F483935

General Info

Members Datasets Scaffolds Average Seq Length
863 506 748 146

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056681323|8056685492
Length 143
Sequence SALIAAMLAVLLGAPMACAQSAAADPSGVWQTQAGDARVKISKCGGGICGVIVSLREPIDPATSRPQFDNKNPNPALTTRPIIGLPLFSGMRPAGGKWTGQIYNADDGGTYASNISLAGPDTLRVEGCVGALCGGETWTRVRR

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
7 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
8 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
11 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
12 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
13 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
14 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
15 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
16 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
17 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
18 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
19 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
20 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
26 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
27 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
28 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
29 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
30 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
31 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
32 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
33 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
34 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
35 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
36 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
37 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
38 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
39 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
40 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
41 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
42 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
43 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
44 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
45 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
46 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
47 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
48 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
49 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
50 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
51 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
52 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
53 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
54 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
55 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
56 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
57 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
58 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
59 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
60 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
61 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
62 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
63 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
64 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
65 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
66 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
67 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
68 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
69 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
70 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
71 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
72 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
73 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
74 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
75 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
76 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
77 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
78 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
79 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
80 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
81 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
82 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
83 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
84 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
85 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
86 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
87 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
88 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
89 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
90 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
91 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
92 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
93 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
94 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
95 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
96 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
97 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
98 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
99 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
100 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
101 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
102 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
103 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
104 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
105 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
107 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
108 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
109 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
110 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
111 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
112 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
113 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
114 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
115 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
116 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
117 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
118 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
119 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
120 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
121 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
122 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
123 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
124 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
125 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
126 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
127 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
128 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
129 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
130 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
131 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
132 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
133 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
134 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
135 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
136 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
137 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
138 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
139 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
140 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
141 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
142 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
143 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
144 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
145 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
146 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
147 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
148 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
149 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
150 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
151 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
152 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
153 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
154 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
155 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
156 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
157 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
158 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
159 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
160 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
161 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
162 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
163 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
164 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
165 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
166 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
167 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
168 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
169 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
170 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
171 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
172 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
173 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
174 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
175 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
176 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
177 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
178 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
179 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
180 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
181 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
182 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
183 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
184 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
185 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
186 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
187 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
188 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
189 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
190 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
192 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
193 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
194 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
195 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
196 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
197 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
198 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
199 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
200 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
201 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
202 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
203 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
204 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
205 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
206 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
207 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
208 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
209 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
210 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
211 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
212 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
213 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
214 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
215 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
216 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
218 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
221 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
279 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
284 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
285 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
286 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
287 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
288 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
289 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
290 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
291 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
292 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
293 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
294 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
295 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
296 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
297 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
298 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
299 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
300 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
301 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
302 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
303 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
304 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
305 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
306 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
307 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
308 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
309 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
310 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
311 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
312 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
313 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
314 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
315 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
316 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
319 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
320 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
321 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
322 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
323 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
324 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
327 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
328 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
329 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
330 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
331 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
332 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
333 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
334 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
335 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
336 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
337 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
338 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
339 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
340 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
341 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
342 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
343 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
344 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
345 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
346 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
347 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
348 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
349 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
350 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
351 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
352 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
353 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
354 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
355 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
356 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
357 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
358 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
359 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
360 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
361 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
362 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
363 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
364 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
367 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
368 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
369 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
370 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
371 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
372 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
373 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
374 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
375 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
376 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
392 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
393 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
394 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
395 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
398 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
399 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
400 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
401 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
402 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
417 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
418 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
419 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
420 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
421 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
422 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
423 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
424 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
425 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
426 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
427 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
430 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
431 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
432 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
433 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
434 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
435 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
436 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
437 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
438 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
439 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
440 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
441 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
442 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
443 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
444 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
445 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
446 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
447 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
448 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
449 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
450 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
451 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
452 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
453 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
454 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
455 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
456 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
457 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
458 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
459 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
460 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
461 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
462 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
463 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
464 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
467 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
468 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
469 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
470 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
471 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
472 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
473 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
474 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
475 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
476 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
477 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
478 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
479 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
480 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
481 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
482 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
483 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
484 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
485 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
486 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
487 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
488 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
489 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
490 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
491 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
492 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
493 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
494 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
495 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
496 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
497 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
498 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
499 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
500 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
501 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
502 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
503 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
504 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
505 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
506 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.67
Metatranscriptomes 0
Isolates 13.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.99
Nodule 8.81
Rhizoplane 3.48
Rhizosphere 60.14
Stem 0
Stem Tuber 0
Unclassified 11.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1051047 3300002070 Bacteria 646
2 JGI25404J52841_10019690 3300003659 Bacteria 1462
3 Ga0070676_10541668 3300005328 Bacteria 832
4 Ga0070676_10598651 3300005328 Bacteria 795
5 Ga0070676_10763867 3300005328 Bacteria 710
6 Ga0070670_100221633 3300005331 Bacteria 1646
7 Ga0070670_100684830 3300005331 Bacteria 921
8 Ga0068869_100191727 3300005334 Bacteria 1607
9 Ga0068869_100518389 3300005334 Bacteria 997
10 Ga0070666_11132787 3300005335 Bacteria 582
11 Ga0068868_100061118 3300005338 Bacteria 2984
12 Ga0068868_100141546 3300005338 Bacteria 1975
13 Ga0068868_100797478 3300005338 Bacteria 852
14 Ga0068868_100887071 3300005338 Bacteria 810
15 Ga0070660_100232836 3300005339 Bacteria 1499
16 Ga0070660_100454544 3300005339 Bacteria 1063
17 Ga0070689_100116708 3300005340 Bacteria 2128
18 Ga0070689_101189751 3300005340 Bacteria 684
19 Ga0070661_101323105 3300005344 Bacteria 605
20 Ga0070668_100033559 3300005347 Bacteria 3909
21 Ga0070668_100045692 3300005347 Bacteria 3360
22 Ga0070668_100071734 3300005347 Bacteria 2698
23 Ga0070668_100114651 3300005347 Bacteria 2147
24 Ga0070668_100417909 3300005347 Bacteria 1148
25 Ga0070668_100607425 3300005347 Bacteria 957
26 Ga0070669_100165185 3300005353 Bacteria 1722
27 Ga0070675_100661982 3300005354 Bacteria 949
28 Ga0070671_100976432 3300005355 Bacteria 741
29 Ga0070674_100050603 3300005356 Bacteria 2860
30 Ga0070673_100610327 3300005364 Bacteria 996
31 Ga0070673_101426930 3300005364 Bacteria 652
32 Ga0070688_100442997 3300005365 Bacteria 970
33 Ga0070688_100727558 3300005365 Bacteria 771
34 Ga0070688_100847227 3300005365 Bacteria 718
35 Ga0070659_100098791 3300005366 Bacteria 2347
36 Ga0070659_101155302 3300005366 Bacteria 684
37 Ga0070667_101086539 3300005367 Bacteria 748
38 Ga0070714_100019687 3300005435 Bacteria 5502
39 Ga0070714_101499796 3300005435 Bacteria 659
40 Ga0070713_100042782 3300005436 Bacteria 3699
41 Ga0070713_100145429 3300005436 Bacteria 2104
42 Ga0070710_10004296 3300005437 Bacteria 6755
43 Ga0070701_10483351 3300005438 Bacteria 801
44 Ga0070711_100069627 3300005439 Bacteria 2475
45 Ga0070700_100022185 3300005441 Bacteria 3699
46 Ga0070700_100699770 3300005441 Bacteria 806
47 Ga0070694_100790158 3300005444 Bacteria 777
48 Ga0070708_101778090 3300005445 Bacteria 572
49 Ga0070663_100052019 3300005455 Bacteria 2920
50 Ga0070663_100063341 3300005455 Bacteria 2669
51 Ga0070663_100083973 3300005455 Bacteria 2346
52 Ga0070663_100088376 3300005455 Bacteria 2291
53 Ga0070663_100103811 3300005455 Bacteria 2125
54 Ga0070663_100213913 3300005455 Bacteria 1511
55 Ga0070678_100029628 3300005456 Bacteria 3750
56 Ga0070678_100361057 3300005456 Bacteria 1252
57 Ga0070678_101322955 3300005456 Bacteria 671
58 Ga0070662_100569355 3300005457 Bacteria 951
59 Ga0070662_100583940 3300005457 Bacteria 939
60 Ga0070681_10123853 3300005458 Bacteria 2518
61 Ga0068867_100031241 3300005459 Bacteria 3843
62 Ga0070706_101037429 3300005467 Bacteria 756
63 Ga0070698_100612347 3300005471 Bacteria 1030
64 Ga0070679_100659573 3300005530 Bacteria 989
65 Ga0070684_100453306 3300005535 Bacteria 1186
66 Ga0068853_100088438 3300005539 Bacteria 2719
67 Ga0068853_100615527 3300005539 Bacteria 1032
68 Ga0070672_100187893 3300005543 Bacteria 1724
69 Ga0070672_102062954 3300005543 Bacteria 514
70 Ga0070686_100596444 3300005544 Bacteria 870
71 Ga0070695_100487693 3300005545 Bacteria 951
72 Ga0070693_100425058 3300005547 Bacteria 927
73 Ga0070665_100005416 3300005548 Bacteria 13166
74 Ga0070665_100062245 3300005548 Bacteria 3742
75 Ga0070665_100067150 3300005548 Bacteria 3596
76 Ga0070665_100178369 3300005548 Bacteria 2125
77 Ga0070665_100276754 3300005548 Bacteria 1680
78 Ga0070665_101020155 3300005548 Bacteria 839
79 Ga0070665_101508262 3300005548 Bacteria 681
80 Ga0070665_101758782 3300005548 Bacteria 627
81 Ga0070704_100367501 3300005549 Bacteria 1219
82 Ga0068855_100087580 3300005563 Bacteria 3598
83 Ga0068855_101239547 3300005563 Bacteria 774
84 Ga0070664_100099136 3300005564 Bacteria 2532
85 Ga0070664_100465619 3300005564 Bacteria 1162
86 Ga0070664_101288438 3300005564 Bacteria 690
87 Ga0068857_100053817 3300005577 Bacteria 3570
88 Ga0068857_100229566 3300005577 Bacteria 1697
89 Ga0068854_100034950 3300005578 Bacteria 3515
90 Ga0068854_100053678 3300005578 Bacteria 2895
91 Ga0068856_100024284 3300005614 Bacteria 5899
92 Ga0068856_100640009 3300005614 Bacteria 1084
93 Ga0068856_100823095 3300005614 Bacteria 948
94 Ga0070702_100864815 3300005615 Bacteria 705
95 Ga0068852_100104864 3300005616 Bacteria 2560
96 Ga0068852_100740967 3300005616 Bacteria 994
97 Ga0068859_100455890 3300005617 Bacteria 1375
98 Ga0068859_100723974 3300005617 Bacteria 1085
99 Ga0068864_100043821 3300005618 Bacteria 3832
100 Ga0068866_10089935 3300005718 Bacteria 1669
101 Ga0068866_10679370 3300005718 Bacteria 704
102 Ga0068861_100046781 3300005719 Bacteria 3263
103 Ga0068861_100175720 3300005719 Bacteria 1778
104 Ga0068861_100486804 3300005719 Bacteria 1112
105 Ga0068861_100810059 3300005719 Bacteria 880
106 Ga0068851_10007476 3300005834 Bacteria 5017
107 Ga0068870_10025221 3300005840 Bacteria 2949
108 Ga0068863_100234805 3300005841 Bacteria 1769
109 Ga0068858_100319919 3300005842 Bacteria 1483
110 Ga0068858_100631037 3300005842 Bacteria 1040
111 Ga0068858_101064066 3300005842 Bacteria 794
112 Ga0068860_100020185 3300005843 Bacteria 6457
113 Ga0068860_100176736 3300005843 Bacteria 2063
114 Ga0068860_100182832 3300005843 Bacteria 2026
115 Ga0068862_100085607 3300005844 Bacteria 2739
116 Ga0068862_100151664 3300005844 Bacteria 2063
117 Ga0068862_100286072 3300005844 Bacteria 1512
118 Ga0068862_100559965 3300005844 Bacteria 1092
119 Ga0068862_100567472 3300005844 Bacteria 1086
120 Ga0068862_100711904 3300005844 Bacteria 973
121 Ga0081455_10145350 3300005937 Bacteria 1835
122 Ga0081538_10096616 3300005981 Bacteria 1504
123 Ga0081540_1006920 3300005983 Bacteria 8174
124 Ga0081540_1009239 3300005983 Bacteria 6799
125 Ga0081540_1017740 3300005983 Bacteria 4396
126 Ga0081540_1029072 3300005983 Bacteria 3088
127 Ga0070717_10143799 3300006028 Bacteria 2059
128 Ga0075365_10033503 3300006038 Bacteria 3311
129 Ga0075365_10282263 3300006038 Bacteria 1168
130 Ga0075365_10928355 3300006038 Bacteria 613
131 Ga0075368_10057590 3300006042 Bacteria 1551
132 Ga0075368_10128665 3300006042 Bacteria 1051
133 Ga0075363_100002282 3300006048 Bacteria 7776
134 Ga0075363_100106464 3300006048 Bacteria 1556
135 Ga0075363_100714333 3300006048 Bacteria 606
136 Ga0075364_10550331 3300006051 Bacteria 789
137 Ga0075364_10556531 3300006051 Bacteria 784
138 Ga0075364_10591138 3300006051 Bacteria 758
139 Ga0070715_10000876 3300006163 Bacteria 8328
140 Ga0070716_100002220 3300006173 Bacteria 8943
141 Ga0070712_100095599 3300006175 Bacteria 2186
142 Ga0070712_100811953 3300006175 Bacteria 803
143 Ga0075362_10206452 3300006177 Bacteria 957
144 Ga0075367_10012050 3300006178 Bacteria 4595
145 Ga0075367_10073711 3300006178 Bacteria 2057
146 Ga0075367_10152725 3300006178 Bacteria 1433
147 Ga0075367_10206156 3300006178 Bacteria 1229
148 Ga0075367_10249824 3300006178 Bacteria 1112
149 Ga0075369_10032107 3300006186 Bacteria 2220
150 Ga0075369_10084795 3300006186 Bacteria 1408
151 Ga0075366_10074104 3300006195 Bacteria 2029
152 Ga0075366_10078044 3300006195 Bacteria 1976
153 Ga0097621_100549798 3300006237 Bacteria 1051
154 Ga0097621_100831619 3300006237 Bacteria 857
155 Ga0097621_100993400 3300006237 Bacteria 785
156 Ga0097621_101405606 3300006237 Bacteria 661
157 Ga0075370_10109857 3300006353 Bacteria 1601
158 Ga0075370_10206875 3300006353 Bacteria 1158
159 Ga0075370_10373789 3300006353 Bacteria 853
160 Ga0075370_10389353 3300006353 Bacteria 835
161 Ga0075370_10474906 3300006353 Bacteria 753
162 Ga0068871_100180601 3300006358 Bacteria 1813
163 Ga0068871_100500593 3300006358 Bacteria 1095
164 Ga0068871_101335164 3300006358 Bacteria 675
165 Ga0075429_100656618 3300006880 Bacteria 919
166 Ga0068865_101068316 3300006881 Bacteria 710
167 Ga0075436_100264123 3300006914 Bacteria 1228
168 Ga0097620_100455882 3300006931 Bacteria 1375
169 Ga0097620_100723877 3300006931 Bacteria 1085
170 Ga0099795_10027007 3300007788 Bacteria 1939
171 Ga0105251_10376511 3300009011 Bacteria 650
172 Ga0105250_10330281 3300009092 Bacteria 664
173 Ga0105240_10542999 3300009093 Bacteria 1287
174 Ga0105240_11749686 3300009093 Bacteria 648
175 Ga0111539_10065388 3300009094 Bacteria 4297
176 Ga0111539_10562174 3300009094 Bacteria 1328
177 Ga0105245_10045538 3300009098 Bacteria 3918
178 Ga0105245_10423459 3300009098 Bacteria 1335
179 Ga0105245_11213268 3300009098 Bacteria 802
180 Ga0105247_10002364 3300009101 Bacteria 12856
181 Ga0105247_10050933 3300009101 Bacteria 2549
182 Ga0105247_10327813 3300009101 Bacteria 1070
183 Ga0105247_10373738 3300009101 Bacteria 1009
184 Ga0105247_11382191 3300009101 Bacteria 569
185 Ga0114129_10190202 3300009147 Bacteria 2788
186 Ga0105243_10036133 3300009148 Bacteria 3832
187 Ga0105243_10429279 3300009148 Bacteria 1235
188 Ga0105243_11468920 3300009148 Bacteria 704
189 Ga0105241_10060020 3300009174 Bacteria 2925
190 Ga0105241_10166738 3300009174 Bacteria 1816
191 Ga0105241_11342152 3300009174 Bacteria 683
192 Ga0105242_10100161 3300009176 Bacteria 2453
193 Ga0105242_11266338 3300009176 Bacteria 760
194 Ga0105248_10112195 3300009177 Bacteria 3075
195 Ga0105248_10685392 3300009177 Bacteria 1156
196 Ga0105237_10006596 3300009545 Bacteria 12834
197 Ga0105237_10219668 3300009545 Bacteria 1901
198 Ga0105237_10382696 3300009545 Bacteria 1412
199 Ga0105238_10119909 3300009551 Bacteria 2610
200 Ga0105238_10244320 3300009551 Bacteria 1773
201 Ga0105238_10676304 3300009551 Bacteria 1043
202 Ga0105249_10022801 3300009553 Bacteria 5612
203 Ga0105239_10466331 3300010375 Bacteria 1434
204 Ga0105239_10470643 3300010375 Bacteria 1427
205 Ga0105239_12075194 3300010375 Bacteria 660
206 Ga0105246_10008882 3300011119 Bacteria 6184
207 Ga0105246_10178515 3300011119 Bacteria 1633
208 Ga0157342_1065633 3300012507 Bacteria 542
209 Ga0157370_10119131 3300013104 Bacteria 2465
210 Ga0157374_10443271 3300013296 Bacteria 1299
211 Ga0157378_10180184 3300013297 Bacteria 1987
212 Ga0157378_10455125 3300013297 Bacteria 1271
213 Ga0163162_10056995 3300013306 Bacteria 3935
214 Ga0163162_10737348 3300013306 Bacteria 1105
215 Ga0163162_10761920 3300013306 Bacteria 1087
216 Ga0163162_11050788 3300013306 Bacteria 922
217 Ga0163162_11391809 3300013306 Bacteria 798
218 Ga0157372_10791173 3300013307 Bacteria 1102
219 Ga0157375_10863399 3300013308 Bacteria 1051
220 Ga0157375_11945064 3300013308 Bacteria 698
221 Ga0157375_12772073 3300013308 Bacteria 586
222 Ga0163163_10033108 3300014325 Bacteria 4997
223 Ga0163163_10503827 3300014325 Bacteria 1273
224 Ga0163163_10581913 3300014325 Bacteria 1183
225 Ga0157380_10321470 3300014326 Bacteria 1435
226 Ga0157380_10368038 3300014326 Bacteria 1351
227 Ga0157380_11009685 3300014326 Bacteria 866
228 Ga0157376_11115185 3300014969 Bacteria 815
229 Ga0182007_10393072 3300015262 Bacteria 527
230 Ga0163161_10056068 3300017792 Bacteria 2861
231 Ga0163161_10645981 3300017792 Bacteria 876
232 Ga0213876_10001108 3300021384 Bacteria 17232
233 Ga0209677_100501 3300025253 Bacteria 22041
234 Ga0209233_1013851 3300025261 Bacteria 2292
235 Ga0209455_1002295 3300025272 Bacteria 7521
236 Ga0209455_1046062 3300025272 Bacteria 635
237 Ga0209564_1038632 3300025295 Bacteria 1324
238 Ga0209758_1041827 3300025297 Bacteria 1707
239 Ga0207697_10061062 3300025315 Bacteria 1568
240 Ga0207656_10013890 3300025321 Bacteria 3090
241 Ga0207692_10001396 3300025898 Bacteria 9039
242 Ga0207642_10113408 3300025899 Bacteria 1385
243 Ga0207710_10135162 3300025900 Bacteria 1187
244 Ga0207710_10187867 3300025900 Bacteria 1016
245 Ga0207710_10236786 3300025900 Bacteria 910
246 Ga0207710_10311967 3300025900 Bacteria 796
247 Ga0207680_10142121 3300025903 Bacteria 1592
248 Ga0207680_10968038 3300025903 Bacteria 610
249 Ga0207685_10011404 3300025905 Bacteria 2670
250 Ga0207685_10058143 3300025905 Bacteria 1520
251 Ga0207699_10021630 3300025906 Bacteria 3470
252 Ga0207645_10223884 3300025907 Bacteria 1240
253 Ga0207643_10181684 3300025908 Bacteria 1273
254 Ga0207643_10327286 3300025908 Bacteria 958
255 Ga0207654_10021180 3300025911 Bacteria 3454
256 Ga0207654_10111194 3300025911 Bacteria 1705
257 Ga0207707_10141119 3300025912 Bacteria 2106
258 Ga0207695_10002042 3300025913 Bacteria 30945
259 Ga0207695_10868482 3300025913 Bacteria 782
260 Ga0207671_10024690 3300025914 Bacteria 4515
261 Ga0207671_10389553 3300025914 Bacteria 1108
262 Ga0207671_10718274 3300025914 Bacteria 794
263 Ga0207693_10002986 3300025915 Bacteria 14649
264 Ga0207663_10001112 3300025916 Bacteria 12359
265 Ga0207663_11192703 3300025916 Bacteria 613
266 Ga0207660_10005383 3300025917 Bacteria 8310
267 Ga0207657_10116605 3300025919 Bacteria 2200
268 Ga0207657_10454447 3300025919 Bacteria 1005
269 Ga0207649_10290018 3300025920 Bacteria 1193
270 Ga0207649_11400429 3300025920 Bacteria 553
271 Ga0207652_10899432 3300025921 Bacteria 782
272 Ga0207646_11290971 3300025922 Bacteria 638
273 Ga0207681_10297862 3300025923 Bacteria 1275
274 Ga0207681_10995163 3300025923 Bacteria 703
275 Ga0207694_10001415 3300025924 Bacteria 20567
276 Ga0207694_10050943 3300025924 Bacteria 3209
277 Ga0207694_10270457 3300025924 Bacteria 1394
278 Ga0207694_10298106 3300025924 Bacteria 1327
279 Ga0207694_10387726 3300025924 Bacteria 1160
280 Ga0207650_10324969 3300025925 Bacteria 1261
281 Ga0207650_10341254 3300025925 Bacteria 1230
282 Ga0207687_10181316 3300025927 Bacteria 1632
283 Ga0207700_10054664 3300025928 Bacteria 2998
284 Ga0207664_10081551 3300025929 Bacteria 2632
285 Ga0207664_10857942 3300025929 Bacteria 816
286 Ga0207644_10226888 3300025931 Bacteria 1483
287 Ga0207690_10012826 3300025932 Bacteria 5021
288 Ga0207690_10056253 3300025932 Bacteria 2653
289 Ga0207706_10060816 3300025933 Bacteria 3327
290 Ga0207670_10390419 3300025936 Bacteria 1111
291 Ga0207669_11020395 3300025937 Bacteria 696
292 Ga0207704_10421655 3300025938 Bacteria 1058
293 Ga0207665_10000703 3300025939 Bacteria 22673
294 Ga0207691_10047902 3300025940 Bacteria 3920
295 Ga0207691_10150618 3300025940 Bacteria 2045
296 Ga0207691_11429772 3300025940 Bacteria 567
297 Ga0207711_10073347 3300025941 Bacteria 2975
298 Ga0207711_10758256 3300025941 Bacteria 904
299 Ga0207689_10151626 3300025942 Bacteria 1911
300 Ga0207689_10209278 3300025942 Bacteria 1611
301 Ga0207689_10211999 3300025942 Bacteria 1600
302 Ga0207679_10406249 3300025945 Bacteria 1199
303 Ga0207679_11185763 3300025945 Bacteria 701
304 Ga0207667_10011130 3300025949 Bacteria 10474
305 Ga0207651_10944470 3300025960 Bacteria 769
306 Ga0207651_11064643 3300025960 Bacteria 724
307 Ga0207712_10106344 3300025961 Bacteria 2096
308 Ga0207668_10099508 3300025972 Bacteria 2157
309 Ga0207668_10127442 3300025972 Bacteria 1938
310 Ga0207668_10170030 3300025972 Bacteria 1708
311 Ga0207668_10182308 3300025972 Bacteria 1657
312 Ga0207640_10217736 3300025981 Bacteria 1459
313 Ga0207640_10553339 3300025981 Bacteria 967
314 Ga0207658_10123641 3300025986 Bacteria 2067
315 Ga0207677_10302867 3300026023 Bacteria 1321
316 Ga0207677_10715139 3300026023 Bacteria 890
317 Ga0207677_11289134 3300026023 Bacteria 671
318 Ga0207703_10034795 3300026035 Bacteria 3999
319 Ga0207703_10095078 3300026035 Bacteria 2513
320 Ga0207639_10152849 3300026041 Bacteria 1935
321 Ga0207639_10252278 3300026041 Bacteria 1539
322 Ga0207678_10011116 3300026067 Bacteria 7907
323 Ga0207678_10156831 3300026067 Bacteria 1943
324 Ga0207678_10256820 3300026067 Bacteria 1497
325 Ga0207678_10301007 3300026067 Bacteria 1378
326 Ga0207678_10331066 3300026067 Bacteria 1311
327 Ga0207678_10405442 3300026067 Bacteria 1181
328 Ga0207678_10787199 3300026067 Bacteria 839
329 Ga0207708_10057294 3300026075 Bacteria 2973
330 Ga0207708_10498592 3300026075 Bacteria 1020
331 Ga0207702_10000003 3300026078 Bacteria 434196
332 Ga0207702_10062440 3300026078 Bacteria 3182
333 Ga0207702_10665328 3300026078 Bacteria 1025
334 Ga0207641_10888368 3300026088 Bacteria 884
335 Ga0207648_10014415 3300026089 Bacteria 7304
336 Ga0207676_10098150 3300026095 Bacteria 2421
337 Ga0207674_10036904 3300026116 Bacteria 5086
338 Ga0207674_10740130 3300026116 Bacteria 949
339 Ga0207674_11238141 3300026116 Bacteria 716
340 Ga0207675_100041106 3300026118 Bacteria 4318
341 Ga0207675_100268752 3300026118 Bacteria 1654
342 Ga0207675_100276616 3300026118 Bacteria 1630
343 Ga0207675_100546237 3300026118 Bacteria 1157
344 Ga0207683_10041381 3300026121 Bacteria 4024
345 Ga0207683_10252994 3300026121 Bacteria 1608
346 Ga0207683_10560401 3300026121 Bacteria 1057
347 Ga0207683_11770198 3300026121 Bacteria 567
348 Ga0207698_10253567 3300026142 Bacteria 1612
349 Ga0207698_10475177 3300026142 Bacteria 1211
350 Ga0209813_10038085 3300027866 Bacteria 1451
351 Ga0209813_10219759 3300027866 Bacteria 711
352 Ga0207428_10083833 3300027907 Bacteria 2485
353 Ga0268266_10001796 3300028379 Bacteria 24309
354 Ga0268266_10006533 3300028379 Bacteria 10670
355 Ga0268266_10028563 3300028379 Bacteria 4740
356 Ga0268266_10098652 3300028379 Bacteria 2571
357 Ga0268266_10180897 3300028379 Bacteria 1919
358 Ga0268266_10237638 3300028379 Bacteria 1680
359 Ga0268266_10551735 3300028379 Bacteria 1104
360 Ga0268266_10647462 3300028379 Bacteria 1017
361 Ga0268265_10118620 3300028380 Bacteria 2175
362 Ga0268265_10216649 3300028380 Bacteria 1672
363 Ga0268265_10485371 3300028380 Bacteria 1161
364 Ga0268265_11003586 3300028380 Bacteria 824
365 Ga0268264_10167444 3300028381 Bacteria 1985
366 Ga0268264_10506443 3300028381 Bacteria 1178
367 Ga0307515_10786597 3300028794 Bacteria 573
368 Ga0265330_10002550 3300031235 Bacteria 9898
369 Ga0265330_10015820 3300031235 Bacteria 3486
370 Ga0265325_10003674 3300031241 Bacteria 9936
371 Ga0265340_10037021 3300031247 Bacteria 2418
372 Ga0265339_10007436 3300031249 Bacteria 7079
373 Ga0265331_10019625 3300031250 Bacteria 3488
374 Ga0265316_10053947 3300031344 Bacteria 3148
375 Ga0307513_10234817 3300031456 Bacteria 1644
376 Ga0307513_10342522 3300031456 Bacteria 1245
377 Ga0307509_10040531 3300031507 Bacteria 5065
378 Ga0307509_10319157 3300031507 Bacteria 1291
379 Ga0307408_100168937 3300031548 Bacteria 1745
380 Ga0307408_100279318 3300031548 Bacteria 1390
381 Ga0307508_10127761 3300031616 Bacteria 2145
382 Ga0307508_10165454 3300031616 Bacteria 1815
383 Ga0307516_10074830 3300031730 Bacteria 3241
384 Ga0307516_10078356 3300031730 Bacteria 3151
385 Ga0307405_10488682 3300031731 Bacteria 984
386 Ga0307413_10197700 3300031824 Bacteria 1449
387 Ga0307413_10750133 3300031824 Bacteria 816
388 Ga0307518_10178990 3300031838 Bacteria 1436
389 Ga0307410_10217170 3300031852 Bacteria 1469
390 Ga0307410_10838822 3300031852 Bacteria 784
391 Ga0307406_10226633 3300031901 Bacteria 1393
392 Ga0307406_10854271 3300031901 Bacteria 772
393 Ga0307412_10059879 3300031911 Bacteria 2554
394 Ga0307412_10079025 3300031911 Bacteria 2268
395 Ga0307412_10178719 3300031911 Bacteria 1594
396 Ga0307409_100523584 3300031995 Bacteria 1159
397 Ga0307409_101123334 3300031995 Bacteria 808
398 Ga0307409_101638543 3300031995 Bacteria 672
399 Ga0307416_100525496 3300032002 Bacteria 1252
400 Ga0307416_100602952 3300032002 Bacteria 1178
401 Ga0307414_10088792 3300032004 Bacteria 2289
402 Ga0307411_11767693 3300032005 Bacteria 573
403 Ga0307411_11877617 3300032005 Bacteria 557
404 Ga0307510_10011129 3300033180 Bacteria 10696
405 Ga0307510_10018329 3300033180 Bacteria 8239
406 Ga0307510_10069015 3300033180 Bacteria 3543
407 Ga0307510_10098798 3300033180 Bacteria 2721
408 Ga0373936_0139993 3300035113 Bacteria 1044
409 Ga0373942_0035731 3300035207 Bacteria 1335
410 Ga0373947_0527347 3300035725 Bacteria 803
411 Ga0395905_0071917 3300037471 Bacteria 3242
412 Ga0395905_0185780 3300037471 Bacteria 1951
413 Ga0395905_1130254 3300037471 Bacteria 687
414 Ga0395901_0088921 3300038443 Bacteria 3232
415 Ga0436365_0122301 3300039437 Bacteria 13111
416 Ga0436365_1394541 3300039437 Bacteria 2634
417 Ga0436365_1539897 3300039437 Bacteria 702
418 Ga0436363_1129876 3300039450 Bacteria 993
419 Ga0451793_1818322 3300041452 Bacteria 1253
420 Ga0451807_1865263 3300041486 Bacteria 1066
421 Ga0451853_1431665 3300041512 Bacteria 886
422 Ga0439431_0047286 3300041997 Bacteria 1109
423 Ga0466966_0000720 3300044684 Bacteria 20983
424 Ga0466961_0000136 3300044693 Bacteria 49049
425 Ga0466971_0639603 3300044719 Bacteria 532
426 Ga0466958_0118098 3300045836 Bacteria 1659
427 Ga0495617_051855 3300046452 Bacteria 1363
428 Ga0495617_270213 3300046452 Bacteria 522
429 Ga0495603_0022671 3300046455 Bacteria 3799
430 Ga0495603_0061397 3300046455 Bacteria 2219
431 Ga0495603_0551565 3300046455 Bacteria 660
432 Ga0495629_0055561 3300046459 Bacteria 2768
433 Ga0495638_0069191 3300046460 Bacteria 2163
434 Ga0495638_0109260 3300046460 Bacteria 1644
435 Ga0495638_0137016 3300046460 Bacteria 1432
436 Ga0495638_0366263 3300046460 Bacteria 757
437 Ga0495651_0086807 3300046462 Bacteria 2353
438 Ga0495605_0178681 3300046474 Bacteria 934
439 Ga0495605_0203080 3300046474 Bacteria 863
440 Ga0495639_0087029 3300046475 Bacteria 1462
441 Ga0495584_0070687 3300046491 Bacteria 1754
442 Ga0495584_0315369 3300046491 Bacteria 794
443 Ga0495585_0036277 3300046492 Bacteria 2782
444 Ga0495594_0028295 3300046499 Bacteria 3024
445 Ga0495594_0436328 3300046499 Bacteria 745
446 Ga0495596_0349182 3300046500 Bacteria 576
447 Ga0495607_0028665 3300046501 Bacteria 3433
448 Ga0495583_0096872 3300046506 Bacteria 1263
449 Ga0495583_0143150 3300046506 Bacteria 994
450 Ga0495606_0267711 3300046507 Bacteria 940
451 Ga0495606_0284679 3300046507 Bacteria 902
452 Ga0495606_0289786 3300046507 Bacteria 891
453 Ga0495610_0188311 3300046512 Bacteria 853
454 Ga0495610_0307151 3300046512 Bacteria 610
455 Ga0495610_0320281 3300046512 Bacteria 592
456 Ga0495616_0471223 3300046513 Bacteria 506
457 Ga0495620_0038259 3300046515 Bacteria 2130
458 Ga0495620_0079650 3300046515 Bacteria 1327
459 Ga0495628_0526830 3300046516 Bacteria 851
460 Ga0495631_0037832 3300046518 Bacteria 2148
461 Ga0495631_0354160 3300046518 Bacteria 625
462 Ga0495632_0263489 3300046519 Bacteria 770
463 Ga0495637_0008884 3300046520 Bacteria 4918
464 Ga0495637_0265153 3300046520 Bacteria 616
465 Ga0495643_0047303 3300046522 Bacteria 2330
466 Ga0495644_0233770 3300046523 Bacteria 712
467 Ga0495648_0002080 3300046524 Bacteria 18945
468 Ga0495648_0034457 3300046524 Bacteria 3294
469 Ga0495648_0044716 3300046524 Bacteria 2761
470 Ga0495648_0065206 3300046524 Bacteria 2142
471 Ga0495652_0103154 3300046529 Bacteria 2309
472 Ga0495654_0116993 3300046530 Bacteria 1210
473 Ga0495665_0200725 3300046531 Bacteria 1034
474 Ga0495587_0285163 3300046536 Bacteria 925
475 Ga0495609_0324196 3300046538 Bacteria 624
476 Ga0495609_0441646 3300046538 Bacteria 517
477 Ga0495621_0079926 3300046539 Bacteria 1218
478 Ga0495597_0054897 3300046542 Bacteria 1748
479 Ga0495597_0145070 3300046542 Bacteria 977
480 Ga0495622_0009680 3300046557 Bacteria 4457
481 Ga0495622_0293396 3300046557 Bacteria 709
482 Ga0495633_0139985 3300046558 Bacteria 1119
483 Ga0495656_0012433 3300046615 Bacteria 3141
484 Ga0495656_0080275 3300046615 Bacteria 1471
485 Ga0495656_0094907 3300046615 Bacteria 1370
486 Ga0495656_0116191 3300046615 Bacteria 1257
487 Ga0495668_0035543 3300046616 Bacteria 2793
488 Ga0495668_0156688 3300046616 Bacteria 1247
489 Ga0495668_0201223 3300046616 Bacteria 1090
490 Ga0495668_0278872 3300046616 Bacteria 916
491 Ga0495611_0439127 3300046648 Bacteria 595
492 Ga0495611_0492072 3300046648 Bacteria 557
493 Ga0495625_0083627 3300046660 Bacteria 2218
494 Ga0495625_0520661 3300046660 Bacteria 724
495 Ga0495625_0525645 3300046660 Bacteria 720
496 Ga0495635_0135785 3300046663 Bacteria 1677
497 Ga0495635_0284145 3300046663 Bacteria 1111
498 Ga0495659_0004777 3300046664 Bacteria 4267
499 Ga0495659_0061185 3300046664 Bacteria 1391
500 Ga0495661_0114119 3300046665 Bacteria 1501
501 Ga0495588_0039553 3300046674 Bacteria 2403
502 Ga0495623_0238640 3300046679 Bacteria 1028
503 Ga0495669_0027733 3300046684 Bacteria 2478
504 Ga0495669_0051935 3300046684 Bacteria 1840
505 Ga0495589_0144672 3300046794 Bacteria 1137
506 Ga0495600_0156354 3300046809 Bacteria 1475
507 Ga0495660_0085628 3300046810 Bacteria 1646
508 Ga0495581_0112266 3300047315 Bacteria 1585
509 Ga0495581_0298185 3300047315 Bacteria 942
510 Ga0495581_0762835 3300047315 Bacteria 556
511 Ga0495672_0338751 3300047320 Bacteria 701
512 Ga0495672_0415460 3300047320 Bacteria 613
513 Ga0495676_0980734 3300047321 Bacteria 540
514 Ga0495683_0030240 3300047323 Bacteria 2764
515 Ga0495677_0062877 3300047445 Bacteria 1378
516 Ga0495673_0118238 3300047469 Bacteria 1052
517 Ga0495673_0131519 3300047469 Bacteria 983
518 Ga0495673_0206617 3300047469 Bacteria 732
519 Ga0495681_0040040 3300047470 Bacteria 2284
520 Ga0495686_0032221 3300047472 Bacteria 3393
521 Ga0495686_0349194 3300047472 Bacteria 804
522 Ga0495686_0402037 3300047472 Unclassified 735
523 Ga0495593_0069686 3300047673 Bacteria 1828
524 Ga0495602_0364194 3300048088 Bacteria 1040
525 Ga0496100_0874408 3300048903 Bacteria 705
526 Ga0496100_1140196 3300048903 Bacteria 615
527 Ga0496101_0218386 3300048904 Bacteria 1479
528 Ga0496102_0201366 3300048905 Bacteria 1877
529 Ga0496102_0414441 3300048905 Bacteria 1265
530 Ga0496102_0420187 3300048905 Bacteria 1256
531 Ga0496102_0530193 3300048905 Bacteria 1100
532 Ga0496102_0988114 3300048905 Bacteria 762
533 Ga0496103_0141235 3300048906 Bacteria 1540
534 Ga0496103_0368634 3300048906 Bacteria 923
535 Ga0496103_0916114 3300048906 Bacteria 549
536 Ga0496106_0001280 3300048909 Bacteria 18862
537 Ga0496106_0326642 3300048909 Bacteria 1231
538 Ga0496107_0153876 3300048910 Bacteria 1702
539 Ga0496108_0143185 3300048911 Bacteria 2060
540 Ga0496109_0373253 3300048912 Bacteria 1347
541 Ga0496109_0531987 3300048912 Bacteria 1109
542 Ga0496110_0327980 3300048913 Bacteria 1394
543 Ga0496110_1061011 3300048913 Bacteria 718
544 Ga0496111_0987228 3300048914 Bacteria 604
545 Ga0496112_0061648 3300048915 Bacteria 3698
546 Ga0496113_0105768 3300048916 Bacteria 2185
547 Ga0496114_1210087 3300048917 Bacteria 641
548 Ga0496115_0010296 3300048918 Bacteria 6981
549 Ga0496115_0184549 3300048918 Bacteria 1724
550 Ga0496115_0327108 3300048918 Bacteria 1253
551 Ga0496115_1248126 3300048918 Bacteria 556
552 Ga0496116_0020084 3300048919 Bacteria 5086
553 Ga0496116_0104835 3300048919 Bacteria 1679
554 Ga0496117_0008319 3300048920 Bacteria 9873
555 Ga0496117_0050653 3300048920 Bacteria 2943
556 Ga0496117_0165289 3300048920 Bacteria 1291
557 Ga0496117_0313375 3300048920 Bacteria 825
558 Ga0496118_0001458 3300048921 Bacteria 35562
559 Ga0496118_0018352 3300048921 Bacteria 6316
560 Ga0496118_0035734 3300048921 Bacteria 4028
561 Ga0496118_0238641 3300048921 Bacteria 1043
562 Ga0496119_0037240 3300048922 Bacteria 3163
563 Ga0496119_0048668 3300048922 Bacteria 2627
564 Ga0496119_0058578 3300048922 Bacteria 2320
565 Ga0496119_0465018 3300048922 Bacteria 594
566 Ga0496120_0058355 3300048923 Bacteria 2168
567 Ga0496120_0269523 3300048923 Bacteria 791
568 Ga0496120_0377552 3300048923 Bacteria 631
569 Ga0496121_0000146 3300048924 Bacteria 154459
570 Ga0496121_0000254 3300048924 Bacteria 113314
571 Ga0496121_0001525 3300048924 Bacteria 38839
572 Ga0496121_0002100 3300048924 Bacteria 31362
573 Ga0496121_0078360 3300048924 Bacteria 2627
574 Ga0496121_0085939 3300048924 Bacteria 2473
575 Ga0496121_0093283 3300048924 Bacteria 2344
576 Ga0496121_0382581 3300048924 Bacteria 927
577 Ga0496121_0565601 3300048924 Bacteria 708
578 Ga0496123_0005070 3300048926 Bacteria 13458
579 Ga0496124_0009204 3300048927 Bacteria 10188
580 Ga0496124_0138488 3300048927 Bacteria 1924
581 Ga0496125_0017943 3300048928 Bacteria 6728
582 Ga0496125_0166685 3300048928 Bacteria 1487
583 Ga0496125_0291557 3300048928 Bacteria 1004
584 Ga0496126_0003212 3300048929 Bacteria 20945
585 Ga0496126_0015212 3300048929 Bacteria 7747
586 Ga0496126_0016838 3300048929 Bacteria 7297
587 Ga0496126_0043920 3300048929 Bacteria 4119
588 Ga0496126_0102678 3300048929 Bacteria 2499
589 Ga0496126_0185463 3300048929 Bacteria 1764
590 Ga0496126_0375826 3300048929 Bacteria 1158
591 Ga0496126_0517341 3300048929 Bacteria 951
592 Ga0496126_0524488 3300048929 Bacteria 943
593 Ga0496126_0717016 3300048929 Bacteria 775
594 Ga0496126_0874033 3300048929 Bacteria 684
595 Ga0495682_0053776 3300049460 Bacteria 1462
596 Ga0495682_0055990 3300049460 Bacteria 1430
597 Ga0495682_0075980 3300049460 Bacteria 1208
598 Ga0495682_0195331 3300049460 Bacteria 718
599 Ga0501032_0000196 3300049569 Bacteria 50261
600 Ga0501033_0001104 3300049570 Bacteria 24475
601 Ga0501034_0001151 3300049571 Bacteria 36663
602 Ga0501036_0000323 3300049572 Bacteria 33256
603 Ga0501036_1626208 3300049572 Bacteria 521
604 Ga0501037_0001204 3300049573 Bacteria 19110
605 Ga0501038_0002973 3300049574 Bacteria 15796
606 Ga0501038_0798311 3300049574 Bacteria 701
607 Ga0501039_0000705 3300049575 Bacteria 24064
608 Ga0501040_0197847 3300049576 Bacteria 1427
609 Ga0501040_0285972 3300049576 Bacteria 1178
610 Ga0501041_0174158 3300049577 Bacteria 1347
611 Ga0501042_0032152 3300049578 Bacteria 3715
612 Ga0501043_0000409 3300049579 Bacteria 38657
613 Ga0501043_1265979 3300049579 Bacteria 516
614 Ga0501046_0000181 3300049580 Bacteria 64035
615 Ga0501047_0000419 3300049581 Bacteria 47535
616 Ga0501048_0000057 3300049582 Bacteria 56138
617 Ga0501048_1089564 3300049582 Bacteria 575
618 Ga0501067_0000145 3300049583 Bacteria 39277
619 Ga0501068_0001512 3300049584 Bacteria 12380
620 Ga0501069_0001180 3300049585 Bacteria 12685
621 Ga0501070_0019419 3300049586 Bacteria 5698
622 Ga0501070_0024463 3300049586 Bacteria 5065
623 Ga0501070_0706112 3300049586 Bacteria 797
624 Ga0501071_0026796 3300049587 Bacteria 4049
625 Ga0501071_0173294 3300049587 Bacteria 1616
626 Ga0501072_0000643 3300049588 Bacteria 25050
627 Ga0501073_0000027 3300049589 Bacteria 121860
628 Ga0501074_0000081 3300049590 Bacteria 46487
629 Ga0501079_0013675 3300049741 Bacteria 6189
630 Ga0501080_0000883 3300049742 Bacteria 24535
631 Ga0501080_0538795 3300049742 Bacteria 1040
632 Ga0501083_0004050 3300049744 Bacteria 10311
633 Ga0501035_0003158 3300049822 Bacteria 15827
634 Ga0501044_0001511 3300049823 Bacteria 27265
635 Ga0501045_0007967 3300049824 Bacteria 7379
636 nmdc:mga03683_58498_c1 3300050489 Bacteria 1624
637 nmdc:mga03n38_61610_c1 3300050490 Bacteria 1709
638 nmdc:mga03n38_640_c1 3300050490 Bacteria 8984
639 nmdc:mga00v17_36643_c1 3300050491 Bacteria 2925
640 nmdc:mga00v17_486919_c1 3300050491 Bacteria 800
641 nmdc:mga0yw44_23931_c1 3300050492 Bacteria 3448
642 nmdc:mga0k408_273329_c1 3300050493 Bacteria 1009
643 nmdc:mga0k408_322557_c1 3300050493 Bacteria 922
644 nmdc:mga0k408_708906_c1 3300050493 Bacteria 589
645 nmdc:mga06z11_249403_c1 3300050494 Bacteria 1045
646 nmdc:mga06z11_43089_c1 3300050494 Bacteria 2268
647 nmdc:mga06z11_54839_c1 3300050494 Bacteria 2056
648 nmdc:mga06z11_662578_c1 3300050494 Bacteria 635
649 nmdc:mga04h51_239633_c1 3300050495 Bacteria 724
650 nmdc:mga04h51_46550_c1 3300050495 Bacteria 1438
651 nmdc:mga07m45_15864_c1 3300050496 Bacteria 4027
652 nmdc:mga07m45_221268_c1 3300050496 Bacteria 1101
653 nmdc:mga07m45_40684_c1 3300050496 Bacteria 2601
654 nmdc:mga07m45_79576_c1 3300050496 Bacteria 1871
655 nmdc:mga07m45_99476_c1 3300050496 Bacteria 1670
656 nmdc:mga05p37_14625_c1 3300050507 Bacteria 9428
657 nmdc:mga09592_526452_c1 3300050508 Bacteria 1016
658 nmdc:mga08y16_217968_c1 3300050511 Bacteria 1976
659 nmdc:mga08x19_411861_c1 3300050514 Bacteria 949
660 nmdc:mga0sz30_191099_c1 3300050516 Bacteria 909
661 nmdc:mga0sz30_278514_c1 3300050516 Bacteria 745
662 nmdc:mga0sz30_295729_c1 3300050516 Bacteria 722
663 nmdc:mga0sz30_6950_c1 3300050516 Bacteria 4228
664 Ga0500635_0013637 3300053080 Bacteria 2365
665 Ga0495595_0508876 3300053084 Bacteria 614
666 Ga0500578_0041351 3300053086 Bacteria 2961
667 Ga0500578_0092395 3300053086 Bacteria 1920
668 Ga0500578_0267537 3300053086 Bacteria 1024
669 Ga0500643_106288 3300053087 Bacteria 760
670 Ga0500643_141764 3300053087 Bacteria 645
671 Ga0500644_0034521 3300053088 Bacteria 1632
672 Ga0500581_043214 3300053089 Bacteria 2305
673 Ga0500646_0010996 3300053090 Bacteria 2325
674 Ga0500646_0125244 3300053090 Bacteria 830
675 Ga0500647_0017905 3300053091 Bacteria 3275
676 Ga0500651_0056536 3300053093 Bacteria 2456
677 Ga0500651_0123443 3300053093 Bacteria 1570
678 Ga0500566_0000113 3300053094 Bacteria 41467
679 Ga0500566_0000574 3300053094 Bacteria 20705
680 Ga0500640_000015 3300053095 Bacteria 25262
681 Ga0500641_0000742 3300053096 Bacteria 11809
682 Ga0500650_0003757 3300053098 Bacteria 5353
683 Ga0500555_045844 3300053103 Bacteria 1207
684 Ga0500556_0000035 3300053104 Bacteria 145357
685 Ga0500556_0029460 3300053104 Bacteria 1851
686 Ga0500562_061930 3300053108 Bacteria 1005
687 Ga0500562_087964 3300053108 Bacteria 842
688 Ga0500569_013787 3300053109 Bacteria 1987
689 Ga0500572_000087 3300053111 Bacteria 29543
690 Ga0500591_214450 3300053115 Bacteria 645
691 Ga0500592_007600 3300053116 Bacteria 1722
692 Ga0500592_041883 3300053116 Bacteria 742
693 Ga0500593_028184 3300053117 Bacteria 2509
694 Ga0500594_0039849 3300053118 Bacteria 1279
695 Ga0500595_002430 3300053119 Bacteria 9285
696 Ga0500595_005832 3300053119 Bacteria 5312
697 Ga0500595_006784 3300053119 Bacteria 4822
698 Ga0500595_011118 3300053119 Bacteria 3539
699 Ga0500595_035406 3300053119 Bacteria 1644
700 Ga0500595_055447 3300053119 Bacteria 1214
701 Ga0500607_110341 3300053121 Bacteria 1350
702 Ga0500608_000269 3300053122 Bacteria 20074
703 Ga0500608_162729 3300053122 Bacteria 965
704 Ga0500614_000881 3300053123 Bacteria 7578
705 Ga0500618_011506 3300053125 Bacteria 2345
706 Ga0500618_022841 3300053125 Bacteria 1517
707 Ga0500642_0000027 3300053130 Bacteria 119688
708 Ga0500642_0083197 3300053130 Bacteria 1472
709 Ga0500652_000529 3300053131 Bacteria 13438
710 Ga0500559_0000064 3300053136 Bacteria 85844
711 Ga0500559_0001344 3300053136 Bacteria 14113
712 Ga0500568_0000443 3300053139 Bacteria 31089
713 Ga0500568_0028239 3300053139 Bacteria 2340
714 Ga0500568_0115453 3300053139 Bacteria 1002
715 Ga0500577_0000809 3300053142 Bacteria 8060
716 Ga0500585_087784 3300053144 Bacteria 1124
717 Ga0500586_004877 3300053145 Bacteria 3343
718 Ga0500588_0175589 3300053146 Bacteria 786
719 Ga0500588_0243282 3300053146 Bacteria 674
720 Ga0500603_000174 3300053150 Bacteria 16397
721 Ga0500603_000706 3300053150 Bacteria 8131
722 Ga0500604_0036684 3300053151 Bacteria 1462
723 Ga0500604_0092125 3300053151 Bacteria 991
724 Ga0500616_0000054 3300053153 Bacteria 290186
725 Ga0500619_031272 3300053154 Bacteria 1623
726 Ga0500622_0019279 3300053156 Bacteria 3623
727 Ga0500627_0016445 3300053158 Bacteria 2885
728 Ga0500627_0025162 3300053158 Bacteria 2443
729 Ga0500627_0038515 3300053158 Bacteria 2045
730 Ga0500627_0222401 3300053158 Bacteria 842
731 Ga0500630_002996 3300053159 Bacteria 8156
732 Ga0500634_0116538 3300053161 Bacteria 1308
733 Ga0500634_0260753 3300053161 Bacteria 713
734 Ga0500639_000050 3300053163 Bacteria 54136
735 Ga0500639_122094 3300053163 Bacteria 1249
736 Ga0500636_0001203 3300053177 Bacteria 13970
737 Ga0500636_0077223 3300053177 Bacteria 1924
738 Ga0500636_0109550 3300053177 Bacteria 1562
739 Ga0500636_0545175 3300053177 Bacteria 503
740 Ga0500637_0001513 3300053178 Bacteria 9913
741 Ga0500637_0106448 3300053178 Bacteria 1626
742 Ga0500611_012900 3300053727 Bacteria 1421
743 Ga0500596_000100 3300053735 Bacteria 11801
744 Ga0500601_003419 3300053737 Bacteria 1721
745 Ga0501084_0003425 3300054114 Bacteria 12868
746 Ga0501082_0007835 3300060353 Bacteria 9215
747 Ga0501082_1310081 3300060353 Bacteria 633
748 Ga0530510_0589998 3300061734 Bacteria 845

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0010296 Ga0496115_0010296_49_492 126
2 3300035725 Ga0373947_0527347 Ga0373947_0527347_365_763 132
3 3300025916 Ga0207663_11192703 Ga0207663_111927031 137
4 3300047472 Ga0495686_0349194 Ga0495686_0349194_168_584 137
5 3300048918 Ga0496115_0184549 Ga0496115_0184549_1045_1461 137
6 3300048929 Ga0496126_0185463 Ga0496126_0185463_1175_1591 137
7 3300005328 Ga0070676_10598651 Ga0070676_105986511 138
8 3300005331 Ga0070670_100221633 Ga0070670_1002216332 138
9 3300005334 Ga0068869_100518389 Ga0068869_1005183892 138
10 3300005338 Ga0068868_100061118 Ga0068868_1000611184 138
11 3300005339 Ga0070660_100454544 Ga0070660_1004545442 138
12 3300005340 Ga0070689_101189751 Ga0070689_1011897511 138
13 3300005347 Ga0070668_100033559 Ga0070668_1000335593 138
14 3300005353 Ga0070669_100165185 Ga0070669_1001651852 138
15 3300005364 Ga0070673_101426930 Ga0070673_1014269301 138
16 3300005365 Ga0070688_100727558 Ga0070688_1007275581 138
17 3300005366 Ga0070659_101155302 Ga0070659_1011553022 138
18 3300005367 Ga0070667_101086539 Ga0070667_1010865391 138
19 3300005456 Ga0070678_100361057 Ga0070678_1003610572 138
20 3300005535 Ga0070684_100453306 Ga0070684_1004533062 138
21 3300005543 Ga0070672_102062954 Ga0070672_1020629541 138
22 3300005548 Ga0070665_101020155 Ga0070665_1010201552 138
23 3300005563 Ga0068855_100087580 Ga0068855_1000875802 138
24 3300005564 Ga0070664_100099136 Ga0070664_1000991363 138
25 3300005577 Ga0068857_100053817 Ga0068857_1000538172 138
26 3300005578 Ga0068854_100034950 Ga0068854_1000349502 138
27 3300005614 Ga0068856_100024284 Ga0068856_1000242842 138
28 3300005617 Ga0068859_100455890 Ga0068859_1004558902 138
29 3300005618 Ga0068864_100043821 Ga0068864_1000438213 138
30 3300005718 Ga0068866_10679370 Ga0068866_106793702 138
31 3300005719 Ga0068861_100175720 Ga0068861_1001757202 138
32 3300005841 Ga0068863_100234805 Ga0068863_1002348052 138
33 3300005842 Ga0068858_100631037 Ga0068858_1006310372 138
34 3300005843 Ga0068860_100176736 Ga0068860_1001767362 138
35 3300005844 Ga0068862_100286072 Ga0068862_1002860722 138
36 3300006042 Ga0075368_10128665 Ga0075368_101286652 138
37 3300006048 Ga0075363_100106464 Ga0075363_1001064641 138
38 3300006051 Ga0075364_10591138 Ga0075364_105911382 138
39 3300006178 Ga0075367_10249824 Ga0075367_102498242 138
40 3300006186 Ga0075369_10084795 Ga0075369_100847951 138
41 3300006195 Ga0075366_10078044 Ga0075366_100780442 138
42 3300006237 Ga0097621_100993400 Ga0097621_1009934001 138
43 3300006353 Ga0075370_10206875 Ga0075370_102068752 138
44 3300006358 Ga0068871_100180601 Ga0068871_1001806011 138
45 3300006881 Ga0068865_101068316 Ga0068865_1010683162 138
46 3300006914 Ga0075436_100264123 Ga0075436_1002641232 138
47 3300006931 Ga0097620_100455882 Ga0097620_1004558822 138
48 3300009093 Ga0105240_10542999 Ga0105240_105429992 138
49 3300009094 Ga0111539_10562174 Ga0111539_105621741 138
50 3300009098 Ga0105245_10045538 Ga0105245_100455382 138
51 3300009148 Ga0105243_10429279 Ga0105243_104292792 138
52 3300009174 Ga0105241_10166738 Ga0105241_101667382 138
53 3300009177 Ga0105248_10112195 Ga0105248_101121952 138
54 3300009545 Ga0105237_10219668 Ga0105237_102196681 138
55 3300009551 Ga0105238_10244320 Ga0105238_102443201 138
56 3300010375 Ga0105239_10470643 Ga0105239_104706432 138
57 3300011119 Ga0105246_10178515 Ga0105246_101785152 138
58 3300013296 Ga0157374_10443271 Ga0157374_104432712 138
59 3300013297 Ga0157378_10455125 Ga0157378_104551251 138
60 3300013306 Ga0163162_10737348 Ga0163162_107373481 138
61 3300014325 Ga0163163_10033108 Ga0163163_100331086 138
62 3300017792 Ga0163161_10645981 Ga0163161_106459812 138
63 3300025900 Ga0207710_10135162 Ga0207710_101351622 138
64 3300025903 Ga0207680_10968038 Ga0207680_109680381 138
65 3300025905 Ga0207685_10058143 Ga0207685_100581432 138
66 3300025911 Ga0207654_10111194 Ga0207654_101111941 138
67 3300025913 Ga0207695_10868482 Ga0207695_108684821 138
68 3300025914 Ga0207671_10389553 Ga0207671_103895532 138
69 3300025919 Ga0207657_10454447 Ga0207657_104544472 138
70 3300025920 Ga0207649_10290018 Ga0207649_102900182 138
71 3300025924 Ga0207694_10050943 Ga0207694_100509433 138
72 3300025925 Ga0207650_10341254 Ga0207650_103412542 138
73 3300025927 Ga0207687_10181316 Ga0207687_101813162 138
74 3300025932 Ga0207690_10056253 Ga0207690_100562533 138
75 3300025936 Ga0207670_10390419 Ga0207670_103904192 138
76 3300025938 Ga0207704_10421655 Ga0207704_104216552 138
77 3300025940 Ga0207691_10150618 Ga0207691_101506182 138
78 3300025941 Ga0207711_10073347 Ga0207711_100733473 138
79 3300025942 Ga0207689_10151626 Ga0207689_101516262 138
80 3300025972 Ga0207668_10127442 Ga0207668_101274422 138
81 3300025981 Ga0207640_10217736 Ga0207640_102177362 138
82 3300025986 Ga0207658_10123641 Ga0207658_101236412 138
83 3300026035 Ga0207703_10034795 Ga0207703_100347954 138
84 3300026041 Ga0207639_10152849 Ga0207639_101528492 138
85 3300026067 Ga0207678_10301007 Ga0207678_103010072 138
86 3300026078 Ga0207702_10062440 Ga0207702_100624402 138
87 3300026088 Ga0207641_10888368 Ga0207641_108883681 138
88 3300026095 Ga0207676_10098150 Ga0207676_100981502 138
89 3300026116 Ga0207674_10036904 Ga0207674_100369044 138
90 3300026118 Ga0207675_100268752 Ga0207675_1002687522 138
91 3300026121 Ga0207683_10252994 Ga0207683_102529941 138
92 3300026142 Ga0207698_10475177 Ga0207698_104751772 138
93 3300028379 Ga0268266_10180897 Ga0268266_101808972 138
94 3300028380 Ga0268265_10485371 Ga0268265_104853712 138
95 3300048905 Ga0496102_0414441 Ga0496102_0414441_288_731 138
96 3300048906 Ga0496103_0141235 Ga0496103_0141235_430_873 138
97 3300048909 Ga0496106_0326642 Ga0496106_0326642_582_1025 138
98 3300048911 Ga0496108_0143185 Ga0496108_0143185_571_1014 138
99 3300048915 Ga0496112_0061648 Ga0496112_0061648_1509_1952 138
100 3300048916 Ga0496113_0105768 Ga0496113_0105768_254_697 138
101 3300048924 Ga0496121_0002100 Ga0496121_0002100_16005_16460 138
102 3300048928 Ga0496125_0166685 Ga0496125_0166685_46_489 138
103 3300050490 nmdc:mga03n38_61610_c1 nmdc:mga03n38_61610_c1_1124_1567 138
104 3300050491 nmdc:mga00v17_36643_c1 nmdc:mga00v17_36643_c1_1262_1705 138
105 3300050493 nmdc:mga0k408_322557_c1 nmdc:mga0k408_322557_c1_400_843 138
106 3300050496 nmdc:mga07m45_40684_c1 nmdc:mga07m45_40684_c1_1000_1443 138
107 3300050514 nmdc:mga08x19_411861_c1 nmdc:mga08x19_411861_c1_76_519 138
108 3300050516 nmdc:mga0sz30_191099_c1 nmdc:mga0sz30_191099_c1_294_737 138
109 3300048912 Ga0496109_0373253 Ga0496109_0373253_39_482 139
110 3300009101 Ga0105247_10050933 Ga0105247_100509333 140
111 3300025900 Ga0207710_10311967 Ga0207710_103119671 140
112 3300031241 Ga0265325_10003674 Ga0265325_100036743 140
113 3300031250 Ga0265331_10019625 Ga0265331_100196254 140
114 3300031344 Ga0265316_10053947 Ga0265316_100539471 140
115 3300046460 Ga0495638_0069191 Ga0495638_0069191_375_797 140
116 3300046460 Ga0495638_0109260 Ga0495638_0109260_61_483 140
117 3300046501 Ga0495607_0028665 Ga0495607_0028665_2675_3097 140
118 3300046512 Ga0495610_0188311 Ga0495610_0188311_347_769 140
119 3300046515 Ga0495620_0038259 Ga0495620_0038259_1377_1799 140
120 3300046518 Ga0495631_0037832 Ga0495631_0037832_202_624 140
121 3300046520 Ga0495637_0008884 Ga0495637_0008884_3034_3456 140
122 3300046522 Ga0495643_0047303 Ga0495643_0047303_768_1190 140
123 3300046524 Ga0495648_0002080 Ga0495648_0002080_17173_17595 140
124 3300046524 Ga0495648_0034457 Ga0495648_0034457_60_482 140
125 3300046530 Ga0495654_0116993 Ga0495654_0116993_772_1194 140
126 3300046542 Ga0495597_0054897 Ga0495597_0054897_1036_1458 140
127 3300046557 Ga0495622_0009680 Ga0495622_0009680_3027_3449 140
128 3300046616 Ga0495668_0156688 Ga0495668_0156688_29_451 140
129 3300046660 Ga0495625_0520661 Ga0495625_0520661_30_452 140
130 3300046665 Ga0495661_0114119 Ga0495661_0114119_61_483 140
131 3300046674 Ga0495588_0039553 Ga0495588_0039553_1407_1829 140
132 3300046810 Ga0495660_0085628 Ga0495660_0085628_706_1128 140
133 3300047472 Ga0495686_0032221 Ga0495686_0032221_1250_1672 140
134 3300048905 Ga0496102_0420187 Ga0496102_0420187_741_1163 140
135 3300048920 Ga0496117_0313375 Ga0496117_0313375_93_515 140
136 3300048921 Ga0496118_0238641 Ga0496118_0238641_592_1014 140
137 3300048923 Ga0496120_0058355 Ga0496120_0058355_899_1321 140
138 3300048924 Ga0496121_0093283 Ga0496121_0093283_1591_2013 140
139 3300048926 Ga0496123_0005070 Ga0496123_0005070_11314_11736 140
140 3300048929 Ga0496126_0517341 Ga0496126_0517341_107_529 140
141 3300053086 Ga0500578_0092395 Ga0500578_0092395_1169_1591 140
142 3300053087 Ga0500643_141764 Ga0500643_141764_127_549 140
143 3300053088 Ga0500644_0034521 Ga0500644_0034521_737_1159 140
144 3300053089 Ga0500581_043214 Ga0500581_043214_1663_2085 140
145 3300053090 Ga0500646_0010996 Ga0500646_0010996_340_762 140
146 3300053093 Ga0500651_0123443 Ga0500651_0123443_960_1382 140
147 3300053094 Ga0500566_0000574 Ga0500566_0000574_15667_16089 140
148 3300053096 Ga0500641_0000742 Ga0500641_0000742_1962_2384 140
149 3300053098 Ga0500650_0003757 Ga0500650_0003757_4109_4531 140
150 3300053103 Ga0500555_045844 Ga0500555_045844_684_1106 140
151 3300053104 Ga0500556_0000035 Ga0500556_0000035_41159_41581 140
152 3300053108 Ga0500562_087964 Ga0500562_087964_69_491 140
153 3300053109 Ga0500569_013787 Ga0500569_013787_1178_1600 140
154 3300053116 Ga0500592_007600 Ga0500592_007600_129_551 140
155 3300053117 Ga0500593_028184 Ga0500593_028184_1887_2309 140
156 3300053118 Ga0500594_0039849 Ga0500594_0039849_134_556 140
157 3300053122 Ga0500608_000269 Ga0500608_000269_6757_7179 140
158 3300053125 Ga0500618_011506 Ga0500618_011506_405_827 140
159 3300053125 Ga0500618_022841 Ga0500618_022841_158_580 140
160 3300053130 Ga0500642_0000027 Ga0500642_0000027_56652_57074 140
161 3300053131 Ga0500652_000529 Ga0500652_000529_7706_8128 140
162 3300053136 Ga0500559_0000064 Ga0500559_0000064_60441_60863 140
163 3300053139 Ga0500568_0000443 Ga0500568_0000443_25476_25898 140
164 3300053151 Ga0500604_0036684 Ga0500604_0036684_398_820 140
165 3300053153 Ga0500616_0000054 Ga0500616_0000054_245519_245941 140
166 3300053154 Ga0500619_031272 Ga0500619_031272_749_1171 140
167 3300053156 Ga0500622_0019279 Ga0500622_0019279_587_1009 140
168 3300053158 Ga0500627_0025162 Ga0500627_0025162_1939_2361 140
169 3300053177 Ga0500636_0001203 Ga0500636_0001203_11099_11521 140
170 3300053177 Ga0500636_0545175 Ga0500636_0545175_56_478 140
171 3300053727 Ga0500611_012900 Ga0500611_012900_842_1264 140
172 iso_pu_bacteria 2511231028 2511394357 140
173 iso_pu_bacteria 2513237092 2513624461 140
174 iso_pu_bacteria 2513237095 2513649935 140
175 iso_pu_bacteria 2513237102 2513702464 140
176 iso_pu_bacteria 2513237139 2513874230 140
177 iso_pu_bacteria 2513237161 2514010004 140
178 iso_pu_bacteria 2517093001 2517104628 140
179 iso_pu_bacteria 2528768022 2528850432 140
180 iso_pu_bacteria 2617270735 2617353855 140
181 iso_pu_bacteria 2617270741 2617374632 140
182 iso_pu_bacteria 2791355196 2793059364 140
183 iso_pu_bacteria 2802429603 2805922120 140
184 iso_pu_bacteria 2816332527 2818240935 140
185 iso_pu_bacteria 2824600985 2824604631 140
186 iso_pu_bacteria 2824609381 2824616161 140
187 iso_pu_bacteria 2824617872 2824618904 140
188 iso_pu_bacteria 2824626560 2824632920 140
189 iso_pu_bacteria 2824635225 2824642619 140
190 iso_pu_bacteria 2824644064 2824652911 140
191 iso_pu_bacteria 2824653114 2824658380 140
192 iso_pu_bacteria 2824661429 2824667389 140
193 iso_pu_bacteria 2824671348 2824675533 140
194 iso_pu_bacteria 2824679649 2824686568 140
195 iso_pu_bacteria 2824687955 2824691755 140
196 iso_pu_bacteria 2824696289 2824698982 140
197 iso_pu_bacteria 2824714736 2824723756 140
198 iso_pu_bacteria 2824723954 2824730663 140
199 iso_pu_bacteria 2824732956 2824739312 140
200 iso_pu_bacteria 2824746037 2824750396 140
201 iso_pu_bacteria 2824773399 2824779749 140
202 iso_pu_bacteria 2838122688 2838126091 140
203 iso_pu_bacteria 2841941048 2841942516 140
204 iso_pu_bacteria 2841949485 2841953134 140
205 iso_pu_bacteria 2841957949 2841960642 140
206 iso_pu_bacteria 2841966195 2841970842 140
207 iso_pu_bacteria 2841974524 2841977899 140
208 iso_pu_bacteria 2841983080 2841984536 140
209 iso_pu_bacteria 2842038055 2842041743 140
210 iso_pu_bacteria 2842045827 2842049785 140
211 iso_pu_bacteria 2847930680 2847932038 140
212 iso_pu_bacteria 2847939898 2847943275 140
213 iso_pu_bacteria 2857509624 2857514724 140
214 iso_pu_bacteria 2874612657 2874620322 140
215 iso_pu_bacteria 2874620515 2874624260 140
216 iso_pu_bacteria 2874628541 2874630266 140
217 iso_pu_bacteria 2879083081 2879085714 140
218 iso_pu_bacteria 2879099564 2879100882 140
219 iso_pu_bacteria 2888378607 2888387671 140
220 iso_pu_bacteria 2888419890 2888426888 140
221 iso_pu_bacteria 2904666416 2904670971 140
222 iso_pu_bacteria 2906643746 2906647247 140
223 iso_pu_bacteria 2908775508 2908777113 140
224 iso_pu_bacteria 2922393267 2922398605 140
225 iso_pu_bacteria 2929615660 2929619838 140
226 iso_pu_bacteria 2929624759 2929629149 140
227 iso_pu_bacteria 2932784394 2932789718 140
228 iso_pu_bacteria 2932809354 2932817770 140
229 iso_pu_bacteria 2932818245 2932827119 140
230 iso_pu_bacteria 2932828146 2932835643 140
231 iso_pu_bacteria 2933577622 2933581757 140
232 iso_pu_bacteria 2935616580 2935624583 140
233 iso_pu_bacteria 2935638405 2935647190 140
234 iso_pu_bacteria 2935665750 2935674347 140
235 iso_pu_bacteria 2935675223 2935684228 140
236 iso_pu_bacteria 2935684952 2935689099 140
237 iso_pu_bacteria 2935694250 2935697641 140
238 iso_pu_bacteria 2935703347 2935711336 140
239 iso_pu_bacteria 2935713505 2935720045 140
240 iso_pu_bacteria 2935722832 2935728338 140
241 iso_pu_bacteria 2935732158 2935737065 140
242 iso_pu_bacteria 2935741537 2935746874 140
243 iso_pu_bacteria 2935750917 2935757841 140
244 iso_pu_bacteria 2935760218 2935764219 140
245 iso_pu_bacteria 2935801545 2935809878 140
246 iso_pu_bacteria 2935810662 2935819341 140
247 iso_pu_bacteria 2935827899 2935836614 140
248 iso_pu_bacteria 2935837841 2935846824 140
249 iso_pu_bacteria 2935855204 2935863207 140
250 iso_pu_bacteria 2935864058 2935868676 140
251 iso_pu_bacteria 2935873716 2935879450 140
252 iso_pu_bacteria 2935992306 2936000244 140
253 iso_pu_bacteria 2936002035 2936010286 140
254 iso_pu_bacteria 2936037263 2936045964 140
255 iso_pu_bacteria 2940556831 2940563337 140
256 iso_pu_bacteria 2941538514 2941547250 140
257 iso_pu_bacteria 3005483717 3005485969 140
258 iso_pu_bacteria 3005506211 3005506633 140
259 iso_pu_bacteria 3005587118 3005591791 140
260 iso_pu_bacteria 8016511872 8016519172 140
261 iso_pu_bacteria 8017057580 8017066331 140
262 iso_pu_bacteria 8019576017 8019578287 140
263 iso_pu_bacteria 8019586578 8019596322 140
264 iso_pu_bacteria 8019597564 8019605377 140
265 iso_pu_bacteria 8019608314 8019613166 140
266 iso_pu_bacteria 8055742211 8055750409 140
267 iso_pu_bacteria 8056967851 8056971811 140
268 3300035113 Ga0373936_0139993 Ga0373936_0139993_537_1001 141
269 3300053091 Ga0500647_0017905 Ga0500647_0017905_214_678 141
270 3300053094 Ga0500566_0000113 Ga0500566_0000113_25251_25715 141
271 3300053095 Ga0500640_000015 Ga0500640_000015_8698_9162 141
272 3300053111 Ga0500572_000087 Ga0500572_000087_6888_7352 141
273 3300053115 Ga0500591_214450 Ga0500591_214450_165_629 141
274 3300053122 Ga0500608_162729 Ga0500608_162729_94_558 141
275 3300053123 Ga0500614_000881 Ga0500614_000881_1237_1701 141
276 3300053136 Ga0500559_0001344 Ga0500559_0001344_12934_13398 141
277 3300053144 Ga0500585_087784 Ga0500585_087784_362_826 141
278 3300053150 Ga0500603_000174 Ga0500603_000174_4477_4941 141
279 3300053159 Ga0500630_002996 Ga0500630_002996_4810_5274 141
280 3300053163 Ga0500639_000050 Ga0500639_000050_30587_31051 141
281 3300053178 Ga0500637_0106448 Ga0500637_0106448_1051_1515 141
282 3300053735 Ga0500596_000100 Ga0500596_000100_1474_1938 141
283 3300053737 Ga0500601_003419 Ga0500601_003419_743_1207 141
284 iso_pu_bacteria 2513237101 2513697587 142
285 iso_pu_bacteria 2524023205 2524438578 142
286 iso_pu_bacteria 2744054633 2745077196 142
287 iso_pu_bacteria 2874604998 2874606782 142
288 iso_pu_bacteria 2876761206 2876767700 142
289 iso_pu_bacteria 2885409591 2885411514 142
290 iso_pu_bacteria 2935959822 2935965424 142
291 iso_pu_bacteria 2941531003 2941531942 142
292 iso_pu_bacteria 8006994254 8006999188 142
293 iso_pu_bacteria 8056681323 8056685492 142
294 3300005617 Ga0068859_100723974 Ga0068859_1007239742 143
295 3300005842 Ga0068858_100319919 Ga0068858_1003199192 143
296 3300006931 Ga0097620_100723877 Ga0097620_1007238772 143
297 3300007788 Ga0099795_10027007 Ga0099795_100270072 143
298 3300025261 Ga0209233_1013851 Ga0209233_10138512 143
299 3300025272 Ga0209455_1002295 Ga0209455_10022957 143
300 3300025900 Ga0207710_10187867 Ga0207710_101878672 143
301 3300025914 Ga0207671_10718274 Ga0207671_107182741 143
302 3300048929 Ga0496126_0016838 Ga0496126_0016838_6322_6753 143
303 3300053119 Ga0500595_035406 Ga0500595_035406_290_721 143
304 iso_pu_bacteria 2602042107 2603860660 143
305 iso_pu_bacteria 2721755755 2723842535 143
306 iso_pu_bacteria 2857524615 2857525619 143
307 iso_pu_bacteria 2879110137 2879113484 143
308 iso_pu_bacteria 2893066018 2893070657 143
309 iso_pu_bacteria 2919073203 2919074572 143
310 iso_pu_bacteria 2922361189 2922367579 143
311 iso_pu_bacteria 8006964411 8006965420 143
312 iso_pu_bacteria 8006984368 8006986148 143
313 3300005457 Ga0070662_100569355 Ga0070662_1005693551 144
314 3300005548 Ga0070665_100062245 Ga0070665_1000622454 144
315 3300005548 Ga0070665_101508262 Ga0070665_1015082621 144
316 3300005563 Ga0068855_101239547 Ga0068855_1012395472 144
317 3300006177 Ga0075362_10206452 Ga0075362_102064522 144
318 3300006186 Ga0075369_10032107 Ga0075369_100321073 144
319 3300006195 Ga0075366_10074104 Ga0075366_100741042 144
320 3300015262 Ga0182007_10393072 Ga0182007_103930721 144
321 3300025253 Ga0209677_100501 Ga0209677_1005016 144
322 3300025272 Ga0209455_1046062 Ga0209455_10460621 144
323 3300028379 Ga0268266_10028563 Ga0268266_100285635 144
324 3300028379 Ga0268266_10647462 Ga0268266_106474621 144
325 3300033180 Ga0307510_10011129 Ga0307510_100111299 144
326 3300037471 Ga0395905_0071917 Ga0395905_0071917_1220_1654 144
327 3300038443 Ga0395901_0088921 Ga0395901_0088921_1228_1662 144
328 3300039437 Ga0436365_1394541 Ga0436365_1394541_106_543 144
329 3300039437 Ga0436365_1539897 Ga0436365_1539897_137_574 144
330 3300046460 Ga0495638_0366263 Ga0495638_0366263_216_650 144
331 3300046500 Ga0495596_0349182 Ga0495596_0349182_117_551 144
332 3300046516 Ga0495628_0526830 Ga0495628_0526830_91_525 144
333 3300046536 Ga0495587_0285163 Ga0495587_0285163_411_845 144
334 3300046679 Ga0495623_0238640 Ga0495623_0238640_111_545 144
335 3300047469 Ga0495673_0206617 Ga0495673_0206617_134_568 144
336 3300048919 Ga0496116_0104835 Ga0496116_0104835_702_1139 144
337 3300048920 Ga0496117_0050653 Ga0496117_0050653_831_1265 144
338 3300048920 Ga0496117_0165289 Ga0496117_0165289_777_1214 144
339 3300048921 Ga0496118_0018352 Ga0496118_0018352_1527_1961 144
340 3300048921 Ga0496118_0035734 Ga0496118_0035734_1265_1699 144
341 3300048922 Ga0496119_0037240 Ga0496119_0037240_1148_1582 144
342 3300048922 Ga0496119_0048668 Ga0496119_0048668_894_1328 144
343 3300048922 Ga0496119_0058578 Ga0496119_0058578_1387_1821 144
344 3300048923 Ga0496120_0269523 Ga0496120_0269523_134_568 144
345 3300048924 Ga0496121_0001525 Ga0496121_0001525_27683_28117 144
346 3300048924 Ga0496121_0085939 Ga0496121_0085939_1827_2264 144
347 3300048924 Ga0496121_0565601 Ga0496121_0565601_54_491 144
348 3300048929 Ga0496126_0874033 Ga0496126_0874033_112_546 144
349 3300049460 Ga0495682_0195331 Ga0495682_0195331_49_483 144
350 3300050489 nmdc:mga03683_58498_c1 nmdc:mga03683_58498_c1_965_1399 144
351 3300050493 nmdc:mga0k408_273329_c1 nmdc:mga0k408_273329_c1_61_495 144
352 3300050496 nmdc:mga07m45_99476_c1 nmdc:mga07m45_99476_c1_985_1419 144
353 3300053084 Ga0495595_0508876 Ga0495595_0508876_55_489 144
354 3300053086 Ga0500578_0041351 Ga0500578_0041351_2426_2860 144
355 3300053093 Ga0500651_0056536 Ga0500651_0056536_537_971 144
356 3300053104 Ga0500556_0029460 Ga0500556_0029460_429_863 144
357 3300053116 Ga0500592_041883 Ga0500592_041883_214_648 144
358 3300053119 Ga0500595_005832 Ga0500595_005832_2423_2857 144
359 3300053130 Ga0500642_0083197 Ga0500642_0083197_734_1168 144
360 3300053139 Ga0500568_0115453 Ga0500568_0115453_120_554 144
361 3300053146 Ga0500588_0175589 Ga0500588_0175589_231_665 144
362 3300053151 Ga0500604_0092125 Ga0500604_0092125_272_706 144
363 3300053158 Ga0500627_0016445 Ga0500627_0016445_354_788 144
364 3300053158 Ga0500627_0038515 Ga0500627_0038515_62_496 144
365 3300006237 Ga0097621_100549798 Ga0097621_1005497982 145
366 3300047469 Ga0495673_0118238 Ga0495673_0118238_440_877 145
367 3300050493 nmdc:mga0k408_708906_c1 nmdc:mga0k408_708906_c1_101_538 145
368 3300005328 Ga0070676_10541668 Ga0070676_105416682 146
369 3300005355 Ga0070671_100976432 Ga0070671_1009764321 146
370 3300005435 Ga0070714_100019687 Ga0070714_1000196874 146
371 3300005436 Ga0070713_100042782 Ga0070713_1000427825 146
372 3300005437 Ga0070710_10004296 Ga0070710_100042965 146
373 3300005439 Ga0070711_100069627 Ga0070711_1000696275 146
374 3300005445 Ga0070708_101778090 Ga0070708_1017780901 146
375 3300005455 Ga0070663_100213913 Ga0070663_1002139132 146
376 3300005467 Ga0070706_101037429 Ga0070706_1010374291 146
377 3300005547 Ga0070693_100425058 Ga0070693_1004250581 146
378 3300005548 Ga0070665_100005416 Ga0070665_1000054165 146
379 3300005564 Ga0070664_100465619 Ga0070664_1004656192 146
380 3300005616 Ga0068852_100104864 Ga0068852_1001048642 146
381 3300006028 Ga0070717_10143799 Ga0070717_101437993 146
382 3300006038 Ga0075365_10282263 Ga0075365_102822632 146
383 3300006042 Ga0075368_10057590 Ga0075368_100575902 146
384 3300006048 Ga0075363_100002282 Ga0075363_1000022825 146
385 3300006051 Ga0075364_10550331 Ga0075364_105503312 146
386 3300006163 Ga0070715_10000876 Ga0070715_100008765 146
387 3300006173 Ga0070716_100002220 Ga0070716_1000022209 146
388 3300006175 Ga0070712_100095599 Ga0070712_1000955991 146
389 3300006178 Ga0075367_10152725 Ga0075367_101527251 146
390 3300006178 Ga0075367_10206156 Ga0075367_102061562 146
391 3300006353 Ga0075370_10474906 Ga0075370_104749062 146
392 3300006358 Ga0068871_100500593 Ga0068871_1005005932 146
393 3300009101 Ga0105247_10373738 Ga0105247_103737382 146
394 3300009551 Ga0105238_10676304 Ga0105238_106763041 146
395 3300013308 Ga0157375_10863399 Ga0157375_108633992 146
396 3300014325 Ga0163163_10503827 Ga0163163_105038272 146
397 3300025898 Ga0207692_10001396 Ga0207692_100013964 146
398 3300025905 Ga0207685_10011404 Ga0207685_100114044 146
399 3300025906 Ga0207699_10021630 Ga0207699_100216302 146
400 3300025915 Ga0207693_10002986 Ga0207693_100029865 146
401 3300025916 Ga0207663_10001112 Ga0207663_100011124 146
402 3300025924 Ga0207694_10270457 Ga0207694_102704572 146
403 3300025924 Ga0207694_10387726 Ga0207694_103877262 146
404 3300025928 Ga0207700_10054664 Ga0207700_100546641 146
405 3300025929 Ga0207664_10081551 Ga0207664_100815514 146
406 3300025939 Ga0207665_10000703 Ga0207665_1000070316 146
407 3300025945 Ga0207679_10406249 Ga0207679_104062492 146
408 3300025981 Ga0207640_10553339 Ga0207640_105533391 146
409 3300026067 Ga0207678_10156831 Ga0207678_101568312 146
410 3300026067 Ga0207678_10331066 Ga0207678_103310662 146
411 3300026078 Ga0207702_10665328 Ga0207702_106653281 146
412 3300026116 Ga0207674_11238141 Ga0207674_112381412 146
413 3300026142 Ga0207698_10253567 Ga0207698_102535672 146
414 3300027866 Ga0209813_10038085 Ga0209813_100380852 146
415 3300028379 Ga0268266_10001796 Ga0268266_1000179613 146
416 3300031247 Ga0265340_10037021 Ga0265340_100370212 146
417 3300031249 Ga0265339_10007436 Ga0265339_100074367 146
418 3300031548 Ga0307408_100168937 Ga0307408_1001689372 146
419 3300031616 Ga0307508_10127761 Ga0307508_101277612 146
420 3300031730 Ga0307516_10074830 Ga0307516_100748302 146
421 3300031824 Ga0307413_10750133 Ga0307413_107501331 146
422 3300031838 Ga0307518_10178990 Ga0307518_101789902 146
423 3300031911 Ga0307412_10059879 Ga0307412_100598792 146
424 3300031995 Ga0307409_101123334 Ga0307409_1011233342 146
425 3300033180 Ga0307510_10069015 Ga0307510_100690154 146
426 3300037471 Ga0395905_0185780 Ga0395905_0185780_115_585 146
427 3300037471 Ga0395905_1130254 Ga0395905_1130254_197_637 146
428 3300044684 Ga0466966_0000720 Ga0466966_0000720_16294_16752 146
429 3300044693 Ga0466961_0000136 Ga0466961_0000136_31868_32326 146
430 3300044719 Ga0466971_0639603 Ga0466971_0639603_48_506 146
431 3300045836 Ga0466958_0118098 Ga0466958_0118098_791_1249 146
432 3300046474 Ga0495605_0203080 Ga0495605_0203080_148_588 146
433 3300046506 Ga0495583_0096872 Ga0495583_0096872_426_866 146
434 3300046507 Ga0495606_0267711 Ga0495606_0267711_408_926 146
435 3300046512 Ga0495610_0320281 Ga0495610_0320281_30_548 146
436 3300046519 Ga0495632_0263489 Ga0495632_0263489_214_732 146
437 3300046524 Ga0495648_0065206 Ga0495648_0065206_1153_1593 146
438 3300046529 Ga0495652_0103154 Ga0495652_0103154_1782_2222 146
439 3300046538 Ga0495609_0324196 Ga0495609_0324196_131_589 146
440 3300046616 Ga0495668_0035543 Ga0495668_0035543_981_1424 146
441 3300046660 Ga0495625_0083627 Ga0495625_0083627_107_547 146
442 3300047320 Ga0495672_0415460 Ga0495672_0415460_52_570 146
443 3300047323 Ga0495683_0030240 Ga0495683_0030240_85_525 146
444 3300047472 Ga0495686_0402037 Ga0495686_0402037_117_557 146
445 3300048904 Ga0496101_0218386 Ga0496101_0218386_988_1431 146
446 3300048905 Ga0496102_0988114 Ga0496102_0988114_30_470 146
447 3300048910 Ga0496107_0153876 Ga0496107_0153876_455_895 146
448 3300048913 Ga0496110_1061011 Ga0496110_1061011_223_663 146
449 3300048917 Ga0496114_1210087 Ga0496114_1210087_82_525 146
450 3300048918 Ga0496115_0327108 Ga0496115_0327108_507_947 146
451 3300048924 Ga0496121_0382581 Ga0496121_0382581_87_605 146
452 3300048929 Ga0496126_0003212 Ga0496126_0003212_11262_11780 146
453 3300048929 Ga0496126_0524488 Ga0496126_0524488_49_489 146
454 3300048929 Ga0496126_0717016 Ga0496126_0717016_260_700 146
455 3300049460 Ga0495682_0055990 Ga0495682_0055990_664_1107 146
456 3300049460 Ga0495682_0075980 Ga0495682_0075980_598_1038 146
457 3300049569 Ga0501032_0000196 Ga0501032_0000196_26079_26567 146
458 3300049570 Ga0501033_0001104 Ga0501033_0001104_8667_9155 146
459 3300049571 Ga0501034_0001151 Ga0501034_0001151_26079_26567 146
460 3300049572 Ga0501036_0000323 Ga0501036_0000323_14679_15167 146
461 3300049573 Ga0501037_0001204 Ga0501037_0001204_8398_8886 146
462 3300049574 Ga0501038_0002973 Ga0501038_0002973_5084_5572 146
463 3300049574 Ga0501038_0798311 Ga0501038_0798311_139_627 146
464 3300049575 Ga0501039_0000705 Ga0501039_0000705_5619_6107 146
465 3300049576 Ga0501040_0285972 Ga0501040_0285972_470_910 146
466 3300049578 Ga0501042_0032152 Ga0501042_0032152_2527_3015 146
467 3300049579 Ga0501043_0000409 Ga0501043_0000409_12091_12579 146
468 3300049580 Ga0501046_0000181 Ga0501046_0000181_26079_26567 146
469 3300049581 Ga0501047_0000419 Ga0501047_0000419_8398_8886 146
470 3300049582 Ga0501048_0000057 Ga0501048_0000057_41226_41714 146
471 3300049583 Ga0501067_0000145 Ga0501067_0000145_26022_26510 146
472 3300049584 Ga0501068_0001512 Ga0501068_0001512_2969_3457 146
473 3300049585 Ga0501069_0001180 Ga0501069_0001180_2495_2983 146
474 3300049586 Ga0501070_0019419 Ga0501070_0019419_4576_5064 146
475 3300049586 Ga0501070_0024463 Ga0501070_0024463_356_844 146
476 3300049586 Ga0501070_0706112 Ga0501070_0706112_160_600 146
477 3300049587 Ga0501071_0026796 Ga0501071_0026796_1798_2286 146
478 3300049588 Ga0501072_0000643 Ga0501072_0000643_4367_4855 146
479 3300049589 Ga0501073_0000027 Ga0501073_0000027_27122_27610 146
480 3300049590 Ga0501074_0000081 Ga0501074_0000081_44467_44955 146
481 3300049741 Ga0501079_0013675 Ga0501079_0013675_3093_3581 146
482 3300049742 Ga0501080_0000883 Ga0501080_0000883_11078_11566 146
483 3300049742 Ga0501080_0538795 Ga0501080_0538795_403_891 146
484 3300049744 Ga0501083_0004050 Ga0501083_0004050_9832_10272 146
485 3300049822 Ga0501035_0003158 Ga0501035_0003158_5115_5603 146
486 3300049823 Ga0501044_0001511 Ga0501044_0001511_8526_9014 146
487 3300049824 Ga0501045_0007967 Ga0501045_0007967_635_1123 146
488 3300050490 nmdc:mga03n38_640_c1 nmdc:mga03n38_640_c1_1555_1995 146
489 3300050491 nmdc:mga00v17_486919_c1 nmdc:mga00v17_486919_c1_70_510 146
490 3300050494 nmdc:mga06z11_249403_c1 nmdc:mga06z11_249403_c1_77_520 146
491 3300050494 nmdc:mga06z11_43089_c1 nmdc:mga06z11_43089_c1_1505_1945 146
492 3300050494 nmdc:mga06z11_662578_c1 nmdc:mga06z11_662578_c1_155_598 146
493 3300050495 nmdc:mga04h51_46550_c1 nmdc:mga04h51_46550_c1_496_936 146
494 3300050496 nmdc:mga07m45_79576_c1 nmdc:mga07m45_79576_c1_186_626 146
495 3300053119 Ga0500595_006784 Ga0500595_006784_4173_4613 146
496 3300053119 Ga0500595_055447 Ga0500595_055447_633_1073 146
497 3300053163 Ga0500639_122094 Ga0500639_122094_442_894 146
498 3300054114 Ga0501084_0003425 Ga0501084_0003425_5174_5662 146
499 3300060353 Ga0501082_0007835 Ga0501082_0007835_3079_3567 146
500 3300002070 JGI24750J21931_1051047 JGI24750J21931_10510471 147
501 3300003659 JGI25404J52841_10019690 JGI25404J52841_100196902 147
502 3300005328 Ga0070676_10763867 Ga0070676_107638671 147
503 3300005331 Ga0070670_100684830 Ga0070670_1006848301 147
504 3300005334 Ga0068869_100191727 Ga0068869_1001917272 147
505 3300005335 Ga0070666_11132787 Ga0070666_111327871 147
506 3300005338 Ga0068868_100141546 Ga0068868_1001415462 147
507 3300005338 Ga0068868_100797478 Ga0068868_1007974781 147
508 3300005338 Ga0068868_100887071 Ga0068868_1008870711 147
509 3300005339 Ga0070660_100232836 Ga0070660_1002328361 147
510 3300005340 Ga0070689_100116708 Ga0070689_1001167082 147
511 3300005344 Ga0070661_101323105 Ga0070661_1013231051 147
512 3300005347 Ga0070668_100045692 Ga0070668_1000456922 147
513 3300005347 Ga0070668_100071734 Ga0070668_1000717343 147
514 3300005347 Ga0070668_100114651 Ga0070668_1001146512 147
515 3300005347 Ga0070668_100417909 Ga0070668_1004179092 147
516 3300005347 Ga0070668_100607425 Ga0070668_1006074252 147
517 3300005354 Ga0070675_100661982 Ga0070675_1006619822 147
518 3300005356 Ga0070674_100050603 Ga0070674_1000506033 147
519 3300005364 Ga0070673_100610327 Ga0070673_1006103272 147
520 3300005365 Ga0070688_100442997 Ga0070688_1004429971 147
521 3300005365 Ga0070688_100847227 Ga0070688_1008472271 147
522 3300005366 Ga0070659_100098791 Ga0070659_1000987911 147
523 3300005435 Ga0070714_101499796 Ga0070714_1014997961 147
524 3300005436 Ga0070713_100145429 Ga0070713_1001454292 147
525 3300005438 Ga0070701_10483351 Ga0070701_104833512 147
526 3300005441 Ga0070700_100022185 Ga0070700_1000221852 147
527 3300005441 Ga0070700_100699770 Ga0070700_1006997701 147
528 3300005444 Ga0070694_100790158 Ga0070694_1007901582 147
529 3300005455 Ga0070663_100052019 Ga0070663_1000520193 147
530 3300005455 Ga0070663_100063341 Ga0070663_1000633412 147
531 3300005455 Ga0070663_100083973 Ga0070663_1000839732 147
532 3300005455 Ga0070663_100088376 Ga0070663_1000883761 147
533 3300005455 Ga0070663_100103811 Ga0070663_1001038113 147
534 3300005456 Ga0070678_100029628 Ga0070678_1000296282 147
535 3300005456 Ga0070678_101322955 Ga0070678_1013229552 147
536 3300005457 Ga0070662_100583940 Ga0070662_1005839401 147
537 3300005458 Ga0070681_10123853 Ga0070681_101238534 147
538 3300005459 Ga0068867_100031241 Ga0068867_1000312412 147
539 3300005471 Ga0070698_100612347 Ga0070698_1006123472 147
540 3300005530 Ga0070679_100659573 Ga0070679_1006595732 147
541 3300005539 Ga0068853_100088438 Ga0068853_1000884381 147
542 3300005539 Ga0068853_100615527 Ga0068853_1006155272 147
543 3300005543 Ga0070672_100187893 Ga0070672_1001878931 147
544 3300005544 Ga0070686_100596444 Ga0070686_1005964442 147
545 3300005545 Ga0070695_100487693 Ga0070695_1004876931 147
546 3300005548 Ga0070665_100067150 Ga0070665_1000671502 147
547 3300005548 Ga0070665_100178369 Ga0070665_1001783692 147
548 3300005548 Ga0070665_100276754 Ga0070665_1002767542 147
549 3300005548 Ga0070665_101758782 Ga0070665_1017587821 147
550 3300005549 Ga0070704_100367501 Ga0070704_1003675012 147
551 3300005564 Ga0070664_101288438 Ga0070664_1012884382 147
552 3300005577 Ga0068857_100229566 Ga0068857_1002295662 147
553 3300005578 Ga0068854_100053678 Ga0068854_1000536783 147
554 3300005614 Ga0068856_100640009 Ga0068856_1006400091 147
555 3300005614 Ga0068856_100823095 Ga0068856_1008230952 147
556 3300005615 Ga0070702_100864815 Ga0070702_1008648151 147
557 3300005616 Ga0068852_100740967 Ga0068852_1007409672 147
558 3300005718 Ga0068866_10089935 Ga0068866_100899352 147
559 3300005719 Ga0068861_100046781 Ga0068861_1000467813 147
560 3300005719 Ga0068861_100486804 Ga0068861_1004868041 147
561 3300005719 Ga0068861_100810059 Ga0068861_1008100592 147
562 3300005834 Ga0068851_10007476 Ga0068851_100074764 147
563 3300005840 Ga0068870_10025221 Ga0068870_100252211 147
564 3300005842 Ga0068858_101064066 Ga0068858_1010640661 147
565 3300005843 Ga0068860_100020185 Ga0068860_1000201855 147
566 3300005843 Ga0068860_100182832 Ga0068860_1001828322 147
567 3300005844 Ga0068862_100085607 Ga0068862_1000856073 147
568 3300005844 Ga0068862_100151664 Ga0068862_1001516642 147
569 3300005844 Ga0068862_100559965 Ga0068862_1005599652 147
570 3300005844 Ga0068862_100567472 Ga0068862_1005674722 147
571 3300005844 Ga0068862_100711904 Ga0068862_1007119041 147
572 3300005937 Ga0081455_10145350 Ga0081455_101453502 147
573 3300005981 Ga0081538_10096616 Ga0081538_100966162 147
574 3300005983 Ga0081540_1006920 Ga0081540_10069207 147
575 3300005983 Ga0081540_1009239 Ga0081540_10092394 147
576 3300005983 Ga0081540_1017740 Ga0081540_10177404 147
577 3300005983 Ga0081540_1029072 Ga0081540_10290722 147
578 3300006038 Ga0075365_10033503 Ga0075365_100335034 147
579 3300006038 Ga0075365_10928355 Ga0075365_109283551 147
580 3300006048 Ga0075363_100714333 Ga0075363_1007143331 147
581 3300006051 Ga0075364_10556531 Ga0075364_105565312 147
582 3300006175 Ga0070712_100811953 Ga0070712_1008119532 147
583 3300006178 Ga0075367_10012050 Ga0075367_100120501 147
584 3300006178 Ga0075367_10073711 Ga0075367_100737113 147
585 3300006237 Ga0097621_100831619 Ga0097621_1008316192 147
586 3300006237 Ga0097621_101405606 Ga0097621_1014056061 147
587 3300006353 Ga0075370_10109857 Ga0075370_101098571 147
588 3300006353 Ga0075370_10373789 Ga0075370_103737891 147
589 3300006353 Ga0075370_10389353 Ga0075370_103893532 147
590 3300006358 Ga0068871_101335164 Ga0068871_1013351641 147
591 3300006880 Ga0075429_100656618 Ga0075429_1006566181 147
592 3300009011 Ga0105251_10376511 Ga0105251_103765112 147
593 3300009092 Ga0105250_10330281 Ga0105250_103302811 147
594 3300009093 Ga0105240_11749686 Ga0105240_117496861 147
595 3300009094 Ga0111539_10065388 Ga0111539_100653883 147
596 3300009098 Ga0105245_10423459 Ga0105245_104234591 147
597 3300009098 Ga0105245_11213268 Ga0105245_112132681 147
598 3300009101 Ga0105247_10002364 Ga0105247_1000236410 147
599 3300009101 Ga0105247_10327813 Ga0105247_103278131 147
600 3300009101 Ga0105247_11382191 Ga0105247_113821911 147
601 3300009147 Ga0114129_10190202 Ga0114129_101902022 147
602 3300009148 Ga0105243_10036133 Ga0105243_100361332 147
603 3300009148 Ga0105243_11468920 Ga0105243_114689201 147
604 3300009174 Ga0105241_10060020 Ga0105241_100600202 147
605 3300009174 Ga0105241_11342152 Ga0105241_113421521 147
606 3300009176 Ga0105242_10100161 Ga0105242_101001612 147
607 3300009176 Ga0105242_11266338 Ga0105242_112663382 147
608 3300009177 Ga0105248_10685392 Ga0105248_106853921 147
609 3300009545 Ga0105237_10006596 Ga0105237_100065966 147
610 3300009545 Ga0105237_10382696 Ga0105237_103826962 147
611 3300009551 Ga0105238_10119909 Ga0105238_101199091 147
612 3300009553 Ga0105249_10022801 Ga0105249_100228014 147
613 3300010375 Ga0105239_10466331 Ga0105239_104663312 147
614 3300010375 Ga0105239_12075194 Ga0105239_120751941 147
615 3300011119 Ga0105246_10008882 Ga0105246_100088821 147
616 3300012507 Ga0157342_1065633 Ga0157342_10656331 147
617 3300013104 Ga0157370_10119131 Ga0157370_101191314 147
618 3300013297 Ga0157378_10180184 Ga0157378_101801842 147
619 3300013306 Ga0163162_10056995 Ga0163162_100569953 147
620 3300013306 Ga0163162_10761920 Ga0163162_107619201 147
621 3300013306 Ga0163162_11050788 Ga0163162_110507881 147
622 3300013306 Ga0163162_11391809 Ga0163162_113918091 147
623 3300013307 Ga0157372_10791173 Ga0157372_107911732 147
624 3300013308 Ga0157375_11945064 Ga0157375_119450641 147
625 3300013308 Ga0157375_12772073 Ga0157375_127720731 147
626 3300014325 Ga0163163_10581913 Ga0163163_105819131 147
627 3300014326 Ga0157380_10321470 Ga0157380_103214702 147
628 3300014326 Ga0157380_10368038 Ga0157380_103680382 147
629 3300014326 Ga0157380_11009685 Ga0157380_110096852 147
630 3300014969 Ga0157376_11115185 Ga0157376_111151851 147
631 3300017792 Ga0163161_10056068 Ga0163161_100560682 147
632 3300021384 Ga0213876_10001108 Ga0213876_1000110810 147
633 3300025295 Ga0209564_1038632 Ga0209564_10386322 147
634 3300025297 Ga0209758_1041827 Ga0209758_10418271 147
635 3300025315 Ga0207697_10061062 Ga0207697_100610621 147
636 3300025321 Ga0207656_10013890 Ga0207656_100138905 147
637 3300025899 Ga0207642_10113408 Ga0207642_101134082 147
638 3300025900 Ga0207710_10236786 Ga0207710_102367862 147
639 3300025903 Ga0207680_10142121 Ga0207680_101421211 147
640 3300025907 Ga0207645_10223884 Ga0207645_102238842 147
641 3300025908 Ga0207643_10181684 Ga0207643_101816842 147
642 3300025908 Ga0207643_10327286 Ga0207643_103272861 147
643 3300025911 Ga0207654_10021180 Ga0207654_100211802 147
644 3300025912 Ga0207707_10141119 Ga0207707_101411193 147
645 3300025913 Ga0207695_10002042 Ga0207695_1000204228 147
646 3300025914 Ga0207671_10024690 Ga0207671_100246904 147
647 3300025917 Ga0207660_10005383 Ga0207660_100053833 147
648 3300025919 Ga0207657_10116605 Ga0207657_101166053 147
649 3300025920 Ga0207649_11400429 Ga0207649_114004291 147
650 3300025921 Ga0207652_10899432 Ga0207652_108994322 147
651 3300025922 Ga0207646_11290971 Ga0207646_112909711 147
652 3300025923 Ga0207681_10297862 Ga0207681_102978622 147
653 3300025923 Ga0207681_10995163 Ga0207681_109951632 147
654 3300025924 Ga0207694_10001415 Ga0207694_100014153 147
655 3300025924 Ga0207694_10298106 Ga0207694_102981062 147
656 3300025925 Ga0207650_10324969 Ga0207650_103249692 147
657 3300025929 Ga0207664_10857942 Ga0207664_108579421 147
658 3300025931 Ga0207644_10226888 Ga0207644_102268882 147
659 3300025932 Ga0207690_10012826 Ga0207690_100128262 147
660 3300025933 Ga0207706_10060816 Ga0207706_100608164 147
661 3300025937 Ga0207669_11020395 Ga0207669_110203952 147
662 3300025940 Ga0207691_10047902 Ga0207691_100479021 147
663 3300025940 Ga0207691_11429772 Ga0207691_114297721 147
664 3300025941 Ga0207711_10758256 Ga0207711_107582561 147
665 3300025942 Ga0207689_10209278 Ga0207689_102092781 147
666 3300025942 Ga0207689_10211999 Ga0207689_102119992 147
667 3300025945 Ga0207679_11185763 Ga0207679_111857631 147
668 3300025949 Ga0207667_10011130 Ga0207667_100111301 147
669 3300025960 Ga0207651_10944470 Ga0207651_109444702 147
670 3300025960 Ga0207651_11064643 Ga0207651_110646431 147
671 3300025961 Ga0207712_10106344 Ga0207712_101063442 147
672 3300025972 Ga0207668_10099508 Ga0207668_100995082 147
673 3300025972 Ga0207668_10170030 Ga0207668_101700302 147
674 3300025972 Ga0207668_10182308 Ga0207668_101823081 147
675 3300026023 Ga0207677_10302867 Ga0207677_103028672 147
676 3300026023 Ga0207677_10715139 Ga0207677_107151392 147
677 3300026023 Ga0207677_11289134 Ga0207677_112891341 147
678 3300026035 Ga0207703_10095078 Ga0207703_100950782 147
679 3300026041 Ga0207639_10252278 Ga0207639_102522782 147
680 3300026067 Ga0207678_10011116 Ga0207678_100111163 147
681 3300026067 Ga0207678_10256820 Ga0207678_102568202 147
682 3300026067 Ga0207678_10405442 Ga0207678_104054422 147
683 3300026067 Ga0207678_10787199 Ga0207678_107871991 147
684 3300026075 Ga0207708_10057294 Ga0207708_100572942 147
685 3300026075 Ga0207708_10498592 Ga0207708_104985922 147
686 3300026078 Ga0207702_10000003 Ga0207702_1000000314 147
687 3300026089 Ga0207648_10014415 Ga0207648_100144154 147
688 3300026116 Ga0207674_10740130 Ga0207674_107401301 147
689 3300026118 Ga0207675_100041106 Ga0207675_1000411062 147
690 3300026118 Ga0207675_100276616 Ga0207675_1002766162 147
691 3300026118 Ga0207675_100546237 Ga0207675_1005462372 147
692 3300026121 Ga0207683_10041381 Ga0207683_100413813 147
693 3300026121 Ga0207683_10560401 Ga0207683_105604012 147
694 3300026121 Ga0207683_11770198 Ga0207683_117701981 147
695 3300027866 Ga0209813_10219759 Ga0209813_102197591 147
696 3300027907 Ga0207428_10083833 Ga0207428_100838332 147
697 3300028379 Ga0268266_10006533 Ga0268266_100065332 147
698 3300028379 Ga0268266_10098652 Ga0268266_100986522 147
699 3300028379 Ga0268266_10237638 Ga0268266_102376382 147
700 3300028379 Ga0268266_10551735 Ga0268266_105517352 147
701 3300028380 Ga0268265_10118620 Ga0268265_101186202 147
702 3300028380 Ga0268265_10216649 Ga0268265_102166492 147
703 3300028380 Ga0268265_11003586 Ga0268265_110035861 147
704 3300028381 Ga0268264_10167444 Ga0268264_101674442 147
705 3300028381 Ga0268264_10506443 Ga0268264_105064432 147
706 3300028794 Ga0307515_10786597 Ga0307515_107865971 147
707 3300031235 Ga0265330_10002550 Ga0265330_100025505 147
708 3300031235 Ga0265330_10015820 Ga0265330_100158204 147
709 3300031456 Ga0307513_10234817 Ga0307513_102348172 147
710 3300031456 Ga0307513_10342522 Ga0307513_103425222 147
711 3300031507 Ga0307509_10040531 Ga0307509_100405313 147
712 3300031507 Ga0307509_10319157 Ga0307509_103191572 147
713 3300031548 Ga0307408_100279318 Ga0307408_1002793182 147
714 3300031616 Ga0307508_10165454 Ga0307508_101654541 147
715 3300031730 Ga0307516_10078356 Ga0307516_100783563 147
716 3300031731 Ga0307405_10488682 Ga0307405_104886822 147
717 3300031824 Ga0307413_10197700 Ga0307413_101977002 147
718 3300031852 Ga0307410_10217170 Ga0307410_102171702 147
719 3300031852 Ga0307410_10838822 Ga0307410_108388222 147
720 3300031901 Ga0307406_10226633 Ga0307406_102266332 147
721 3300031901 Ga0307406_10854271 Ga0307406_108542711 147
722 3300031911 Ga0307412_10079025 Ga0307412_100790252 147
723 3300031911 Ga0307412_10178719 Ga0307412_101787192 147
724 3300031995 Ga0307409_100523584 Ga0307409_1005235842 147
725 3300031995 Ga0307409_101638543 Ga0307409_1016385431 147
726 3300032002 Ga0307416_100525496 Ga0307416_1005254962 147
727 3300032002 Ga0307416_100602952 Ga0307416_1006029522 147
728 3300032004 Ga0307414_10088792 Ga0307414_100887922 147
729 3300032005 Ga0307411_11767693 Ga0307411_117676931 147
730 3300032005 Ga0307411_11877617 Ga0307411_118776171 147
731 3300033180 Ga0307510_10018329 Ga0307510_1001832911 147
732 3300033180 Ga0307510_10098798 Ga0307510_100987982 147
733 3300035207 Ga0373942_0035731 Ga0373942_0035731_95_568 147
734 3300039437 Ga0436365_0122301 Ga0436365_0122301_7229_7672 147
735 3300039450 Ga0436363_1129876 Ga0436363_1129876_376_819 147
736 3300041452 Ga0451793_1818322 Ga0451793_1818322_551_1042 147
737 3300041486 Ga0451807_1865263 Ga0451807_1865263_68_511 147
738 3300041512 Ga0451853_1431665 Ga0451853_1431665_327_770 147
739 3300041997 Ga0439431_0047286 Ga0439431_0047286_235_756 147
740 3300046452 Ga0495617_051855 Ga0495617_051855_373_894 147
741 3300046452 Ga0495617_270213 Ga0495617_270213_18_461 147
742 3300046455 Ga0495603_0022671 Ga0495603_0022671_2637_3080 147
743 3300046455 Ga0495603_0061397 Ga0495603_0061397_1038_1559 147
744 3300046455 Ga0495603_0551565 Ga0495603_0551565_157_648 147
745 3300046459 Ga0495629_0055561 Ga0495629_0055561_2010_2453 147
746 3300046460 Ga0495638_0137016 Ga0495638_0137016_159_662 147
747 3300046462 Ga0495651_0086807 Ga0495651_0086807_1690_2133 147
748 3300046474 Ga0495605_0178681 Ga0495605_0178681_64_507 147
749 3300046475 Ga0495639_0087029 Ga0495639_0087029_384_905 147
750 3300046491 Ga0495584_0070687 Ga0495584_0070687_119_640 147
751 3300046491 Ga0495584_0315369 Ga0495584_0315369_286_729 147
752 3300046492 Ga0495585_0036277 Ga0495585_0036277_32_493 147
753 3300046499 Ga0495594_0028295 Ga0495594_0028295_2257_2700 147
754 3300046499 Ga0495594_0436328 Ga0495594_0436328_280_723 147
755 3300046506 Ga0495583_0143150 Ga0495583_0143150_398_919 147
756 3300046507 Ga0495606_0284679 Ga0495606_0284679_122_565 147
757 3300046507 Ga0495606_0289786 Ga0495606_0289786_30_533 147
758 3300046512 Ga0495610_0307151 Ga0495610_0307151_59_580 147
759 3300046513 Ga0495616_0471223 Ga0495616_0471223_19_462 147
760 3300046515 Ga0495620_0079650 Ga0495620_0079650_578_1021 147
761 3300046518 Ga0495631_0354160 Ga0495631_0354160_151_594 147
762 3300046520 Ga0495637_0265153 Ga0495637_0265153_34_495 147
763 3300046523 Ga0495644_0233770 Ga0495644_0233770_42_563 147
764 3300046524 Ga0495648_0044716 Ga0495648_0044716_181_654 147
765 3300046531 Ga0495665_0200725 Ga0495665_0200725_377_898 147
766 3300046538 Ga0495609_0441646 Ga0495609_0441646_31_492 147
767 3300046539 Ga0495621_0079926 Ga0495621_0079926_51_494 147
768 3300046542 Ga0495597_0145070 Ga0495597_0145070_419_862 147
769 3300046557 Ga0495622_0293396 Ga0495622_0293396_84_605 147
770 3300046558 Ga0495633_0139985 Ga0495633_0139985_144_587 147
771 3300046615 Ga0495656_0012433 Ga0495656_0012433_2274_2717 147
772 3300046615 Ga0495656_0080275 Ga0495656_0080275_100_543 147
773 3300046615 Ga0495656_0094907 Ga0495656_0094907_162_605 147
774 3300046615 Ga0495656_0116191 Ga0495656_0116191_151_594 147
775 3300046616 Ga0495668_0201223 Ga0495668_0201223_482_1003 147
776 3300046616 Ga0495668_0278872 Ga0495668_0278872_87_530 147
777 3300046648 Ga0495611_0439127 Ga0495611_0439127_68_511 147
778 3300046648 Ga0495611_0492072 Ga0495611_0492072_39_482 147
779 3300046660 Ga0495625_0525645 Ga0495625_0525645_31_534 147
780 3300046663 Ga0495635_0135785 Ga0495635_0135785_154_597 147
781 3300046663 Ga0495635_0284145 Ga0495635_0284145_448_891 147
782 3300046664 Ga0495659_0004777 Ga0495659_0004777_1894_2337 147
783 3300046664 Ga0495659_0061185 Ga0495659_0061185_285_728 147
784 3300046684 Ga0495669_0027733 Ga0495669_0027733_1424_1867 147
785 3300046684 Ga0495669_0051935 Ga0495669_0051935_782_1225 147
786 3300046794 Ga0495589_0144672 Ga0495589_0144672_359_802 147
787 3300046809 Ga0495600_0156354 Ga0495600_0156354_730_1173 147
788 3300047315 Ga0495581_0112266 Ga0495581_0112266_530_973 147
789 3300047315 Ga0495581_0298185 Ga0495581_0298185_25_546 147
790 3300047315 Ga0495581_0762835 Ga0495581_0762835_37_480 147
791 3300047320 Ga0495672_0338751 Ga0495672_0338751_52_495 147
792 3300047321 Ga0495676_0980734 Ga0495676_0980734_66_509 147
793 3300047445 Ga0495677_0062877 Ga0495677_0062877_721_1164 147
794 3300047469 Ga0495673_0131519 Ga0495673_0131519_408_911 147
795 3300047470 Ga0495681_0040040 Ga0495681_0040040_1781_2242 147
796 3300047673 Ga0495593_0069686 Ga0495593_0069686_387_830 147
797 3300048088 Ga0495602_0364194 Ga0495602_0364194_391_834 147
798 3300048903 Ga0496100_0874408 Ga0496100_0874408_67_510 147
799 3300048903 Ga0496100_1140196 Ga0496100_1140196_82_585 147
800 3300048905 Ga0496102_0201366 Ga0496102_0201366_1255_1776 147
801 3300048905 Ga0496102_0530193 Ga0496102_0530193_453_896 147
802 3300048906 Ga0496103_0368634 Ga0496103_0368634_321_764 147
803 3300048906 Ga0496103_0916114 Ga0496103_0916114_16_459 147
804 3300048909 Ga0496106_0001280 Ga0496106_0001280_10841_11284 147
805 3300048912 Ga0496109_0531987 Ga0496109_0531987_341_784 147
806 3300048913 Ga0496110_0327980 Ga0496110_0327980_53_496 147
807 3300048914 Ga0496111_0987228 Ga0496111_0987228_118_561 147
808 3300048918 Ga0496115_1248126 Ga0496115_1248126_33_506 147
809 3300048919 Ga0496116_0020084 Ga0496116_0020084_3738_4181 147
810 3300048920 Ga0496117_0008319 Ga0496117_0008319_1962_2405 147
811 3300048921 Ga0496118_0001458 Ga0496118_0001458_26870_27313 147
812 3300048922 Ga0496119_0465018 Ga0496119_0465018_39_560 147
813 3300048923 Ga0496120_0377552 Ga0496120_0377552_166_609 147
814 3300048924 Ga0496121_0000146 Ga0496121_0000146_70732_71175 147
815 3300048924 Ga0496121_0000254 Ga0496121_0000254_13806_14249 147
816 3300048924 Ga0496121_0078360 Ga0496121_0078360_2127_2588 147
817 3300048927 Ga0496124_0009204 Ga0496124_0009204_2743_3186 147
818 3300048927 Ga0496124_0138488 Ga0496124_0138488_1221_1712 147
819 3300048928 Ga0496125_0017943 Ga0496125_0017943_4753_5196 147
820 3300048928 Ga0496125_0291557 Ga0496125_0291557_292_735 147
821 3300048929 Ga0496126_0015212 Ga0496126_0015212_4891_5334 147
822 3300048929 Ga0496126_0043920 Ga0496126_0043920_144_587 147
823 3300048929 Ga0496126_0102678 Ga0496126_0102678_67_558 147
824 3300048929 Ga0496126_0375826 Ga0496126_0375826_236_679 147
825 3300049460 Ga0495682_0053776 Ga0495682_0053776_121_642 147
826 3300049572 Ga0501036_1626208 Ga0501036_1626208_49_492 147
827 3300049576 Ga0501040_0197847 Ga0501040_0197847_736_1179 147
828 3300049577 Ga0501041_0174158 Ga0501041_0174158_644_1087 147
829 3300049579 Ga0501043_1265979 Ga0501043_1265979_20_463 147
830 3300049582 Ga0501048_1089564 Ga0501048_1089564_66_509 147
831 3300049587 Ga0501071_0173294 Ga0501071_0173294_450_893 147
832 3300050492 nmdc:mga0yw44_23931_c1 nmdc:mga0yw44_23931_c1_2966_3409 147
833 3300050494 nmdc:mga06z11_54839_c1 nmdc:mga06z11_54839_c1_452_895 147
834 3300050495 nmdc:mga04h51_239633_c1 nmdc:mga04h51_239633_c1_170_613 147
835 3300050496 nmdc:mga07m45_15864_c1 nmdc:mga07m45_15864_c1_1089_1580 147
836 3300050496 nmdc:mga07m45_221268_c1 nmdc:mga07m45_221268_c1_235_678 147
837 3300050507 nmdc:mga05p37_14625_c1 nmdc:mga05p37_14625_c1_5528_5971 147
838 3300050508 nmdc:mga09592_526452_c1 nmdc:mga09592_526452_c1_507_950 147
839 3300050511 nmdc:mga08y16_217968_c1 nmdc:mga08y16_217968_c1_211_654 147
840 3300050516 nmdc:mga0sz30_278514_c1 nmdc:mga0sz30_278514_c1_45_488 147
841 3300050516 nmdc:mga0sz30_295729_c1 nmdc:mga0sz30_295729_c1_10_471 147
842 3300050516 nmdc:mga0sz30_6950_c1 nmdc:mga0sz30_6950_c1_36_479 147
843 3300053080 Ga0500635_0013637 Ga0500635_0013637_185_628 147
844 3300053086 Ga0500578_0267537 Ga0500578_0267537_270_773 147
845 3300053087 Ga0500643_106288 Ga0500643_106288_119_562 147
846 3300053090 Ga0500646_0125244 Ga0500646_0125244_14_457 147
847 3300053108 Ga0500562_061930 Ga0500562_061930_21_524 147
848 3300053119 Ga0500595_002430 Ga0500595_002430_7882_8325 147
849 3300053119 Ga0500595_011118 Ga0500595_011118_1734_2225 147
850 3300053121 Ga0500607_110341 Ga0500607_110341_63_506 147
851 3300053139 Ga0500568_0028239 Ga0500568_0028239_1026_1469 147
852 3300053142 Ga0500577_0000809 Ga0500577_0000809_4780_5241 147
853 3300053145 Ga0500586_004877 Ga0500586_004877_1430_1873 147
854 3300053146 Ga0500588_0243282 Ga0500588_0243282_59_580 147
855 3300053150 Ga0500603_000706 Ga0500603_000706_3859_4302 147
856 3300053158 Ga0500627_0222401 Ga0500627_0222401_46_567 147
857 3300053161 Ga0500634_0116538 Ga0500634_0116538_80_541 147
858 3300053161 Ga0500634_0260753 Ga0500634_0260753_203_646 147
859 3300053177 Ga0500636_0077223 Ga0500636_0077223_602_1045 147
860 3300053177 Ga0500636_0109550 Ga0500636_0109550_1061_1504 147
861 3300053178 Ga0500637_0001513 Ga0500637_0001513_6923_7366 147
862 3300060353 Ga0501082_1310081 Ga0501082_1310081_128_571 147
863 3300061734 Ga0530510_0589998 Ga0530510_0589998_384_827 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09917

DUF2147

Uncharacterized protein conserved in bacteria (DUF2147)

28

140

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4inn-assembly1.cif.gz_A protein hp1028 from the human pathogen helicobacter pylori belongs to the lipocalin family 0.8302 27 145
6g2i-assembly1.cif.gz_B filament of acetyl-coa carboxylase and brct domains of brca1 (acc-brct) at 5.9 a resolution 0.7168 99 130
2qmi-assembly1.cif.gz_E structure of the octameric penicillin-binding protein homologue from pyrococcus abyssi 0.5983 28 142
8f0y-assembly1.cif.gz_A lipocalin-like milk protein-1 0.588 29 144
6czg-assembly2.cif.gz_B structure of a redesigned beta barrel, b11l5f_lgl 0.5828 29 145
ID Description Score Start End Superfamily
4innA00 Mainly Beta;Beta Barrel;Lipocalin; 0.8237 27 145 2.40.128.520
af_Q4E0Z5_1_101_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.746 90 121 3.30.200.20
4innA00 Mainly Beta;Beta Barrel;Lipocalin; 0.6842 27 145 2.40.128.520
af_Q8IHP1_1152_1236_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6617 90 123 3.30.200.20
2qmiA02 Mainly Beta;Beta Barrel;Lipocalin;Pab87 octamerisation domain 0.6363 28 142 2.40.128.210
ID Description Score Start End GO Terms
AF-A0A0Q7U1A6-F1-model_v4 DUF2147 domain-containing protein 0.967 23 145
AF-A0A1P9X4K1-F1-model_v4 SIGNAL peptide protein 0.9595 29 145
AF-A0A6L8W6K7-F1-model_v4 DUF2147 domain-containing protein 0.9587 26 145
AF-A0A346A196-F1-model_v4 DUF2147 domain-containing protein 0.9564 33 146
AF-D2QBY8-F1-model_v4 DUF2147 domain-containing protein 0.9454 29 144

Feature Viewer

pLDDT pTM Quality
87.76 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map