nmdc:mga0sz30_191099_c1 | 3300050516 | Bacteria | 909 |
| 661 | nmdc:mga0sz30_278514_c1 | 3300050516 | Bacteria | 745 |
| 662 | nmdc:mga0sz30_295729_c1 | 3300050516 | Bacteria | 722 |
| 663 | nmdc:mga0sz30_6950_c1 | 3300050516 | Bacteria | 4228 |
| 664 | Ga0500635_0013637 | 3300053080 | Bacteria | 2365 |
| 665 | Ga0495595_0508876 | 3300053084 | Bacteria | 614 |
| 666 | Ga0500578_0041351 | 3300053086 | Bacteria | 2961 |
| 667 | Ga0500578_0092395 | 3300053086 | Bacteria | 1920 |
| 668 | Ga0500578_0267537 | 3300053086 | Bacteria | 1024 |
| 669 | Ga0500643_106288 | 3300053087 | Bacteria | 760 |
| 670 | Ga0500643_141764 | 3300053087 | Bacteria | 645 |
| 671 | Ga0500644_0034521 | 3300053088 | Bacteria | 1632 |
| 672 | Ga0500581_043214 | 3300053089 | Bacteria | 2305 |
| 673 | Ga0500646_0010996 | 3300053090 | Bacteria | 2325 |
| 674 | Ga0500646_0125244 | 3300053090 | Bacteria | 830 |
| 675 | Ga0500647_0017905 | 3300053091 | Bacteria | 3275 |
| 676 | Ga0500651_0056536 | 3300053093 | Bacteria | 2456 |
| 677 | Ga0500651_0123443 | 3300053093 | Bacteria | 1570 |
| 678 | Ga0500566_0000113 | 3300053094 | Bacteria | 41467 |
| 679 | Ga0500566_0000574 | 3300053094 | Bacteria | 20705 |
| 680 | Ga0500640_000015 | 3300053095 | Bacteria | 25262 |
| 681 | Ga0500641_0000742 | 3300053096 | Bacteria | 11809 |
| 682 | Ga0500650_0003757 | 3300053098 | Bacteria | 5353 |
| 683 | Ga0500555_045844 | 3300053103 | Bacteria | 1207 |
| 684 | Ga0500556_0000035 | 3300053104 | Bacteria | 145357 |
| 685 | Ga0500556_0029460 | 3300053104 | Bacteria | 1851 |
| 686 | Ga0500562_061930 | 3300053108 | Bacteria | 1005 |
| 687 | Ga0500562_087964 | 3300053108 | Bacteria | 842 |
| 688 | Ga0500569_013787 | 3300053109 | Bacteria | 1987 |
| 689 | Ga0500572_000087 | 3300053111 | Bacteria | 29543 |
| 690 | Ga0500591_214450 | 3300053115 | Bacteria | 645 |
| 691 | Ga0500592_007600 | 3300053116 | Bacteria | 1722 |
| 692 | Ga0500592_041883 | 3300053116 | Bacteria | 742 |
| 693 | Ga0500593_028184 | 3300053117 | Bacteria | 2509 |
| 694 | Ga0500594_0039849 | 3300053118 | Bacteria | 1279 |
| 695 | Ga0500595_002430 | 3300053119 | Bacteria | 9285 |
| 696 | Ga0500595_005832 | 3300053119 | Bacteria | 5312 |
| 697 | Ga0500595_006784 | 3300053119 | Bacteria | 4822 |
| 698 | Ga0500595_011118 | 3300053119 | Bacteria | 3539 |
| 699 | Ga0500595_035406 | 3300053119 | Bacteria | 1644 |
| 700 | Ga0500595_055447 | 3300053119 | Bacteria | 1214 |
| 701 | Ga0500607_110341 | 3300053121 | Bacteria | 1350 |
| 702 | Ga0500608_000269 | 3300053122 | Bacteria | 20074 |
| 703 | Ga0500608_162729 | 3300053122 | Bacteria | 965 |
| 704 | Ga0500614_000881 | 3300053123 | Bacteria | 7578 |
| 705 | Ga0500618_011506 | 3300053125 | Bacteria | 2345 |
| 706 | Ga0500618_022841 | 3300053125 | Bacteria | 1517 |
| 707 | Ga0500642_0000027 | 3300053130 | Bacteria | 119688 |
| 708 | Ga0500642_0083197 | 3300053130 | Bacteria | 1472 |
| 709 | Ga0500652_000529 | 3300053131 | Bacteria | 13438 |
| 710 | Ga0500559_0000064 | 3300053136 | Bacteria | 85844 |
| 711 | Ga0500559_0001344 | 3300053136 | Bacteria | 14113 |
| 712 | Ga0500568_0000443 | 3300053139 | Bacteria | 31089 |
| 713 | Ga0500568_0028239 | 3300053139 | Bacteria | 2340 |
| 714 | Ga0500568_0115453 | 3300053139 | Bacteria | 1002 |
| 715 | Ga0500577_0000809 | 3300053142 | Bacteria | 8060 |
| 716 | Ga0500585_087784 | 3300053144 | Bacteria | 1124 |
| 717 | Ga0500586_004877 | 3300053145 | Bacteria | 3343 |
| 718 | Ga0500588_0175589 | 3300053146 | Bacteria | 786 |
| 719 | Ga0500588_0243282 | 3300053146 | Bacteria | 674 |
| 720 | Ga0500603_000174 | 3300053150 | Bacteria | 16397 |
| 721 | Ga0500603_000706 | 3300053150 | Bacteria | 8131 |
| 722 | Ga0500604_0036684 | 3300053151 | Bacteria | 1462 |
| 723 | Ga0500604_0092125 | 3300053151 | Bacteria | 991 |
| 724 | Ga0500616_0000054 | 3300053153 | Bacteria | 290186 |
| 725 | Ga0500619_031272 | 3300053154 | Bacteria | 1623 |
| 726 | Ga0500622_0019279 | 3300053156 | Bacteria | 3623 |
| 727 | Ga0500627_0016445 | 3300053158 | Bacteria | 2885 |
| 728 | Ga0500627_0025162 | 3300053158 | Bacteria | 2443 |
| 729 | Ga0500627_0038515 | 3300053158 | Bacteria | 2045 |
| 730 | Ga0500627_0222401 | 3300053158 | Bacteria | 842 |
| 731 | Ga0500630_002996 | 3300053159 | Bacteria | 8156 |
| 732 | Ga0500634_0116538 | 3300053161 | Bacteria | 1308 |
| 733 | Ga0500634_0260753 | 3300053161 | Bacteria | 713 |
| 734 | Ga0500639_000050 | 3300053163 | Bacteria | 54136 |
| 735 | Ga0500639_122094 | 3300053163 | Bacteria | 1249 |
| 736 | Ga0500636_0001203 | 3300053177 | Bacteria | 13970 |
| 737 | Ga0500636_0077223 | 3300053177 | Bacteria | 1924 |
| 738 | Ga0500636_0109550 | 3300053177 | Bacteria | 1562 |
| 739 | Ga0500636_0545175 | 3300053177 | Bacteria | 503 |
| 740 | Ga0500637_0001513 | 3300053178 | Bacteria | 9913 |
| 741 | Ga0500637_0106448 | 3300053178 | Bacteria | 1626 |
| 742 | Ga0500611_012900 | 3300053727 | Bacteria | 1421 |
| 743 | Ga0500596_000100 | 3300053735 | Bacteria | 11801 |
| 744 | Ga0500601_003419 | 3300053737 | Bacteria | 1721 |
| 745 | Ga0501084_0003425 | 3300054114 | Bacteria | 12868 |
| 746 | Ga0501082_0007835 | 3300060353 | Bacteria | 9215 |
| 747 | Ga0501082_1310081 | 3300060353 | Bacteria | 633 |
| 748 | Ga0530510_0589998 | 3300061734 | Bacteria | 845 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0010296 | Ga0496115_0010296_49_492 | 126 |
| 2 | 3300035725 | Ga0373947_0527347 | Ga0373947_0527347_365_763 | 132 |
| 3 | 3300025916 | Ga0207663_11192703 | Ga0207663_111927031 | 137 |
| 4 | 3300047472 | Ga0495686_0349194 | Ga0495686_0349194_168_584 | 137 |
| 5 | 3300048918 | Ga0496115_0184549 | Ga0496115_0184549_1045_1461 | 137 |
| 6 | 3300048929 | Ga0496126_0185463 | Ga0496126_0185463_1175_1591 | 137 |
| 7 | 3300005328 | Ga0070676_10598651 | Ga0070676_105986511 | 138 |
| 8 | 3300005331 | Ga0070670_100221633 | Ga0070670_1002216332 | 138 |
| 9 | 3300005334 | Ga0068869_100518389 | Ga0068869_1005183892 | 138 |
| 10 | 3300005338 | Ga0068868_100061118 | Ga0068868_1000611184 | 138 |
| 11 | 3300005339 | Ga0070660_100454544 | Ga0070660_1004545442 | 138 |
| 12 | 3300005340 | Ga0070689_101189751 | Ga0070689_1011897511 | 138 |
| 13 | 3300005347 | Ga0070668_100033559 | Ga0070668_1000335593 | 138 |
| 14 | 3300005353 | Ga0070669_100165185 | Ga0070669_1001651852 | 138 |
| 15 | 3300005364 | Ga0070673_101426930 | Ga0070673_1014269301 | 138 |
| 16 | 3300005365 | Ga0070688_100727558 | Ga0070688_1007275581 | 138 |
| 17 | 3300005366 | Ga0070659_101155302 | Ga0070659_1011553022 | 138 |
| 18 | 3300005367 | Ga0070667_101086539 | Ga0070667_1010865391 | 138 |
| 19 | 3300005456 | Ga0070678_100361057 | Ga0070678_1003610572 | 138 |
| 20 | 3300005535 | Ga0070684_100453306 | Ga0070684_1004533062 | 138 |
| 21 | 3300005543 | Ga0070672_102062954 | Ga0070672_1020629541 | 138 |
| 22 | 3300005548 | Ga0070665_101020155 | Ga0070665_1010201552 | 138 |
| 23 | 3300005563 | Ga0068855_100087580 | Ga0068855_1000875802 | 138 |
| 24 | 3300005564 | Ga0070664_100099136 | Ga0070664_1000991363 | 138 |
| 25 | 3300005577 | Ga0068857_100053817 | Ga0068857_1000538172 | 138 |
| 26 | 3300005578 | Ga0068854_100034950 | Ga0068854_1000349502 | 138 |
| 27 | 3300005614 | Ga0068856_100024284 | Ga0068856_1000242842 | 138 |
| 28 | 3300005617 | Ga0068859_100455890 | Ga0068859_1004558902 | 138 |
| 29 | 3300005618 | Ga0068864_100043821 | Ga0068864_1000438213 | 138 |
| 30 | 3300005718 | Ga0068866_10679370 | Ga0068866_106793702 | 138 |
| 31 | 3300005719 | Ga0068861_100175720 | Ga0068861_1001757202 | 138 |
| 32 | 3300005841 | Ga0068863_100234805 | Ga0068863_1002348052 | 138 |
| 33 | 3300005842 | Ga0068858_100631037 | Ga0068858_1006310372 | 138 |
| 34 | 3300005843 | Ga0068860_100176736 | Ga0068860_1001767362 | 138 |
| 35 | 3300005844 | Ga0068862_100286072 | Ga0068862_1002860722 | 138 |
| 36 | 3300006042 | Ga0075368_10128665 | Ga0075368_101286652 | 138 |
| 37 | 3300006048 | Ga0075363_100106464 | Ga0075363_1001064641 | 138 |
| 38 | 3300006051 | Ga0075364_10591138 | Ga0075364_105911382 | 138 |
| 39 | 3300006178 | Ga0075367_10249824 | Ga0075367_102498242 | 138 |
| 40 | 3300006186 | Ga0075369_10084795 | Ga0075369_100847951 | 138 |
| 41 | 3300006195 | Ga0075366_10078044 | Ga0075366_100780442 | 138 |
| 42 | 3300006237 | Ga0097621_100993400 | Ga0097621_1009934001 | 138 |
| 43 | 3300006353 | Ga0075370_10206875 | Ga0075370_102068752 | 138 |
| 44 | 3300006358 | Ga0068871_100180601 | Ga0068871_1001806011 | 138 |
| 45 | 3300006881 | Ga0068865_101068316 | Ga0068865_1010683162 | 138 |
| 46 | 3300006914 | Ga0075436_100264123 | Ga0075436_1002641232 | 138 |
| 47 | 3300006931 | Ga0097620_100455882 | Ga0097620_1004558822 | 138 |
| 48 | 3300009093 | Ga0105240_10542999 | Ga0105240_105429992 | 138 |
| 49 | 3300009094 | Ga0111539_10562174 | Ga0111539_105621741 | 138 |
| 50 | 3300009098 | Ga0105245_10045538 | Ga0105245_100455382 | 138 |
| 51 | 3300009148 | Ga0105243_10429279 | Ga0105243_104292792 | 138 |
| 52 | 3300009174 | Ga0105241_10166738 | Ga0105241_101667382 | 138 |
| 53 | 3300009177 | Ga0105248_10112195 | Ga0105248_101121952 | 138 |
| 54 | 3300009545 | Ga0105237_10219668 | Ga0105237_102196681 | 138 |
| 55 | 3300009551 | Ga0105238_10244320 | Ga0105238_102443201 | 138 |
| 56 | 3300010375 | Ga0105239_10470643 | Ga0105239_104706432 | 138 |
| 57 | 3300011119 | Ga0105246_10178515 | Ga0105246_101785152 | 138 |
| 58 | 3300013296 | Ga0157374_10443271 | Ga0157374_104432712 | 138 |
| 59 | 3300013297 | Ga0157378_10455125 | Ga0157378_104551251 | 138 |
| 60 | 3300013306 | Ga0163162_10737348 | Ga0163162_107373481 | 138 |
| 61 | 3300014325 | Ga0163163_10033108 | Ga0163163_100331086 | 138 |
| 62 | 3300017792 | Ga0163161_10645981 | Ga0163161_106459812 | 138 |
| 63 | 3300025900 | Ga0207710_10135162 | Ga0207710_101351622 | 138 |
| 64 | 3300025903 | Ga0207680_10968038 | Ga0207680_109680381 | 138 |
| 65 | 3300025905 | Ga0207685_10058143 | Ga0207685_100581432 | 138 |
| 66 | 3300025911 | Ga0207654_10111194 | Ga0207654_101111941 | 138 |
| 67 | 3300025913 | Ga0207695_10868482 | Ga0207695_108684821 | 138 |
| 68 | 3300025914 | Ga0207671_10389553 | Ga0207671_103895532 | 138 |
| 69 | 3300025919 | Ga0207657_10454447 | Ga0207657_104544472 | 138 |
| 70 | 3300025920 | Ga0207649_10290018 | Ga0207649_102900182 | 138 |
| 71 | 3300025924 | Ga0207694_10050943 | Ga0207694_100509433 | 138 |
| 72 | 3300025925 | Ga0207650_10341254 | Ga0207650_103412542 | 138 |
| 73 | 3300025927 | Ga0207687_10181316 | Ga0207687_101813162 | 138 |
| 74 | 3300025932 | Ga0207690_10056253 | Ga0207690_100562533 | 138 |
| 75 | 3300025936 | Ga0207670_10390419 | Ga0207670_103904192 | 138 |
| 76 | 3300025938 | Ga0207704_10421655 | Ga0207704_104216552 | 138 |
| 77 | 3300025940 | Ga0207691_10150618 | Ga0207691_101506182 | 138 |
| 78 | 3300025941 | Ga0207711_10073347 | Ga0207711_100733473 | 138 |
| 79 | 3300025942 | Ga0207689_10151626 | Ga0207689_101516262 | 138 |
| 80 | 3300025972 | Ga0207668_10127442 | Ga0207668_101274422 | 138 |
| 81 | 3300025981 | Ga0207640_10217736 | Ga0207640_102177362 | 138 |
| 82 | 3300025986 | Ga0207658_10123641 | Ga0207658_101236412 | 138 |
| 83 | 3300026035 | Ga0207703_10034795 | Ga0207703_100347954 | 138 |
| 84 | 3300026041 | Ga0207639_10152849 | Ga0207639_101528492 | 138 |
| 85 | 3300026067 | Ga0207678_10301007 | Ga0207678_103010072 | 138 |
| 86 | 3300026078 | Ga0207702_10062440 | Ga0207702_100624402 | 138 |
| 87 | 3300026088 | Ga0207641_10888368 | Ga0207641_108883681 | 138 |
| 88 | 3300026095 | Ga0207676_10098150 | Ga0207676_100981502 | 138 |
| 89 | 3300026116 | Ga0207674_10036904 | Ga0207674_100369044 | 138 |
| 90 | 3300026118 | Ga0207675_100268752 | Ga0207675_1002687522 | 138 |
| 91 | 3300026121 | Ga0207683_10252994 | Ga0207683_102529941 | 138 |
| 92 | 3300026142 | Ga0207698_10475177 | Ga0207698_104751772 | 138 |
| 93 | 3300028379 | Ga0268266_10180897 | Ga0268266_101808972 | 138 |
| 94 | 3300028380 | Ga0268265_10485371 | Ga0268265_104853712 | 138 |
| 95 | 3300048905 | Ga0496102_0414441 | Ga0496102_0414441_288_731 | 138 |
| 96 | 3300048906 | Ga0496103_0141235 | Ga0496103_0141235_430_873 | 138 |
| 97 | 3300048909 | Ga0496106_0326642 | Ga0496106_0326642_582_1025 | 138 |
| 98 | 3300048911 | Ga0496108_0143185 | Ga0496108_0143185_571_1014 | 138 |
| 99 | 3300048915 | Ga0496112_0061648 | Ga0496112_0061648_1509_1952 | 138 |
| 100 | 3300048916 | Ga0496113_0105768 | Ga0496113_0105768_254_697 | 138 |
| 101 | 3300048924 | Ga0496121_0002100 | Ga0496121_0002100_16005_16460 | 138 |
| 102 | 3300048928 | Ga0496125_0166685 | Ga0496125_0166685_46_489 | 138 |
| 103 | 3300050490 | nmdc:mga03n38_61610_c1 | nmdc:mga03n38_61610_c1_1124_1567 | 138 |
| 104 | 3300050491 | nmdc:mga00v17_36643_c1 | nmdc:mga00v17_36643_c1_1262_1705 | 138 |
| 105 | 3300050493 | nmdc:mga0k408_322557_c1 | nmdc:mga0k408_322557_c1_400_843 | 138 |
| 106 | 3300050496 | nmdc:mga07m45_40684_c1 | nmdc:mga07m45_40684_c1_1000_1443 | 138 |
| 107 | 3300050514 | nmdc:mga08x19_411861_c1 | nmdc:mga08x19_411861_c1_76_519 | 138 |
| 108 | 3300050516 | nmdc:mga0sz30_191099_c1 | nmdc:mga0sz30_191099_c1_294_737 | 138 |
| 109 | 3300048912 | Ga0496109_0373253 | Ga0496109_0373253_39_482 | 139 |
| 110 | 3300009101 | Ga0105247_10050933 | Ga0105247_100509333 | 140 |
| 111 | 3300025900 | Ga0207710_10311967 | Ga0207710_103119671 | 140 |
| 112 | 3300031241 | Ga0265325_10003674 | Ga0265325_100036743 | 140 |
| 113 | 3300031250 | Ga0265331_10019625 | Ga0265331_100196254 | 140 |
| 114 | 3300031344 | Ga0265316_10053947 | Ga0265316_100539471 | 140 |
| 115 | 3300046460 | Ga0495638_0069191 | Ga0495638_0069191_375_797 | 140 |
| 116 | 3300046460 | Ga0495638_0109260 | Ga0495638_0109260_61_483 | 140 |
| 117 | 3300046501 | Ga0495607_0028665 | Ga0495607_0028665_2675_3097 | 140 |
| 118 | 3300046512 | Ga0495610_0188311 | Ga0495610_0188311_347_769 | 140 |
| 119 | 3300046515 | Ga0495620_0038259 | Ga0495620_0038259_1377_1799 | 140 |
| 120 | 3300046518 | Ga0495631_0037832 | Ga0495631_0037832_202_624 | 140 |
| 121 | 3300046520 | Ga0495637_0008884 | Ga0495637_0008884_3034_3456 | 140 |
| 122 | 3300046522 | Ga0495643_0047303 | Ga0495643_0047303_768_1190 | 140 |
| 123 | 3300046524 | Ga0495648_0002080 | Ga0495648_0002080_17173_17595 | 140 |
| 124 | 3300046524 | Ga0495648_0034457 | Ga0495648_0034457_60_482 | 140 |
| 125 | 3300046530 | Ga0495654_0116993 | Ga0495654_0116993_772_1194 | 140 |
| 126 | 3300046542 | Ga0495597_0054897 | Ga0495597_0054897_1036_1458 | 140 |
| 127 | 3300046557 | Ga0495622_0009680 | Ga0495622_0009680_3027_3449 | 140 |
| 128 | 3300046616 | Ga0495668_0156688 | Ga0495668_0156688_29_451 | 140 |
| 129 | 3300046660 | Ga0495625_0520661 | Ga0495625_0520661_30_452 | 140 |
| 130 | 3300046665 | Ga0495661_0114119 | Ga0495661_0114119_61_483 | 140 |
| 131 | 3300046674 | Ga0495588_0039553 | Ga0495588_0039553_1407_1829 | 140 |
| 132 | 3300046810 | Ga0495660_0085628 | Ga0495660_0085628_706_1128 | 140 |
| 133 | 3300047472 | Ga0495686_0032221 | Ga0495686_0032221_1250_1672 | 140 |
| 134 | 3300048905 | Ga0496102_0420187 | Ga0496102_0420187_741_1163 | 140 |
| 135 | 3300048920 | Ga0496117_0313375 | Ga0496117_0313375_93_515 | 140 |
| 136 | 3300048921 | Ga0496118_0238641 | Ga0496118_0238641_592_1014 | 140 |
| 137 | 3300048923 | Ga0496120_0058355 | Ga0496120_0058355_899_1321 | 140 |
| 138 | 3300048924 | Ga0496121_0093283 | Ga0496121_0093283_1591_2013 | 140 |
| 139 | 3300048926 | Ga0496123_0005070 | Ga0496123_0005070_11314_11736 | 140 |
| 140 | 3300048929 | Ga0496126_0517341 | Ga0496126_0517341_107_529 | 140 |
| 141 | 3300053086 | Ga0500578_0092395 | Ga0500578_0092395_1169_1591 | 140 |
| 142 | 3300053087 | Ga0500643_141764 | Ga0500643_141764_127_549 | 140 |
| 143 | 3300053088 | Ga0500644_0034521 | Ga0500644_0034521_737_1159 | 140 |
| 144 | 3300053089 | Ga0500581_043214 | Ga0500581_043214_1663_2085 | 140 |
| 145 | 3300053090 | Ga0500646_0010996 | Ga0500646_0010996_340_762 | 140 |
| 146 | 3300053093 | Ga0500651_0123443 | Ga0500651_0123443_960_1382 | 140 |
| 147 | 3300053094 | Ga0500566_0000574 | Ga0500566_0000574_15667_16089 | 140 |
| 148 | 3300053096 | Ga0500641_0000742 | Ga0500641_0000742_1962_2384 | 140 |
| 149 | 3300053098 | Ga0500650_0003757 | Ga0500650_0003757_4109_4531 | 140 |
| 150 | 3300053103 | Ga0500555_045844 | Ga0500555_045844_684_1106 | 140 |
| 151 | 3300053104 | Ga0500556_0000035 | Ga0500556_0000035_41159_41581 | 140 |
| 152 | 3300053108 | Ga0500562_087964 | Ga0500562_087964_69_491 | 140 |
| 153 | 3300053109 | Ga0500569_013787 | Ga0500569_013787_1178_1600 | 140 |
| 154 | 3300053116 | Ga0500592_007600 | Ga0500592_007600_129_551 | 140 |
| 155 | 3300053117 | Ga0500593_028184 | Ga0500593_028184_1887_2309 | 140 |
| 156 | 3300053118 | Ga0500594_0039849 | Ga0500594_0039849_134_556 | 140 |
| 157 | 3300053122 | Ga0500608_000269 | Ga0500608_000269_6757_7179 | 140 |
| 158 | 3300053125 | Ga0500618_011506 | Ga0500618_011506_405_827 | 140 |
| 159 | 3300053125 | Ga0500618_022841 | Ga0500618_022841_158_580 | 140 |
| 160 | 3300053130 | Ga0500642_0000027 | Ga0500642_0000027_56652_57074 | 140 |
| 161 | 3300053131 | Ga0500652_000529 | Ga0500652_000529_7706_8128 | 140 |
| 162 | 3300053136 | Ga0500559_0000064 | Ga0500559_0000064_60441_60863 | 140 |
| 163 | 3300053139 | Ga0500568_0000443 | Ga0500568_0000443_25476_25898 | 140 |
| 164 | 3300053151 | Ga0500604_0036684 | Ga0500604_0036684_398_820 | 140 |
| 165 | 3300053153 | Ga0500616_0000054 | Ga0500616_0000054_245519_245941 | 140 |
| 166 | 3300053154 | Ga0500619_031272 | Ga0500619_031272_749_1171 | 140 |
| 167 | 3300053156 | Ga0500622_0019279 | Ga0500622_0019279_587_1009 | 140 |
| 168 | 3300053158 | Ga0500627_0025162 | Ga0500627_0025162_1939_2361 | 140 |
| 169 | 3300053177 | Ga0500636_0001203 | Ga0500636_0001203_11099_11521 | 140 |
| 170 | 3300053177 | Ga0500636_0545175 | Ga0500636_0545175_56_478 | 140 |
| 171 | 3300053727 | Ga0500611_012900 | Ga0500611_012900_842_1264 | 140 |
| 172 | iso_pu_bacteria | 2511231028 | 2511394357 | 140 |
| 173 | iso_pu_bacteria | 2513237092 | 2513624461 | 140 |
| 174 | iso_pu_bacteria | 2513237095 | 2513649935 | 140 |
| 175 | iso_pu_bacteria | 2513237102 | 2513702464 | 140 |
| 176 | iso_pu_bacteria | 2513237139 | 2513874230 | 140 |
| 177 | iso_pu_bacteria | 2513237161 | 2514010004 | 140 |
| 178 | iso_pu_bacteria | 2517093001 | 2517104628 | 140 |
| 179 | iso_pu_bacteria | 2528768022 | 2528850432 | 140 |
| 180 | iso_pu_bacteria | 2617270735 | 2617353855 | 140 |
| 181 | iso_pu_bacteria | 2617270741 | 2617374632 | 140 |
| 182 | iso_pu_bacteria | 2791355196 | 2793059364 | 140 |
| 183 | iso_pu_bacteria | 2802429603 | 2805922120 | 140 |
| 184 | iso_pu_bacteria | 2816332527 | 2818240935 | 140 |
| 185 | iso_pu_bacteria | 2824600985 | 2824604631 | 140 |
| 186 | iso_pu_bacteria | 2824609381 | 2824616161 | 140 |
| 187 | iso_pu_bacteria | 2824617872 | 2824618904 | 140 |
| 188 | iso_pu_bacteria | 2824626560 | 2824632920 | 140 |
| 189 | iso_pu_bacteria | 2824635225 | 2824642619 | 140 |
| 190 | iso_pu_bacteria | 2824644064 | 2824652911 | 140 |
| 191 | iso_pu_bacteria | 2824653114 | 2824658380 | 140 |
| 192 | iso_pu_bacteria | 2824661429 | 2824667389 | 140 |
| 193 | iso_pu_bacteria | 2824671348 | 2824675533 | 140 |
| 194 | iso_pu_bacteria | 2824679649 | 2824686568 | 140 |
| 195 | iso_pu_bacteria | 2824687955 | 2824691755 | 140 |
| 196 | iso_pu_bacteria | 2824696289 | 2824698982 | 140 |
| 197 | iso_pu_bacteria | 2824714736 | 2824723756 | 140 |
| 198 | iso_pu_bacteria | 2824723954 | 2824730663 | 140 |
| 199 | iso_pu_bacteria | 2824732956 | 2824739312 | 140 |
| 200 | iso_pu_bacteria | 2824746037 | 2824750396 | 140 |
| 201 | iso_pu_bacteria | 2824773399 | 2824779749 | 140 |
| 202 | iso_pu_bacteria | 2838122688 | 2838126091 | 140 |
| 203 | iso_pu_bacteria | 2841941048 | 2841942516 | 140 |
| 204 | iso_pu_bacteria | 2841949485 | 2841953134 | 140 |
| 205 | iso_pu_bacteria | 2841957949 | 2841960642 | 140 |
| 206 | iso_pu_bacteria | 2841966195 | 2841970842 | 140 |
| 207 | iso_pu_bacteria | 2841974524 | 2841977899 | 140 |
| 208 | iso_pu_bacteria | 2841983080 | 2841984536 | 140 |
| 209 | iso_pu_bacteria | 2842038055 | 2842041743 | 140 |
| 210 | iso_pu_bacteria | 2842045827 | 2842049785 | 140 |
| 211 | iso_pu_bacteria | 2847930680 | 2847932038 | 140 |
| 212 | iso_pu_bacteria | 2847939898 | 2847943275 | 140 |
| 213 | iso_pu_bacteria | 2857509624 | 2857514724 | 140 |
| 214 | iso_pu_bacteria | 2874612657 | 2874620322 | 140 |
| 215 | iso_pu_bacteria | 2874620515 | 2874624260 | 140 |
| 216 | iso_pu_bacteria | 2874628541 | 2874630266 | 140 |
| 217 | iso_pu_bacteria | 2879083081 | 2879085714 | 140 |
| 218 | iso_pu_bacteria | 2879099564 | 2879100882 | 140 |
| 219 | iso_pu_bacteria | 2888378607 | 2888387671 | 140 |
| 220 | iso_pu_bacteria | 2888419890 | 2888426888 | 140 |
| 221 | iso_pu_bacteria | 2904666416 | 2904670971 | 140 |
| 222 | iso_pu_bacteria | 2906643746 | 2906647247 | 140 |
| 223 | iso_pu_bacteria | 2908775508 | 2908777113 | 140 |
| 224 | iso_pu_bacteria | 2922393267 | 2922398605 | 140 |
| 225 | iso_pu_bacteria | 2929615660 | 2929619838 | 140 |
| 226 | iso_pu_bacteria | 2929624759 | 2929629149 | 140 |
| 227 | iso_pu_bacteria | 2932784394 | 2932789718 | 140 |
| 228 | iso_pu_bacteria | 2932809354 | 2932817770 | 140 |
| 229 | iso_pu_bacteria | 2932818245 | 2932827119 | 140 |
| 230 | iso_pu_bacteria | 2932828146 | 2932835643 | 140 |
| 231 | iso_pu_bacteria | 2933577622 | 2933581757 | 140 |
| 232 | iso_pu_bacteria | 2935616580 | 2935624583 | 140 |
| 233 | iso_pu_bacteria | 2935638405 | 2935647190 | 140 |
| 234 | iso_pu_bacteria | 2935665750 | 2935674347 | 140 |
| 235 | iso_pu_bacteria | 2935675223 | 2935684228 | 140 |
| 236 | iso_pu_bacteria | 2935684952 | 2935689099 | 140 |
| 237 | iso_pu_bacteria | 2935694250 | 2935697641 | 140 |
| 238 | iso_pu_bacteria | 2935703347 | 2935711336 | 140 |
| 239 | iso_pu_bacteria | 2935713505 | 2935720045 | 140 |
| 240 | iso_pu_bacteria | 2935722832 | 2935728338 | 140 |
| 241 | iso_pu_bacteria | 2935732158 | 2935737065 | 140 |
| 242 | iso_pu_bacteria | 2935741537 | 2935746874 | 140 |
| 243 | iso_pu_bacteria | 2935750917 | 2935757841 | 140 |
| 244 | iso_pu_bacteria | 2935760218 | 2935764219 | 140 |
| 245 | iso_pu_bacteria | 2935801545 | 2935809878 | 140 |
| 246 | iso_pu_bacteria | 2935810662 | 2935819341 | 140 |
| 247 | iso_pu_bacteria | 2935827899 | 2935836614 | 140 |
| 248 | iso_pu_bacteria | 2935837841 | 2935846824 | 140 |
| 249 | iso_pu_bacteria | 2935855204 | 2935863207 | 140 |
| 250 | iso_pu_bacteria | 2935864058 | 2935868676 | 140 |
| 251 | iso_pu_bacteria | 2935873716 | 2935879450 | 140 |
| 252 | iso_pu_bacteria | 2935992306 | 2936000244 | 140 |
| 253 | iso_pu_bacteria | 2936002035 | 2936010286 | 140 |
| 254 | iso_pu_bacteria | 2936037263 | 2936045964 | 140 |
| 255 | iso_pu_bacteria | 2940556831 | 2940563337 | 140 |
| 256 | iso_pu_bacteria | 2941538514 | 2941547250 | 140 |
| 257 | iso_pu_bacteria | 3005483717 | 3005485969 | 140 |
| 258 | iso_pu_bacteria | 3005506211 | 3005506633 | 140 |
| 259 | iso_pu_bacteria | 3005587118 | 3005591791 | 140 |
| 260 | iso_pu_bacteria | 8016511872 | 8016519172 | 140 |
| 261 | iso_pu_bacteria | 8017057580 | 8017066331 | 140 |
| 262 | iso_pu_bacteria | 8019576017 | 8019578287 | 140 |
| 263 | iso_pu_bacteria | 8019586578 | 8019596322 | 140 |
| 264 | iso_pu_bacteria | 8019597564 | 8019605377 | 140 |
| 265 | iso_pu_bacteria | 8019608314 | 8019613166 | 140 |
| 266 | iso_pu_bacteria | 8055742211 | 8055750409 | 140 |
| 267 | iso_pu_bacteria | 8056967851 | 8056971811 | 140 |
| 268 | 3300035113 | Ga0373936_0139993 | Ga0373936_0139993_537_1001 | 141 |
| 269 | 3300053091 | Ga0500647_0017905 | Ga0500647_0017905_214_678 | 141 |
| 270 | 3300053094 | Ga0500566_0000113 | Ga0500566_0000113_25251_25715 | 141 |
| 271 | 3300053095 | Ga0500640_000015 | Ga0500640_000015_8698_9162 | 141 |
| 272 | 3300053111 | Ga0500572_000087 | Ga0500572_000087_6888_7352 | 141 |
| 273 | 3300053115 | Ga0500591_214450 | Ga0500591_214450_165_629 | 141 |
| 274 | 3300053122 | Ga0500608_162729 | Ga0500608_162729_94_558 | 141 |
| 275 | 3300053123 | Ga0500614_000881 | Ga0500614_000881_1237_1701 | 141 |
| 276 | 3300053136 | Ga0500559_0001344 | Ga0500559_0001344_12934_13398 | 141 |
| 277 | 3300053144 | Ga0500585_087784 | Ga0500585_087784_362_826 | 141 |
| 278 | 3300053150 | Ga0500603_000174 | Ga0500603_000174_4477_4941 | 141 |
| 279 | 3300053159 | Ga0500630_002996 | Ga0500630_002996_4810_5274 | 141 |
| 280 | 3300053163 | Ga0500639_000050 | Ga0500639_000050_30587_31051 | 141 |
| 281 | 3300053178 | Ga0500637_0106448 | Ga0500637_0106448_1051_1515 | 141 |
| 282 | 3300053735 | Ga0500596_000100 | Ga0500596_000100_1474_1938 | 141 |
| 283 | 3300053737 | Ga0500601_003419 | Ga0500601_003419_743_1207 | 141 |
| 284 | iso_pu_bacteria | 2513237101 | 2513697587 | 142 |
| 285 | iso_pu_bacteria | 2524023205 | 2524438578 | 142 |
| 286 | iso_pu_bacteria | 2744054633 | 2745077196 | 142 |
| 287 | iso_pu_bacteria | 2874604998 | 2874606782 | 142 |
| 288 | iso_pu_bacteria | 2876761206 | 2876767700 | 142 |
| 289 | iso_pu_bacteria | 2885409591 | 2885411514 | 142 |
| 290 | iso_pu_bacteria | 2935959822 | 2935965424 | 142 |
| 291 | iso_pu_bacteria | 2941531003 | 2941531942 | 142 |
| 292 | iso_pu_bacteria | 8006994254 | 8006999188 | 142 |
| 293 | iso_pu_bacteria | 8056681323 | 8056685492 | 142 |
| 294 | 3300005617 | Ga0068859_100723974 | Ga0068859_1007239742 | 143 |
| 295 | 3300005842 | Ga0068858_100319919 | Ga0068858_1003199192 | 143 |
| 296 | 3300006931 | Ga0097620_100723877 | Ga0097620_1007238772 | 143 |
| 297 | 3300007788 | Ga0099795_10027007 | Ga0099795_100270072 | 143 |
| 298 | 3300025261 | Ga0209233_1013851 | Ga0209233_10138512 | 143 |
| 299 | 3300025272 | Ga0209455_1002295 | Ga0209455_10022957 | 143 |
| 300 | 3300025900 | Ga0207710_10187867 | Ga0207710_101878672 | 143 |
| 301 | 3300025914 | Ga0207671_10718274 | Ga0207671_107182741 | 143 |
| 302 | 3300048929 | Ga0496126_0016838 | Ga0496126_0016838_6322_6753 | 143 |
| 303 | 3300053119 | Ga0500595_035406 | Ga0500595_035406_290_721 | 143 |
| 304 | iso_pu_bacteria | 2602042107 | 2603860660 | 143 |
| 305 | iso_pu_bacteria | 2721755755 | 2723842535 | 143 |
| 306 | iso_pu_bacteria | 2857524615 | 2857525619 | 143 |
| 307 | iso_pu_bacteria | 2879110137 | 2879113484 | 143 |
| 308 | iso_pu_bacteria | 2893066018 | 2893070657 | 143 |
| 309 | iso_pu_bacteria | 2919073203 | 2919074572 | 143 |
| 310 | iso_pu_bacteria | 2922361189 | 2922367579 | 143 |
| 311 | iso_pu_bacteria | 8006964411 | 8006965420 | 143 |
| 312 | iso_pu_bacteria | 8006984368 | 8006986148 | 143 |
| 313 | 3300005457 | Ga0070662_100569355 | Ga0070662_1005693551 | 144 |
| 314 | 3300005548 | Ga0070665_100062245 | Ga0070665_1000622454 | 144 |
| 315 | 3300005548 | Ga0070665_101508262 | Ga0070665_1015082621 | 144 |
| 316 | 3300005563 | Ga0068855_101239547 | Ga0068855_1012395472 | 144 |
| 317 | 3300006177 | Ga0075362_10206452 | Ga0075362_102064522 | 144 |
| 318 | 3300006186 | Ga0075369_10032107 | Ga0075369_100321073 | 144 |
| 319 | 3300006195 | Ga0075366_10074104 | Ga0075366_100741042 | 144 |
| 320 | 3300015262 | Ga0182007_10393072 | Ga0182007_103930721 | 144 |
| 321 | 3300025253 | Ga0209677_100501 | Ga0209677_1005016 | 144 |
| 322 | 3300025272 | Ga0209455_1046062 | Ga0209455_10460621 | 144 |
| 323 | 3300028379 | Ga0268266_10028563 | Ga0268266_100285635 | 144 |
| 324 | 3300028379 | Ga0268266_10647462 | Ga0268266_106474621 | 144 |
| 325 | 3300033180 | Ga0307510_10011129 | Ga0307510_100111299 | 144 |
| 326 | 3300037471 | Ga0395905_0071917 | Ga0395905_0071917_1220_1654 | 144 |
| 327 | 3300038443 | Ga0395901_0088921 | Ga0395901_0088921_1228_1662 | 144 |
| 328 | 3300039437 | Ga0436365_1394541 | Ga0436365_1394541_106_543 | 144 |
| 329 | 3300039437 | Ga0436365_1539897 | Ga0436365_1539897_137_574 | 144 |
| 330 | 3300046460 | Ga0495638_0366263 | Ga0495638_0366263_216_650 | 144 |
| 331 | 3300046500 | Ga0495596_0349182 | Ga0495596_0349182_117_551 | 144 |
| 332 | 3300046516 | Ga0495628_0526830 | Ga0495628_0526830_91_525 | 144 |
| 333 | 3300046536 | Ga0495587_0285163 | Ga0495587_0285163_411_845 | 144 |
| 334 | 3300046679 | Ga0495623_0238640 | Ga0495623_0238640_111_545 | 144 |
| 335 | 3300047469 | Ga0495673_0206617 | Ga0495673_0206617_134_568 | 144 |
| 336 | 3300048919 | Ga0496116_0104835 | Ga0496116_0104835_702_1139 | 144 |
| 337 | 3300048920 | Ga0496117_0050653 | Ga0496117_0050653_831_1265 | 144 |
| 338 | 3300048920 | Ga0496117_0165289 | Ga0496117_0165289_777_1214 | 144 |
| 339 | 3300048921 | Ga0496118_0018352 | Ga0496118_0018352_1527_1961 | 144 |
| 340 | 3300048921 | Ga0496118_0035734 | Ga0496118_0035734_1265_1699 | 144 |
| 341 | 3300048922 | Ga0496119_0037240 | Ga0496119_0037240_1148_1582 | 144 |
| 342 | 3300048922 | Ga0496119_0048668 | Ga0496119_0048668_894_1328 | 144 |
| 343 | 3300048922 | Ga0496119_0058578 | Ga0496119_0058578_1387_1821 | 144 |
| 344 | 3300048923 | Ga0496120_0269523 | Ga0496120_0269523_134_568 | 144 |
| 345 | 3300048924 | Ga0496121_0001525 | Ga0496121_0001525_27683_28117 | 144 |
| 346 | 3300048924 | Ga0496121_0085939 | Ga0496121_0085939_1827_2264 | 144 |
| 347 | 3300048924 | Ga0496121_0565601 | Ga0496121_0565601_54_491 | 144 |
| 348 | 3300048929 | Ga0496126_0874033 | Ga0496126_0874033_112_546 | 144 |
| 349 | 3300049460 | Ga0495682_0195331 | Ga0495682_0195331_49_483 | 144 |
| 350 | 3300050489 | nmdc:mga03683_58498_c1 | nmdc:mga03683_58498_c1_965_1399 | 144 |
| 351 | 3300050493 | nmdc:mga0k408_273329_c1 | nmdc:mga0k408_273329_c1_61_495 | 144 |
| 352 | 3300050496 | nmdc:mga07m45_99476_c1 | nmdc:mga07m45_99476_c1_985_1419 | 144 |
| 353 | 3300053084 | Ga0495595_0508876 | Ga0495595_0508876_55_489 | 144 |
| 354 | 3300053086 | Ga0500578_0041351 | Ga0500578_0041351_2426_2860 | 144 |
| 355 | 3300053093 | Ga0500651_0056536 | Ga0500651_0056536_537_971 | 144 |
| 356 | 3300053104 | Ga0500556_0029460 | Ga0500556_0029460_429_863 | 144 |
| 357 | 3300053116 | Ga0500592_041883 | Ga0500592_041883_214_648 | 144 |
| 358 | 3300053119 | Ga0500595_005832 | Ga0500595_005832_2423_2857 | 144 |
| 359 | 3300053130 | Ga0500642_0083197 | Ga0500642_0083197_734_1168 | 144 |
| 360 | 3300053139 | Ga0500568_0115453 | Ga0500568_0115453_120_554 | 144 |
| 361 | 3300053146 | Ga0500588_0175589 | Ga0500588_0175589_231_665 | 144 |
| 362 | 3300053151 | Ga0500604_0092125 | Ga0500604_0092125_272_706 | 144 |
| 363 | 3300053158 | Ga0500627_0016445 | Ga0500627_0016445_354_788 | 144 |
| 364 | 3300053158 | Ga0500627_0038515 | Ga0500627_0038515_62_496 | 144 |
| 365 | 3300006237 | Ga0097621_100549798 | Ga0097621_1005497982 | 145 |
| 366 | 3300047469 | Ga0495673_0118238 | Ga0495673_0118238_440_877 | 145 |
| 367 | 3300050493 | nmdc:mga0k408_708906_c1 | nmdc:mga0k408_708906_c1_101_538 | 145 |
| 368 | 3300005328 | Ga0070676_10541668 | Ga0070676_105416682 | 146 |
| 369 | 3300005355 | Ga0070671_100976432 | Ga0070671_1009764321 | 146 |
| 370 | 3300005435 | Ga0070714_100019687 | Ga0070714_1000196874 | 146 |
| 371 | 3300005436 | Ga0070713_100042782 | Ga0070713_1000427825 | 146 |
| 372 | 3300005437 | Ga0070710_10004296 | Ga0070710_100042965 | 146 |
| 373 | 3300005439 | Ga0070711_100069627 | Ga0070711_1000696275 | 146 |
| 374 | 3300005445 | Ga0070708_101778090 | Ga0070708_1017780901 | 146 |
| 375 | 3300005455 | Ga0070663_100213913 | Ga0070663_1002139132 | 146 |
| 376 | 3300005467 | Ga0070706_101037429 | Ga0070706_1010374291 | 146 |
| 377 | 3300005547 | Ga0070693_100425058 | Ga0070693_1004250581 | 146 |
| 378 | 3300005548 | Ga0070665_100005416 | Ga0070665_1000054165 | 146 |
| 379 | 3300005564 | Ga0070664_100465619 | Ga0070664_1004656192 | 146 |
| 380 | 3300005616 | Ga0068852_100104864 | Ga0068852_1001048642 | 146 |
| 381 | 3300006028 | Ga0070717_10143799 | Ga0070717_101437993 | 146 |
| 382 | 3300006038 | Ga0075365_10282263 | Ga0075365_102822632 | 146 |
| 383 | 3300006042 | Ga0075368_10057590 | Ga0075368_100575902 | 146 |
| 384 | 3300006048 | Ga0075363_100002282 | Ga0075363_1000022825 | 146 |
| 385 | 3300006051 | Ga0075364_10550331 | Ga0075364_105503312 | 146 |
| 386 | 3300006163 | Ga0070715_10000876 | Ga0070715_100008765 | 146 |
| 387 | 3300006173 | Ga0070716_100002220 | Ga0070716_1000022209 | 146 |
| 388 | 3300006175 | Ga0070712_100095599 | Ga0070712_1000955991 | 146 |
| 389 | 3300006178 | Ga0075367_10152725 | Ga0075367_101527251 | 146 |
| 390 | 3300006178 | Ga0075367_10206156 | Ga0075367_102061562 | 146 |
| 391 | 3300006353 | Ga0075370_10474906 | Ga0075370_104749062 | 146 |
| 392 | 3300006358 | Ga0068871_100500593 | Ga0068871_1005005932 | 146 |
| 393 | 3300009101 | Ga0105247_10373738 | Ga0105247_103737382 | 146 |
| 394 | 3300009551 | Ga0105238_10676304 | Ga0105238_106763041 | 146 |
| 395 | 3300013308 | Ga0157375_10863399 | Ga0157375_108633992 | 146 |
| 396 | 3300014325 | Ga0163163_10503827 | Ga0163163_105038272 | 146 |
| 397 | 3300025898 | Ga0207692_10001396 | Ga0207692_100013964 | 146 |
| 398 | 3300025905 | Ga0207685_10011404 | Ga0207685_100114044 | 146 |
| 399 | 3300025906 | Ga0207699_10021630 | Ga0207699_100216302 | 146 |
| 400 | 3300025915 | Ga0207693_10002986 | Ga0207693_100029865 | 146 |
| 401 | 3300025916 | Ga0207663_10001112 | Ga0207663_100011124 | 146 |
| 402 | 3300025924 | Ga0207694_10270457 | Ga0207694_102704572 | 146 |
| 403 | 3300025924 | Ga0207694_10387726 | Ga0207694_103877262 | 146 |
| 404 | 3300025928 | Ga0207700_10054664 | Ga0207700_100546641 | 146 |
| 405 | 3300025929 | Ga0207664_10081551 | Ga0207664_100815514 | 146 |
| 406 | 3300025939 | Ga0207665_10000703 | Ga0207665_1000070316 | 146 |
| 407 | 3300025945 | Ga0207679_10406249 | Ga0207679_104062492 | 146 |
| 408 | 3300025981 | Ga0207640_10553339 | Ga0207640_105533391 | 146 |
| 409 | 3300026067 | Ga0207678_10156831 | Ga0207678_101568312 | 146 |
| 410 | 3300026067 | Ga0207678_10331066 | Ga0207678_103310662 | 146 |
| 411 | 3300026078 | Ga0207702_10665328 | Ga0207702_106653281 | 146 |
| 412 | 3300026116 | Ga0207674_11238141 | Ga0207674_112381412 | 146 |
| 413 | 3300026142 | Ga0207698_10253567 | Ga0207698_102535672 | 146 |
| 414 | 3300027866 | Ga0209813_10038085 | Ga0209813_100380852 | 146 |
| 415 | 3300028379 | Ga0268266_10001796 | Ga0268266_1000179613 | 146 |
| 416 | 3300031247 | Ga0265340_10037021 | Ga0265340_100370212 | 146 |
| 417 | 3300031249 | Ga0265339_10007436 | Ga0265339_100074367 | 146 |
| 418 | 3300031548 | Ga0307408_100168937 | Ga0307408_1001689372 | 146 |
| 419 | 3300031616 | Ga0307508_10127761 | Ga0307508_101277612 | 146 |
| 420 | 3300031730 | Ga0307516_10074830 | Ga0307516_100748302 | 146 |
| 421 | 3300031824 | Ga0307413_10750133 | Ga0307413_107501331 | 146 |
| 422 | 3300031838 | Ga0307518_10178990 | Ga0307518_101789902 | 146 |
| 423 | 3300031911 | Ga0307412_10059879 | Ga0307412_100598792 | 146 |
| 424 | 3300031995 | Ga0307409_101123334 | Ga0307409_1011233342 | 146 |
| 425 | 3300033180 | Ga0307510_10069015 | Ga0307510_100690154 | 146 |
| 426 | 3300037471 | Ga0395905_0185780 | Ga0395905_0185780_115_585 | 146 |
| 427 | 3300037471 | Ga0395905_1130254 | Ga0395905_1130254_197_637 | 146 |
| 428 | 3300044684 | Ga0466966_0000720 | Ga0466966_0000720_16294_16752 | 146 |
| 429 | 3300044693 | Ga0466961_0000136 | Ga0466961_0000136_31868_32326 | 146 |
| 430 | 3300044719 | Ga0466971_0639603 | Ga0466971_0639603_48_506 | 146 |
| 431 | 3300045836 | Ga0466958_0118098 | Ga0466958_0118098_791_1249 | 146 |
| 432 | 3300046474 | Ga0495605_0203080 | Ga0495605_0203080_148_588 | 146 |
| 433 | 3300046506 | Ga0495583_0096872 | Ga0495583_0096872_426_866 | 146 |
| 434 | 3300046507 | Ga0495606_0267711 | Ga0495606_0267711_408_926 | 146 |
| 435 | 3300046512 | Ga0495610_0320281 | Ga0495610_0320281_30_548 | 146 |
| 436 | 3300046519 | Ga0495632_0263489 | Ga0495632_0263489_214_732 | 146 |
| 437 | 3300046524 | Ga0495648_0065206 | Ga0495648_0065206_1153_1593 | 146 |
| 438 | 3300046529 | Ga0495652_0103154 | Ga0495652_0103154_1782_2222 | 146 |
| 439 | 3300046538 | Ga0495609_0324196 | Ga0495609_0324196_131_589 | 146 |
| 440 | 3300046616 | Ga0495668_0035543 | Ga0495668_0035543_981_1424 | 146 |
| 441 | 3300046660 | Ga0495625_0083627 | Ga0495625_0083627_107_547 | 146 |
| 442 | 3300047320 | Ga0495672_0415460 | Ga0495672_0415460_52_570 | 146 |
| 443 | 3300047323 | Ga0495683_0030240 | Ga0495683_0030240_85_525 | 146 |
| 444 | 3300047472 | Ga0495686_0402037 | Ga0495686_0402037_117_557 | 146 |
| 445 | 3300048904 | Ga0496101_0218386 | Ga0496101_0218386_988_1431 | 146 |
| 446 | 3300048905 | Ga0496102_0988114 | Ga0496102_0988114_30_470 | 146 |
| 447 | 3300048910 | Ga0496107_0153876 | Ga0496107_0153876_455_895 | 146 |
| 448 | 3300048913 | Ga0496110_1061011 | Ga0496110_1061011_223_663 | 146 |
| 449 | 3300048917 | Ga0496114_1210087 | Ga0496114_1210087_82_525 | 146 |
| 450 | 3300048918 | Ga0496115_0327108 | Ga0496115_0327108_507_947 | 146 |
| 451 | 3300048924 | Ga0496121_0382581 | Ga0496121_0382581_87_605 | 146 |
| 452 | 3300048929 | Ga0496126_0003212 | Ga0496126_0003212_11262_11780 | 146 |
| 453 | 3300048929 | Ga0496126_0524488 | Ga0496126_0524488_49_489 | 146 |
| 454 | 3300048929 | Ga0496126_0717016 | Ga0496126_0717016_260_700 | 146 |
| 455 | 3300049460 | Ga0495682_0055990 | Ga0495682_0055990_664_1107 | 146 |
| 456 | 3300049460 | Ga0495682_0075980 | Ga0495682_0075980_598_1038 | 146 |
| 457 | 3300049569 | Ga0501032_0000196 | Ga0501032_0000196_26079_26567 | 146 |
| 458 | 3300049570 | Ga0501033_0001104 | Ga0501033_0001104_8667_9155 | 146 |
| 459 | 3300049571 | Ga0501034_0001151 | Ga0501034_0001151_26079_26567 | 146 |
| 460 | 3300049572 | Ga0501036_0000323 | Ga0501036_0000323_14679_15167 | 146 |
| 461 | 3300049573 | Ga0501037_0001204 | Ga0501037_0001204_8398_8886 | 146 |
| 462 | 3300049574 | Ga0501038_0002973 | Ga0501038_0002973_5084_5572 | 146 |
| 463 | 3300049574 | Ga0501038_0798311 | Ga0501038_0798311_139_627 | 146 |
| 464 | 3300049575 | Ga0501039_0000705 | Ga0501039_0000705_5619_6107 | 146 |
| 465 | 3300049576 | Ga0501040_0285972 | Ga0501040_0285972_470_910 | 146 |
| 466 | 3300049578 | Ga0501042_0032152 | Ga0501042_0032152_2527_3015 | 146 |
| 467 | 3300049579 | Ga0501043_0000409 | Ga0501043_0000409_12091_12579 | 146 |
| 468 | 3300049580 | Ga0501046_0000181 | Ga0501046_0000181_26079_26567 | 146 |
| 469 | 3300049581 | Ga0501047_0000419 | Ga0501047_0000419_8398_8886 | 146 |
| 470 | 3300049582 | Ga0501048_0000057 | Ga0501048_0000057_41226_41714 | 146 |
| 471 | 3300049583 | Ga0501067_0000145 | Ga0501067_0000145_26022_26510 | 146 |
| 472 | 3300049584 | Ga0501068_0001512 | Ga0501068_0001512_2969_3457 | 146 |
| 473 | 3300049585 | Ga0501069_0001180 | Ga0501069_0001180_2495_2983 | 146 |
| 474 | 3300049586 | Ga0501070_0019419 | Ga0501070_0019419_4576_5064 | 146 |
| 475 | 3300049586 | Ga0501070_0024463 | Ga0501070_0024463_356_844 | 146 |
| 476 | 3300049586 | Ga0501070_0706112 | Ga0501070_0706112_160_600 | 146 |
| 477 | 3300049587 | Ga0501071_0026796 | Ga0501071_0026796_1798_2286 | 146 |
| 478 | 3300049588 | Ga0501072_0000643 | Ga0501072_0000643_4367_4855 | 146 |
| 479 | 3300049589 | Ga0501073_0000027 | Ga0501073_0000027_27122_27610 | 146 |
| 480 | 3300049590 | Ga0501074_0000081 | Ga0501074_0000081_44467_44955 | 146 |
| 481 | 3300049741 | Ga0501079_0013675 | Ga0501079_0013675_3093_3581 | 146 |
| 482 | 3300049742 | Ga0501080_0000883 | Ga0501080_0000883_11078_11566 | 146 |
| 483 | 3300049742 | Ga0501080_0538795 | Ga0501080_0538795_403_891 | 146 |
| 484 | 3300049744 | Ga0501083_0004050 | Ga0501083_0004050_9832_10272 | 146 |
| 485 | 3300049822 | Ga0501035_0003158 | Ga0501035_0003158_5115_5603 | 146 |
| 486 | 3300049823 | Ga0501044_0001511 | Ga0501044_0001511_8526_9014 | 146 |
| 487 | 3300049824 | Ga0501045_0007967 | Ga0501045_0007967_635_1123 | 146 |
| 488 | 3300050490 | nmdc:mga03n38_640_c1 | nmdc:mga03n38_640_c1_1555_1995 | 146 |
| 489 | 3300050491 | nmdc:mga00v17_486919_c1 | nmdc:mga00v17_486919_c1_70_510 | 146 |
| 490 | 3300050494 | nmdc:mga06z11_249403_c1 | nmdc:mga06z11_249403_c1_77_520 | 146 |
| 491 | 3300050494 | nmdc:mga06z11_43089_c1 | nmdc:mga06z11_43089_c1_1505_1945 | 146 |
| 492 | 3300050494 | nmdc:mga06z11_662578_c1 | nmdc:mga06z11_662578_c1_155_598 | 146 |
| 493 | 3300050495 | nmdc:mga04h51_46550_c1 | nmdc:mga04h51_46550_c1_496_936 | 146 |
| 494 | 3300050496 | nmdc:mga07m45_79576_c1 | nmdc:mga07m45_79576_c1_186_626 | 146 |
| 495 | 3300053119 | Ga0500595_006784 | Ga0500595_006784_4173_4613 | 146 |
| 496 | 3300053119 | Ga0500595_055447 | Ga0500595_055447_633_1073 | 146 |
| 497 | 3300053163 | Ga0500639_122094 | Ga0500639_122094_442_894 | 146 |
| 498 | 3300054114 | Ga0501084_0003425 | Ga0501084_0003425_5174_5662 | 146 |
| 499 | 3300060353 | Ga0501082_0007835 | Ga0501082_0007835_3079_3567 | 146 |
| 500 | 3300002070 | JGI24750J21931_1051047 | JGI24750J21931_10510471 | 147 |
| 501 | 3300003659 | JGI25404J52841_10019690 | JGI25404J52841_100196902 | 147 |
| 502 | 3300005328 | Ga0070676_10763867 | Ga0070676_107638671 | 147 |
| 503 | 3300005331 | Ga0070670_100684830 | Ga0070670_1006848301 | 147 |
| 504 | 3300005334 | Ga0068869_100191727 | Ga0068869_1001917272 | 147 |
| 505 | 3300005335 | Ga0070666_11132787 | Ga0070666_111327871 | 147 |
| 506 | 3300005338 | Ga0068868_100141546 | Ga0068868_1001415462 | 147 |
| 507 | 3300005338 | Ga0068868_100797478 | Ga0068868_1007974781 | 147 |
| 508 | 3300005338 | Ga0068868_100887071 | Ga0068868_1008870711 | 147 |
| 509 | 3300005339 | Ga0070660_100232836 | Ga0070660_1002328361 | 147 |
| 510 | 3300005340 | Ga0070689_100116708 | Ga0070689_1001167082 | 147 |
| 511 | 3300005344 | Ga0070661_101323105 | Ga0070661_1013231051 | 147 |
| 512 | 3300005347 | Ga0070668_100045692 | Ga0070668_1000456922 | 147 |
| 513 | 3300005347 | Ga0070668_100071734 | Ga0070668_1000717343 | 147 |
| 514 | 3300005347 | Ga0070668_100114651 | Ga0070668_1001146512 | 147 |
| 515 | 3300005347 | Ga0070668_100417909 | Ga0070668_1004179092 | 147 |
| 516 | 3300005347 | Ga0070668_100607425 | Ga0070668_1006074252 | 147 |
| 517 | 3300005354 | Ga0070675_100661982 | Ga0070675_1006619822 | 147 |
| 518 | 3300005356 | Ga0070674_100050603 | Ga0070674_1000506033 | 147 |
| 519 | 3300005364 | Ga0070673_100610327 | Ga0070673_1006103272 | 147 |
| 520 | 3300005365 | Ga0070688_100442997 | Ga0070688_1004429971 | 147 |
| 521 | 3300005365 | Ga0070688_100847227 | Ga0070688_1008472271 | 147 |
| 522 | 3300005366 | Ga0070659_100098791 | Ga0070659_1000987911 | 147 |
| 523 | 3300005435 | Ga0070714_101499796 | Ga0070714_1014997961 | 147 |
| 524 | 3300005436 | Ga0070713_100145429 | Ga0070713_1001454292 | 147 |
| 525 | 3300005438 | Ga0070701_10483351 | Ga0070701_104833512 | 147 |
| 526 | 3300005441 | Ga0070700_100022185 | Ga0070700_1000221852 | 147 |
| 527 | 3300005441 | Ga0070700_100699770 | Ga0070700_1006997701 | 147 |
| 528 | 3300005444 | Ga0070694_100790158 | Ga0070694_1007901582 | 147 |
| 529 | 3300005455 | Ga0070663_100052019 | Ga0070663_1000520193 | 147 |
| 530 | 3300005455 | Ga0070663_100063341 | Ga0070663_1000633412 | 147 |
| 531 | 3300005455 | Ga0070663_100083973 | Ga0070663_1000839732 | 147 |
| 532 | 3300005455 | Ga0070663_100088376 | Ga0070663_1000883761 | 147 |
| 533 | 3300005455 | Ga0070663_100103811 | Ga0070663_1001038113 | 147 |
| 534 | 3300005456 | Ga0070678_100029628 | Ga0070678_1000296282 | 147 |
| 535 | 3300005456 | Ga0070678_101322955 | Ga0070678_1013229552 | 147 |
| 536 | 3300005457 | Ga0070662_100583940 | Ga0070662_1005839401 | 147 |
| 537 | 3300005458 | Ga0070681_10123853 | Ga0070681_101238534 | 147 |
| 538 | 3300005459 | Ga0068867_100031241 | Ga0068867_1000312412 | 147 |
| 539 | 3300005471 | Ga0070698_100612347 | Ga0070698_1006123472 | 147 |
| 540 | 3300005530 | Ga0070679_100659573 | Ga0070679_1006595732 | 147 |
| 541 | 3300005539 | Ga0068853_100088438 | Ga0068853_1000884381 | 147 |
| 542 | 3300005539 | Ga0068853_100615527 | Ga0068853_1006155272 | 147 |
| 543 | 3300005543 | Ga0070672_100187893 | Ga0070672_1001878931 | 147 |
| 544 | 3300005544 | Ga0070686_100596444 | Ga0070686_1005964442 | 147 |
| 545 | 3300005545 | Ga0070695_100487693 | Ga0070695_1004876931 | 147 |
| 546 | 3300005548 | Ga0070665_100067150 | Ga0070665_1000671502 | 147 |
| 547 | 3300005548 | Ga0070665_100178369 | Ga0070665_1001783692 | 147 |
| 548 | 3300005548 | Ga0070665_100276754 | Ga0070665_1002767542 | 147 |
| 549 | 3300005548 | Ga0070665_101758782 | Ga0070665_1017587821 | 147 |
| 550 | 3300005549 | Ga0070704_100367501 | Ga0070704_1003675012 | 147 |
| 551 | 3300005564 | Ga0070664_101288438 | Ga0070664_1012884382 | 147 |
| 552 | 3300005577 | Ga0068857_100229566 | Ga0068857_1002295662 | 147 |
| 553 | 3300005578 | Ga0068854_100053678 | Ga0068854_1000536783 | 147 |
| 554 | 3300005614 | Ga0068856_100640009 | Ga0068856_1006400091 | 147 |
| 555 | 3300005614 | Ga0068856_100823095 | Ga0068856_1008230952 | 147 |
| 556 | 3300005615 | Ga0070702_100864815 | Ga0070702_1008648151 | 147 |
| 557 | 3300005616 | Ga0068852_100740967 | Ga0068852_1007409672 | 147 |
| 558 | 3300005718 | Ga0068866_10089935 | Ga0068866_100899352 | 147 |
| 559 | 3300005719 | Ga0068861_100046781 | Ga0068861_1000467813 | 147 |
| 560 | 3300005719 | Ga0068861_100486804 | Ga0068861_1004868041 | 147 |
| 561 | 3300005719 | Ga0068861_100810059 | Ga0068861_1008100592 | 147 |
| 562 | 3300005834 | Ga0068851_10007476 | Ga0068851_100074764 | 147 |
| 563 | 3300005840 | Ga0068870_10025221 | Ga0068870_100252211 | 147 |
| 564 | 3300005842 | Ga0068858_101064066 | Ga0068858_1010640661 | 147 |
| 565 | 3300005843 | Ga0068860_100020185 | Ga0068860_1000201855 | 147 |
| 566 | 3300005843 | Ga0068860_100182832 | Ga0068860_1001828322 | 147 |
| 567 | 3300005844 | Ga0068862_100085607 | Ga0068862_1000856073 | 147 |
| 568 | 3300005844 | Ga0068862_100151664 | Ga0068862_1001516642 | 147 |
| 569 | 3300005844 | Ga0068862_100559965 | Ga0068862_1005599652 | 147 |
| 570 | 3300005844 | Ga0068862_100567472 | Ga0068862_1005674722 | 147 |
| 571 | 3300005844 | Ga0068862_100711904 | Ga0068862_1007119041 | 147 |
| 572 | 3300005937 | Ga0081455_10145350 | Ga0081455_101453502 | 147 |
| 573 | 3300005981 | Ga0081538_10096616 | Ga0081538_100966162 | 147 |
| 574 | 3300005983 | Ga0081540_1006920 | Ga0081540_10069207 | 147 |
| 575 | 3300005983 | Ga0081540_1009239 | Ga0081540_10092394 | 147 |
| 576 | 3300005983 | Ga0081540_1017740 | Ga0081540_10177404 | 147 |
| 577 | 3300005983 | Ga0081540_1029072 | Ga0081540_10290722 | 147 |
| 578 | 3300006038 | Ga0075365_10033503 | Ga0075365_100335034 | 147 |
| 579 | 3300006038 | Ga0075365_10928355 | Ga0075365_109283551 | 147 |
| 580 | 3300006048 | Ga0075363_100714333 | Ga0075363_1007143331 | 147 |
| 581 | 3300006051 | Ga0075364_10556531 | Ga0075364_105565312 | 147 |
| 582 | 3300006175 | Ga0070712_100811953 | Ga0070712_1008119532 | 147 |
| 583 | 3300006178 | Ga0075367_10012050 | Ga0075367_100120501 | 147 |
| 584 | 3300006178 | Ga0075367_10073711 | Ga0075367_100737113 | 147 |
| 585 | 3300006237 | Ga0097621_100831619 | Ga0097621_1008316192 | 147 |
| 586 | 3300006237 | Ga0097621_101405606 | Ga0097621_1014056061 | 147 |
| 587 | 3300006353 | Ga0075370_10109857 | Ga0075370_101098571 | 147 |
| 588 | 3300006353 | Ga0075370_10373789 | Ga0075370_103737891 | 147 |
| 589 | 3300006353 | Ga0075370_10389353 | Ga0075370_103893532 | 147 |
| 590 | 3300006358 | Ga0068871_101335164 | Ga0068871_1013351641 | 147 |
| 591 | 3300006880 | Ga0075429_100656618 | Ga0075429_1006566181 | 147 |
| 592 | 3300009011 | Ga0105251_10376511 | Ga0105251_103765112 | 147 |
| 593 | 3300009092 | Ga0105250_10330281 | Ga0105250_103302811 | 147 |
| 594 | 3300009093 | Ga0105240_11749686 | Ga0105240_117496861 | 147 |
| 595 | 3300009094 | Ga0111539_10065388 | Ga0111539_100653883 | 147 |
| 596 | 3300009098 | Ga0105245_10423459 | Ga0105245_104234591 | 147 |
| 597 | 3300009098 | Ga0105245_11213268 | Ga0105245_112132681 | 147 |
| 598 | 3300009101 | Ga0105247_10002364 | Ga0105247_1000236410 | 147 |
| 599 | 3300009101 | Ga0105247_10327813 | Ga0105247_103278131 | 147 |
| 600 | 3300009101 | Ga0105247_11382191 | Ga0105247_113821911 | 147 |
| 601 | 3300009147 | Ga0114129_10190202 | Ga0114129_101902022 | 147 |
| 602 | 3300009148 | Ga0105243_10036133 | Ga0105243_100361332 | 147 |
| 603 | 3300009148 | Ga0105243_11468920 | Ga0105243_114689201 | 147 |
| 604 | 3300009174 | Ga0105241_10060020 | Ga0105241_100600202 | 147 |
| 605 | 3300009174 | Ga0105241_11342152 | Ga0105241_113421521 | 147 |
| 606 | 3300009176 | Ga0105242_10100161 | Ga0105242_101001612 | 147 |
| 607 | 3300009176 | Ga0105242_11266338 | Ga0105242_112663382 | 147 |
| 608 | 3300009177 | Ga0105248_10685392 | Ga0105248_106853921 | 147 |
| 609 | 3300009545 | Ga0105237_10006596 | Ga0105237_100065966 | 147 |
| 610 | 3300009545 | Ga0105237_10382696 | Ga0105237_103826962 | 147 |
| 611 | 3300009551 | Ga0105238_10119909 | Ga0105238_101199091 | 147 |
| 612 | 3300009553 | Ga0105249_10022801 | Ga0105249_100228014 | 147 |
| 613 | 3300010375 | Ga0105239_10466331 | Ga0105239_104663312 | 147 |
| 614 | 3300010375 | Ga0105239_12075194 | Ga0105239_120751941 | 147 |
| 615 | 3300011119 | Ga0105246_10008882 | Ga0105246_100088821 | 147 |
| 616 | 3300012507 | Ga0157342_1065633 | Ga0157342_10656331 | 147 |
| 617 | 3300013104 | Ga0157370_10119131 | Ga0157370_101191314 | 147 |
| 618 | 3300013297 | Ga0157378_10180184 | Ga0157378_101801842 | 147 |
| 619 | 3300013306 | Ga0163162_10056995 | Ga0163162_100569953 | 147 |
| 620 | 3300013306 | Ga0163162_10761920 | Ga0163162_107619201 | 147 |
| 621 | 3300013306 | Ga0163162_11050788 | Ga0163162_110507881 | 147 |
| 622 | 3300013306 | Ga0163162_11391809 | Ga0163162_113918091 | 147 |
| 623 | 3300013307 | Ga0157372_10791173 | Ga0157372_107911732 | 147 |
| 624 | 3300013308 | Ga0157375_11945064 | Ga0157375_119450641 | 147 |
| 625 | 3300013308 | Ga0157375_12772073 | Ga0157375_127720731 | 147 |
| 626 | 3300014325 | Ga0163163_10581913 | Ga0163163_105819131 | 147 |
| 627 | 3300014326 | Ga0157380_10321470 | Ga0157380_103214702 | 147 |
| 628 | 3300014326 | Ga0157380_10368038 | Ga0157380_103680382 | 147 |
| 629 | 3300014326 | Ga0157380_11009685 | Ga0157380_110096852 | 147 |
| 630 | 3300014969 | Ga0157376_11115185 | Ga0157376_111151851 | 147 |
| 631 | 3300017792 | Ga0163161_10056068 | Ga0163161_100560682 | 147 |
| 632 | 3300021384 | Ga0213876_10001108 | Ga0213876_1000110810 | 147 |
| 633 | 3300025295 | Ga0209564_1038632 | Ga0209564_10386322 | 147 |
| 634 | 3300025297 | Ga0209758_1041827 | Ga0209758_10418271 | 147 |
| 635 | 3300025315 | Ga0207697_10061062 | Ga0207697_100610621 | 147 |
| 636 | 3300025321 | Ga0207656_10013890 | Ga0207656_100138905 | 147 |
| 637 | 3300025899 | Ga0207642_10113408 | Ga0207642_101134082 | 147 |
| 638 | 3300025900 | Ga0207710_10236786 | Ga0207710_102367862 | 147 |
| 639 | 3300025903 | Ga0207680_10142121 | Ga0207680_101421211 | 147 |
| 640 | 3300025907 | Ga0207645_10223884 | Ga0207645_102238842 | 147 |
| 641 | 3300025908 | Ga0207643_10181684 | Ga0207643_101816842 | 147 |
| 642 | 3300025908 | Ga0207643_10327286 | Ga0207643_103272861 | 147 |
| 643 | 3300025911 | Ga0207654_10021180 | Ga0207654_100211802 | 147 |
| 644 | 3300025912 | Ga0207707_10141119 | Ga0207707_101411193 | 147 |
| 645 | 3300025913 | Ga0207695_10002042 | Ga0207695_1000204228 | 147 |
| 646 | 3300025914 | Ga0207671_10024690 | Ga0207671_100246904 | 147 |
| 647 | 3300025917 | Ga0207660_10005383 | Ga0207660_100053833 | 147 |
| 648 | 3300025919 | Ga0207657_10116605 | Ga0207657_101166053 | 147 |
| 649 | 3300025920 | Ga0207649_11400429 | Ga0207649_114004291 | 147 |
| 650 | 3300025921 | Ga0207652_10899432 | Ga0207652_108994322 | 147 |
| 651 | 3300025922 | Ga0207646_11290971 | Ga0207646_112909711 | 147 |
| 652 | 3300025923 | Ga0207681_10297862 | Ga0207681_102978622 | 147 |
| 653 | 3300025923 | Ga0207681_10995163 | Ga0207681_109951632 | 147 |
| 654 | 3300025924 | Ga0207694_10001415 | Ga0207694_100014153 | 147 |
| 655 | 3300025924 | Ga0207694_10298106 | Ga0207694_102981062 | 147 |
| 656 | 3300025925 | Ga0207650_10324969 | Ga0207650_103249692 | 147 |
| 657 | 3300025929 | Ga0207664_10857942 | Ga0207664_108579421 | 147 |
| 658 | 3300025931 | Ga0207644_10226888 | Ga0207644_102268882 | 147 |
| 659 | 3300025932 | Ga0207690_10012826 | Ga0207690_100128262 | 147 |
| 660 | 3300025933 | Ga0207706_10060816 | Ga0207706_100608164 | 147 |
| 661 | 3300025937 | Ga0207669_11020395 | Ga0207669_110203952 | 147 |
| 662 | 3300025940 | Ga0207691_10047902 | Ga0207691_100479021 | 147 |
| 663 | 3300025940 | Ga0207691_11429772 | Ga0207691_114297721 | 147 |
| 664 | 3300025941 | Ga0207711_10758256 | Ga0207711_107582561 | 147 |
| 665 | 3300025942 | Ga0207689_10209278 | Ga0207689_102092781 | 147 |
| 666 | 3300025942 | Ga0207689_10211999 | Ga0207689_102119992 | 147 |
| 667 | 3300025945 | Ga0207679_11185763 | Ga0207679_111857631 | 147 |
| 668 | 3300025949 | Ga0207667_10011130 | Ga0207667_100111301 | 147 |
| 669 | 3300025960 | Ga0207651_10944470 | Ga0207651_109444702 | 147 |
| 670 | 3300025960 | Ga0207651_11064643 | Ga0207651_110646431 | 147 |
| 671 | 3300025961 | Ga0207712_10106344 | Ga0207712_101063442 | 147 |
| 672 | 3300025972 | Ga0207668_10099508 | Ga0207668_100995082 | 147 |
| 673 | 3300025972 | Ga0207668_10170030 | Ga0207668_101700302 | 147 |
| 674 | 3300025972 | Ga0207668_10182308 | Ga0207668_101823081 | 147 |
| 675 | 3300026023 | Ga0207677_10302867 | Ga0207677_103028672 | 147 |
| 676 | 3300026023 | Ga0207677_10715139 | Ga0207677_107151392 | 147 |
| 677 | 3300026023 | Ga0207677_11289134 | Ga0207677_112891341 | 147 |
| 678 | 3300026035 | Ga0207703_10095078 | Ga0207703_100950782 | 147 |
| 679 | 3300026041 | Ga0207639_10252278 | Ga0207639_102522782 | 147 |
| 680 | 3300026067 | Ga0207678_10011116 | Ga0207678_100111163 | 147 |
| 681 | 3300026067 | Ga0207678_10256820 | Ga0207678_102568202 | 147 |
| 682 | 3300026067 | Ga0207678_10405442 | Ga0207678_104054422 | 147 |
| 683 | 3300026067 | Ga0207678_10787199 | Ga0207678_107871991 | 147 |
| 684 | 3300026075 | Ga0207708_10057294 | Ga0207708_100572942 | 147 |
| 685 | 3300026075 | Ga0207708_10498592 | Ga0207708_104985922 | 147 |
| 686 | 3300026078 | Ga0207702_10000003 | Ga0207702_1000000314 | 147 |
| 687 | 3300026089 | Ga0207648_10014415 | Ga0207648_100144154 | 147 |
| 688 | 3300026116 | Ga0207674_10740130 | Ga0207674_107401301 | 147 |
| 689 | 3300026118 | Ga0207675_100041106 | Ga0207675_1000411062 | 147 |
| 690 | 3300026118 | Ga0207675_100276616 | Ga0207675_1002766162 | 147 |
| 691 | 3300026118 | Ga0207675_100546237 | Ga0207675_1005462372 | 147 |
| 692 | 3300026121 | Ga0207683_10041381 | Ga0207683_100413813 | 147 |
| 693 | 3300026121 | Ga0207683_10560401 | Ga0207683_105604012 | 147 |
| 694 | 3300026121 | Ga0207683_11770198 | Ga0207683_117701981 | 147 |
| 695 | 3300027866 | Ga0209813_10219759 | Ga0209813_102197591 | 147 |
| 696 | 3300027907 | Ga0207428_10083833 | Ga0207428_100838332 | 147 |
| 697 | 3300028379 | Ga0268266_10006533 | Ga0268266_100065332 | 147 |
| 698 | 3300028379 | Ga0268266_10098652 | Ga0268266_100986522 | 147 |
| 699 | 3300028379 | Ga0268266_10237638 | Ga0268266_102376382 | 147 |
| 700 | 3300028379 | Ga0268266_10551735 | Ga0268266_105517352 | 147 |
| 701 | 3300028380 | Ga0268265_10118620 | Ga0268265_101186202 | 147 |
| 702 | 3300028380 | Ga0268265_10216649 | Ga0268265_102166492 | 147 |
| 703 | 3300028380 | Ga0268265_11003586 | Ga0268265_110035861 | 147 |
| 704 | 3300028381 | Ga0268264_10167444 | Ga0268264_101674442 | 147 |
| 705 | 3300028381 | Ga0268264_10506443 | Ga0268264_105064432 | 147 |
| 706 | 3300028794 | Ga0307515_10786597 | Ga0307515_107865971 | 147 |
| 707 | 3300031235 | Ga0265330_10002550 | Ga0265330_100025505 | 147 |
| 708 | 3300031235 | Ga0265330_10015820 | Ga0265330_100158204 | 147 |
| 709 | 3300031456 | Ga0307513_10234817 | Ga0307513_102348172 | 147 |
| 710 | 3300031456 | Ga0307513_10342522 | Ga0307513_103425222 | 147 |
| 711 | 3300031507 | Ga0307509_10040531 | Ga0307509_100405313 | 147 |
| 712 | 3300031507 | Ga0307509_10319157 | Ga0307509_103191572 | 147 |
| 713 | 3300031548 | Ga0307408_100279318 | Ga0307408_1002793182 | 147 |
| 714 | 3300031616 | Ga0307508_10165454 | Ga0307508_101654541 | 147 |
| 715 | 3300031730 | Ga0307516_10078356 | Ga0307516_100783563 | 147 |
| 716 | 3300031731 | Ga0307405_10488682 | Ga0307405_104886822 | 147 |
| 717 | 3300031824 | Ga0307413_10197700 | Ga0307413_101977002 | 147 |
| 718 | 3300031852 | Ga0307410_10217170 | Ga0307410_102171702 | 147 |
| 719 | 3300031852 | Ga0307410_10838822 | Ga0307410_108388222 | 147 |
| 720 | 3300031901 | Ga0307406_10226633 | Ga0307406_102266332 | 147 |
| 721 | 3300031901 | Ga0307406_10854271 | Ga0307406_108542711 | 147 |
| 722 | 3300031911 | Ga0307412_10079025 | Ga0307412_100790252 | 147 |
| 723 | 3300031911 | Ga0307412_10178719 | Ga0307412_101787192 | 147 |
| 724 | 3300031995 | Ga0307409_100523584 | Ga0307409_1005235842 | 147 |
| 725 | 3300031995 | Ga0307409_101638543 | Ga0307409_1016385431 | 147 |
| 726 | 3300032002 | Ga0307416_100525496 | Ga0307416_1005254962 | 147 |
| 727 | 3300032002 | Ga0307416_100602952 | Ga0307416_1006029522 | 147 |
| 728 | 3300032004 | Ga0307414_10088792 | Ga0307414_100887922 | 147 |
| 729 | 3300032005 | Ga0307411_11767693 | Ga0307411_117676931 | 147 |
| 730 | 3300032005 | Ga0307411_11877617 | Ga0307411_118776171 | 147 |
| 731 | 3300033180 | Ga0307510_10018329 | Ga0307510_1001832911 | 147 |
| 732 | 3300033180 | Ga0307510_10098798 | Ga0307510_100987982 | 147 |
| 733 | 3300035207 | Ga0373942_0035731 | Ga0373942_0035731_95_568 | 147 |
| 734 | 3300039437 | Ga0436365_0122301 | Ga0436365_0122301_7229_7672 | 147 |
| 735 | 3300039450 | Ga0436363_1129876 | Ga0436363_1129876_376_819 | 147 |
| 736 | 3300041452 | Ga0451793_1818322 | Ga0451793_1818322_551_1042 | 147 |
| 737 | 3300041486 | Ga0451807_1865263 | Ga0451807_1865263_68_511 | 147 |
| 738 | 3300041512 | Ga0451853_1431665 | Ga0451853_1431665_327_770 | 147 |
| 739 | 3300041997 | Ga0439431_0047286 | Ga0439431_0047286_235_756 | 147 |
| 740 | 3300046452 | Ga0495617_051855 | Ga0495617_051855_373_894 | 147 |
| 741 | 3300046452 | Ga0495617_270213 | Ga0495617_270213_18_461 | 147 |
| 742 | 3300046455 | Ga0495603_0022671 | Ga0495603_0022671_2637_3080 | 147 |
| 743 | 3300046455 | Ga0495603_0061397 | Ga0495603_0061397_1038_1559 | 147 |
| 744 | 3300046455 | Ga0495603_0551565 | Ga0495603_0551565_157_648 | 147 |
| 745 | 3300046459 | Ga0495629_0055561 | Ga0495629_0055561_2010_2453 | 147 |
| 746 | 3300046460 | Ga0495638_0137016 | Ga0495638_0137016_159_662 | 147 |
| 747 | 3300046462 | Ga0495651_0086807 | Ga0495651_0086807_1690_2133 | 147 |
| 748 | 3300046474 | Ga0495605_0178681 | Ga0495605_0178681_64_507 | 147 |
| 749 | 3300046475 | Ga0495639_0087029 | Ga0495639_0087029_384_905 | 147 |
| 750 | 3300046491 | Ga0495584_0070687 | Ga0495584_0070687_119_640 | 147 |
| 751 | 3300046491 | Ga0495584_0315369 | Ga0495584_0315369_286_729 | 147 |
| 752 | 3300046492 | Ga0495585_0036277 | Ga0495585_0036277_32_493 | 147 |
| 753 | 3300046499 | Ga0495594_0028295 | Ga0495594_0028295_2257_2700 | 147 |
| 754 | 3300046499 | Ga0495594_0436328 | Ga0495594_0436328_280_723 | 147 |
| 755 | 3300046506 | Ga0495583_0143150 | Ga0495583_0143150_398_919 | 147 |
| 756 | 3300046507 | Ga0495606_0284679 | Ga0495606_0284679_122_565 | 147 |
| 757 | 3300046507 | Ga0495606_0289786 | Ga0495606_0289786_30_533 | 147 |
| 758 | 3300046512 | Ga0495610_0307151 | Ga0495610_0307151_59_580 | 147 |
| 759 | 3300046513 | Ga0495616_0471223 | Ga0495616_0471223_19_462 | 147 |
| 760 | 3300046515 | Ga0495620_0079650 | Ga0495620_0079650_578_1021 | 147 |
| 761 | 3300046518 | Ga0495631_0354160 | Ga0495631_0354160_151_594 | 147 |
| 762 | 3300046520 | Ga0495637_0265153 | Ga0495637_0265153_34_495 | 147 |
| 763 | 3300046523 | Ga0495644_0233770 | Ga0495644_0233770_42_563 | 147 |
| 764 | 3300046524 | Ga0495648_0044716 | Ga0495648_0044716_181_654 | 147 |
| 765 | 3300046531 | Ga0495665_0200725 | Ga0495665_0200725_377_898 | 147 |
| 766 | 3300046538 | Ga0495609_0441646 | Ga0495609_0441646_31_492 | 147 |
| 767 | 3300046539 | Ga0495621_0079926 | Ga0495621_0079926_51_494 | 147 |
| 768 | 3300046542 | Ga0495597_0145070 | Ga0495597_0145070_419_862 | 147 |
| 769 | 3300046557 | Ga0495622_0293396 | Ga0495622_0293396_84_605 | 147 |
| 770 | 3300046558 | Ga0495633_0139985 | Ga0495633_0139985_144_587 | 147 |
| 771 | 3300046615 | Ga0495656_0012433 | Ga0495656_0012433_2274_2717 | 147 |
| 772 | 3300046615 | Ga0495656_0080275 | Ga0495656_0080275_100_543 | 147 |
| 773 | 3300046615 | Ga0495656_0094907 | Ga0495656_0094907_162_605 | 147 |
| 774 | 3300046615 | Ga0495656_0116191 | Ga0495656_0116191_151_594 | 147 |
| 775 | 3300046616 | Ga0495668_0201223 | Ga0495668_0201223_482_1003 | 147 |
| 776 | 3300046616 | Ga0495668_0278872 | Ga0495668_0278872_87_530 | 147 |
| 777 | 3300046648 | Ga0495611_0439127 | Ga0495611_0439127_68_511 | 147 |
| 778 | 3300046648 | Ga0495611_0492072 | Ga0495611_0492072_39_482 | 147 |
| 779 | 3300046660 | Ga0495625_0525645 | Ga0495625_0525645_31_534 | 147 |
| 780 | 3300046663 | Ga0495635_0135785 | Ga0495635_0135785_154_597 | 147 |
| 781 | 3300046663 | Ga0495635_0284145 | Ga0495635_0284145_448_891 | 147 |
| 782 | 3300046664 | Ga0495659_0004777 | Ga0495659_0004777_1894_2337 | 147 |
| 783 | 3300046664 | Ga0495659_0061185 | Ga0495659_0061185_285_728 | 147 |
| 784 | 3300046684 | Ga0495669_0027733 | Ga0495669_0027733_1424_1867 | 147 |
| 785 | 3300046684 | Ga0495669_0051935 | Ga0495669_0051935_782_1225 | 147 |
| 786 | 3300046794 | Ga0495589_0144672 | Ga0495589_0144672_359_802 | 147 |
| 787 | 3300046809 | Ga0495600_0156354 | Ga0495600_0156354_730_1173 | 147 |
| 788 | 3300047315 | Ga0495581_0112266 | Ga0495581_0112266_530_973 | 147 |
| 789 | 3300047315 | Ga0495581_0298185 | Ga0495581_0298185_25_546 | 147 |
| 790 | 3300047315 | Ga0495581_0762835 | Ga0495581_0762835_37_480 | 147 |
| 791 | 3300047320 | Ga0495672_0338751 | Ga0495672_0338751_52_495 | 147 |
| 792 | 3300047321 | Ga0495676_0980734 | Ga0495676_0980734_66_509 | 147 |
| 793 | 3300047445 | Ga0495677_0062877 | Ga0495677_0062877_721_1164 | 147 |
| 794 | 3300047469 | Ga0495673_0131519 | Ga0495673_0131519_408_911 | 147 |
| 795 | 3300047470 | Ga0495681_0040040 | Ga0495681_0040040_1781_2242 | 147 |
| 796 | 3300047673 | Ga0495593_0069686 | Ga0495593_0069686_387_830 | 147 |
| 797 | 3300048088 | Ga0495602_0364194 | Ga0495602_0364194_391_834 | 147 |
| 798 | 3300048903 | Ga0496100_0874408 | Ga0496100_0874408_67_510 | 147 |
| 799 | 3300048903 | Ga0496100_1140196 | Ga0496100_1140196_82_585 | 147 |
| 800 | 3300048905 | Ga0496102_0201366 | Ga0496102_0201366_1255_1776 | 147 |
| 801 | 3300048905 | Ga0496102_0530193 | Ga0496102_0530193_453_896 | 147 |
| 802 | 3300048906 | Ga0496103_0368634 | Ga0496103_0368634_321_764 | 147 |
| 803 | 3300048906 | Ga0496103_0916114 | Ga0496103_0916114_16_459 | 147 |
| 804 | 3300048909 | Ga0496106_0001280 | Ga0496106_0001280_10841_11284 | 147 |
| 805 | 3300048912 | Ga0496109_0531987 | Ga0496109_0531987_341_784 | 147 |
| 806 | 3300048913 | Ga0496110_0327980 | Ga0496110_0327980_53_496 | 147 |
| 807 | 3300048914 | Ga0496111_0987228 | Ga0496111_0987228_118_561 | 147 |
| 808 | 3300048918 | Ga0496115_1248126 | Ga0496115_1248126_33_506 | 147 |
| 809 | 3300048919 | Ga0496116_0020084 | Ga0496116_0020084_3738_4181 | 147 |
| 810 | 3300048920 | Ga0496117_0008319 | Ga0496117_0008319_1962_2405 | 147 |
| 811 | 3300048921 | Ga0496118_0001458 | Ga0496118_0001458_26870_27313 | 147 |
| 812 | 3300048922 | Ga0496119_0465018 | Ga0496119_0465018_39_560 | 147 |
| 813 | 3300048923 | Ga0496120_0377552 | Ga0496120_0377552_166_609 | 147 |
| 814 | 3300048924 | Ga0496121_0000146 | Ga0496121_0000146_70732_71175 | 147 |
| 815 | 3300048924 | Ga0496121_0000254 | Ga0496121_0000254_13806_14249 | 147 |
| 816 | 3300048924 | Ga0496121_0078360 | Ga0496121_0078360_2127_2588 | 147 |
| 817 | 3300048927 | Ga0496124_0009204 | Ga0496124_0009204_2743_3186 | 147 |
| 818 | 3300048927 | Ga0496124_0138488 | Ga0496124_0138488_1221_1712 | 147 |
| 819 | 3300048928 | Ga0496125_0017943 | Ga0496125_0017943_4753_5196 | 147 |
| 820 | 3300048928 | Ga0496125_0291557 | Ga0496125_0291557_292_735 | 147 |
| 821 | 3300048929 | Ga0496126_0015212 | Ga0496126_0015212_4891_5334 | 147 |
| 822 | 3300048929 | Ga0496126_0043920 | Ga0496126_0043920_144_587 | 147 |
| 823 | 3300048929 | Ga0496126_0102678 | Ga0496126_0102678_67_558 | 147 |
| 824 | 3300048929 | Ga0496126_0375826 | Ga0496126_0375826_236_679 | 147 |
| 825 | 3300049460 | Ga0495682_0053776 | Ga0495682_0053776_121_642 | 147 |
| 826 | 3300049572 | Ga0501036_1626208 | Ga0501036_1626208_49_492 | 147 |
| 827 | 3300049576 | Ga0501040_0197847 | Ga0501040_0197847_736_1179 | 147 |
| 828 | 3300049577 | Ga0501041_0174158 | Ga0501041_0174158_644_1087 | 147 |
| 829 | 3300049579 | Ga0501043_1265979 | Ga0501043_1265979_20_463 | 147 |
| 830 | 3300049582 | Ga0501048_1089564 | Ga0501048_1089564_66_509 | 147 |
| 831 | 3300049587 | Ga0501071_0173294 | Ga0501071_0173294_450_893 | 147 |
| 832 | 3300050492 | nmdc:mga0yw44_23931_c1 | nmdc:mga0yw44_23931_c1_2966_3409 | 147 |
| 833 | 3300050494 | nmdc:mga06z11_54839_c1 | nmdc:mga06z11_54839_c1_452_895 | 147 |
| 834 | 3300050495 | nmdc:mga04h51_239633_c1 | nmdc:mga04h51_239633_c1_170_613 | 147 |
| 835 | 3300050496 | nmdc:mga07m45_15864_c1 | nmdc:mga07m45_15864_c1_1089_1580 | 147 |
| 836 | 3300050496 | nmdc:mga07m45_221268_c1 | nmdc:mga07m45_221268_c1_235_678 | 147 |
| 837 | 3300050507 | nmdc:mga05p37_14625_c1 | nmdc:mga05p37_14625_c1_5528_5971 | 147 |
| 838 | 3300050508 | nmdc:mga09592_526452_c1 | nmdc:mga09592_526452_c1_507_950 | 147 |
| 839 | 3300050511 | nmdc:mga08y16_217968_c1 | nmdc:mga08y16_217968_c1_211_654 | 147 |
| 840 | 3300050516 | nmdc:mga0sz30_278514_c1 | nmdc:mga0sz30_278514_c1_45_488 | 147 |
| 841 | 3300050516 | nmdc:mga0sz30_295729_c1 | nmdc:mga0sz30_295729_c1_10_471 | 147 |
| 842 | 3300050516 | nmdc:mga0sz30_6950_c1 | nmdc:mga0sz30_6950_c1_36_479 | 147 |
| 843 | 3300053080 | Ga0500635_0013637 | Ga0500635_0013637_185_628 | 147 |
| 844 | 3300053086 | Ga0500578_0267537 | Ga0500578_0267537_270_773 | 147 |
| 845 | 3300053087 | Ga0500643_106288 | Ga0500643_106288_119_562 | 147 |
| 846 | 3300053090 | Ga0500646_0125244 | Ga0500646_0125244_14_457 | 147 |
| 847 | 3300053108 | Ga0500562_061930 | Ga0500562_061930_21_524 | 147 |
| 848 | 3300053119 | Ga0500595_002430 | Ga0500595_002430_7882_8325 | 147 |
| 849 | 3300053119 | Ga0500595_011118 | Ga0500595_011118_1734_2225 | 147 |
| 850 | 3300053121 | Ga0500607_110341 | Ga0500607_110341_63_506 | 147 |
| 851 | 3300053139 | Ga0500568_0028239 | Ga0500568_0028239_1026_1469 | 147 |
| 852 | 3300053142 | Ga0500577_0000809 | Ga0500577_0000809_4780_5241 | 147 |
| 853 | 3300053145 | Ga0500586_004877 | Ga0500586_004877_1430_1873 | 147 |
| 854 | 3300053146 | Ga0500588_0243282 | Ga0500588_0243282_59_580 | 147 |
| 855 | 3300053150 | Ga0500603_000706 | Ga0500603_000706_3859_4302 | 147 |
| 856 | 3300053158 | Ga0500627_0222401 | Ga0500627_0222401_46_567 | 147 |
| 857 | 3300053161 | Ga0500634_0116538 | Ga0500634_0116538_80_541 | 147 |
| 858 | 3300053161 | Ga0500634_0260753 | Ga0500634_0260753_203_646 | 147 |
| 859 | 3300053177 | Ga0500636_0077223 | Ga0500636_0077223_602_1045 | 147 |
| 860 | 3300053177 | Ga0500636_0109550 | Ga0500636_0109550_1061_1504 | 147 |
| 861 | 3300053178 | Ga0500637_0001513 | Ga0500637_0001513_6923_7366 | 147 |
| 862 | 3300060353 | Ga0501082_1310081 | Ga0501082_1310081_128_571 | 147 |
| 863 | 3300061734 | Ga0530510_0589998 | Ga0530510_0589998_384_827 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4inn-assembly1.cif.gz_A | protein hp1028 from the human pathogen helicobacter pylori belongs to the lipocalin family | 0.8302 | 27 | 145 |
| 6g2i-assembly1.cif.gz_B | filament of acetyl-coa carboxylase and brct domains of brca1 (acc-brct) at 5.9 a resolution | 0.7168 | 99 | 130 |
| 2qmi-assembly1.cif.gz_E | structure of the octameric penicillin-binding protein homologue from pyrococcus abyssi | 0.5983 | 28 | 142 |
| 8f0y-assembly1.cif.gz_A | lipocalin-like milk protein-1 | 0.588 | 29 | 144 |
| 6czg-assembly2.cif.gz_B | structure of a redesigned beta barrel, b11l5f_lgl | 0.5828 | 29 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4innA00 | Mainly Beta;Beta Barrel;Lipocalin; | 0.8237 | 27 | 145 | 2.40.128.520 |
| af_Q4E0Z5_1_101_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.746 | 90 | 121 | 3.30.200.20 |
| 4innA00 | Mainly Beta;Beta Barrel;Lipocalin; | 0.6842 | 27 | 145 | 2.40.128.520 |
| af_Q8IHP1_1152_1236_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.6617 | 90 | 123 | 3.30.200.20 |
| 2qmiA02 | Mainly Beta;Beta Barrel;Lipocalin;Pab87 octamerisation domain | 0.6363 | 28 | 142 | 2.40.128.210 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q7U1A6-F1-model_v4 | DUF2147 domain-containing protein | 0.967 | 23 | 145 |
|
| AF-A0A1P9X4K1-F1-model_v4 | SIGNAL peptide protein | 0.9595 | 29 | 145 |
|
| AF-A0A6L8W6K7-F1-model_v4 | DUF2147 domain-containing protein | 0.9587 | 26 | 145 |
|
| AF-A0A346A196-F1-model_v4 | DUF2147 domain-containing protein | 0.9564 | 33 | 146 |
|
| AF-D2QBY8-F1-model_v4 | DUF2147 domain-containing protein | 0.9454 | 29 | 144 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar