F484014

General Info

Members Datasets Scaffolds Average Seq Length
865 681 1730 334

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2952252522|2952255548
Length 355
Sequence PRPSPISASVDFDAQGVQHGFLKLPISVDESAWGAVMIPITVVANGEGPTALLTGGNHGDEYEGITALMKLANSLEAGDVRGRVIIVPMMNLPAAEAGKRTSPLDGGNLNRSFPGDPDGSVTSQIADYFTRVLVPMCDVALDLHSGGRTLDIVPFAAAHRLDDLNQERASLGGAVAFGAPYAMMMFELDATRLYDTAVESQGKTFVTTELGGGGTSTPASLAISERGVRNFLIHYGLIDGELETADEPMIYVDMPDASCYVQSEHAGLLELTVSLGEMVKQGDVLARIYDMTRTGTDPVEYRAQRDGVLIARRFPAKVGMGDTIAVVAEVVQSLERDSFSTPKPVGALSTPKPVE

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
63 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
64 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
100 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
251 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
252 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 2952252522 Salinicola sp. DM10 Isolate Unclassified
259 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
260 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
261 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
262 2508501050 Microvirga lupini Lut6 Isolate Nodule
263 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
264 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
265 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
266 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
267 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
268 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
269 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
270 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
271 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
272 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
273 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
274 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
275 2512875024
276 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
277 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
278 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
279 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
280 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
281 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
282 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
283 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
284 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
285 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
286 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
287 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
288 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
289 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
290 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
291 2516143018 Ensifer sp. BR816 Isolate Nodule
292 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
293 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
294 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
295 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
296 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
297 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
298 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
299 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
300 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
301 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
302 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
303 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
304 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
305 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
306 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
307 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
308 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
309 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
310 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
311 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
312 2643221557 Ensifer sp. Root558 Isolate Unclassified
313 2643221607 Rhizobium sp. Root73 Isolate Unclassified
314 2643221610 Ensifer sp. Root74 Isolate Unclassified
315 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
316 2643221668 Ensifer sp. Root423 Isolate Unclassified
317 2643221675 Ensifer sp. Root1298 Isolate Unclassified
318 2643221680 Ensifer sp. Root1312 Isolate Unclassified
319 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
320 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
321 2643221726 Ensifer sp. Root954 Isolate Unclassified
322 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
323 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
324 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
325 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
326 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
327 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
328 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
329 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
330 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
331 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
332 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
333 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
334 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
335 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
336 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
337 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
338 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
339 2791355267 Rhizobium sp. L18 Isolate Nodule
340 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
341 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
342 2802429633 Rhizobium anhuiense J3 Isolate Nodule
343 2802429634 Rhizobium anhuiense S10 Isolate Nodule
344 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
345 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
346 2802429637 Rhizobium anhuiense C15 Isolate Nodule
347 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
348 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
349 2818991450 Burkholderia sp. 604 Isolate Unclassified
350 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
351 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
352 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
353 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
354 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
355 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
356 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
357 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
358 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
359 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
360 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
361 2854911287 Brucella lupini LUP21 Isolate Unclassified
362 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
363 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
364 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
365 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
366 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
367 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
368 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
369 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
370 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
371 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
372 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
373 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
374 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
375 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
376 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
377 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
378 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
379 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
380 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
381 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
382 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
383 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
384 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
385 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
386 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
387 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
388 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
389 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
390 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
391 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
392 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
393 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
394 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
395 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
396 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
397 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
398 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
399 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
400 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
401 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
402 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
403 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
404 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
405 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
406 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
407 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
408 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
409 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
410 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
411 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
412 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
413 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
414 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
415 2904564687 Burkholderia sp. 571 Isolate Unclassified
416 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
417 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
418 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
419 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
420 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
421 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
422 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
423 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
424 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
425 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
426 2909042592 Labrys sp. LIt4 Isolate Nodule
427 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
428 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
429 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
430 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
431 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
432 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
433 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
434 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
435 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
436 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
437 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
438 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
439 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
440 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
441 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
442 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
443 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
444 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
445 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
446 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
447 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
448 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
449 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
450 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
451 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
452 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
453 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
454 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
455 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
456 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
457 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
458 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
459 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
460 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
461 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
462 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
463 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
464 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
465 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
466 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
467 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
468 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
469 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
470 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
471 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
472 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
473 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
474 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
475 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
476 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
477 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
478 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
479 2928163908 Burkholderia sp. 567 Isolate Unclassified
480 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
481 2928536128 Burkholderia sola 565 Isolate Unclassified
482 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
483 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
484 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
485 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
486 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
487 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
488 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
489 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
490 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
491 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
492 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
493 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
494 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
495 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
496 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
497 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
498 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
499 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
500 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
501 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
502 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
503 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
504 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
505 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
506 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
507 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
508 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
509 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
510 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
511 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
512 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
513 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
514 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
515 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
516 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
517 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
518 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
519 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
520 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
521 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
522 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
523 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
524 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
525 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
526 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
527 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
528 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
529 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
530 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
531 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
532 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
533 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
534 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
535 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
536 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
537 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
538 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
539 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
540 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
541 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
542 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
543 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
544 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
545 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
546 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
547 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
548 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
549 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
550 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
551 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
552 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
553 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
554 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
555 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
556 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
557 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
558 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
559 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
560 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
561 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
562 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
563 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
564 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
565 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
566 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
567 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
568 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
569 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
570 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
571 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
572 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
573 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
574 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
575 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
576 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
577 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
578 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
579 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
580 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
581 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
582 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
583 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
584 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
585 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
586 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
587 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
588 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
589 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
590 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
591 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
592 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
593 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
594 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
595 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
596 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
597 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
598 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
599 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
600 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
601 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
602 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
603 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
604 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
605 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
606 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
607 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
608 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
609 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
610 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
611 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
612 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
613 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
614 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
615 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
616 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
617 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
618 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
619 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
620 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
621 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
622 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
623 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
624 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
625 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
626 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
627 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
628 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
629 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
630 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
631 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
632 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
633 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
634 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
635 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
636 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
637 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
638 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
639 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
640 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
641 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
642 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
643 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
644 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
645 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
646 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
647 3004167301 Mesorhizobium loti 582 Isolate Unclassified
648 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
649 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
650 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
651 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
652 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
653 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
654 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
655 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
656 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
657 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
658 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
659 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
660 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
661 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
662 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
663 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
664 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
665 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
666 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
667 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
668 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
669 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
670 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
671 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
672 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
673 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
674 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
675 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
676 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
677 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
678 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
679 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
680 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
681 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 50.52
Metatranscriptomes 0.12
Isolates 49.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.55
Nodule 39.88
Rhizoplane 3.24
Rhizosphere 36.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000182 3300001989 Bacteria 21007
2 JGI24739J22299_10000607 3300001989 Bacteria 12939
3 JGI24739J22299_10010426 3300001989 Bacteria 3451
4 JGI24735J21928_10000090 3300002067 Bacteria 34657
5 JGI24735J21928_10003930 3300002067 Bacteria 5031
6 JGI24735J21928_10035655 3300002067 Bacteria 1461
7 JGI24738J21930_10000351 3300002075 Bacteria 12727
8 JGI25151J46595_10002908 3300003187 Bacteria 9814
9 rootH1_10086515 3300003323 Bacteria 4133
10 JGI25160J50197_1001489 3300003354 Bacteria 11639
11 JGI25160J50197_1011650 3300003354 Bacteria 3100
12 JGI25161J50226_1002195 3300003374 Bacteria 5193
13 Ga0055533_1001478 3300003756 Bacteria 6187
14 Ga0055532_1000327 3300003758 Bacteria 26545
15 Ga0055527_1000150 3300003760 Bacteria 49156
16 Ga0055527_1007753 3300003760 Bacteria 1301
17 Ga0055535_1000202 3300003761 Bacteria 63538
18 Ga0055542_1000237 3300003762 Bacteria 63538
19 Ga0055529_1000257 3300003763 Bacteria 63538
20 Ga0055526_1013097 3300003771 Bacteria 3542
21 Ga0055524_1000517 3300003775 Bacteria 29782
22 Ga0055528_1000858 3300003790 Bacteria 20639
23 Ga0055528_1000982 3300003790 Bacteria 18925
24 Ga0055540_1000096 3300003792 Bacteria 96969
25 Ga0055540_1023505 3300003792 Bacteria 1551
26 Ga0055531_10038529 3300003794 Bacteria 1433
27 Ga0055543_1002427 3300004625 Bacteria 6178
28 Ga0065165_1003243 3300005262 Bacteria 11788
29 Ga0070658_10016807 3300005327 Bacteria 5857
30 Ga0070658_10060702 3300005327 Bacteria 3080
31 Ga0070658_10089396 3300005327 Bacteria 2536
32 Ga0070670_100216060 3300005331 Bacteria 1668
33 Ga0070660_100000057 3300005339 Bacteria 66715
34 Ga0070660_100010160 3300005339 Bacteria 6643
35 Ga0070660_100133925 3300005339 Bacteria 1985
36 Ga0070660_100202125 3300005339 Bacteria 1612
37 Ga0070659_100000097 3300005366 Bacteria 66243
38 Ga0070667_100120355 3300005367 Bacteria 2283
39 Ga0070708_100059501 3300005445 Bacteria 3406
40 Ga0070663_100005322 3300005455 Bacteria 7636
41 Ga0070663_100056233 3300005455 Bacteria 2818
42 Ga0070663_100356276 3300005455 Bacteria 1186
43 Ga0070681_10244787 3300005458 Bacteria 1706
44 Ga0070684_100083656 3300005535 Bacteria 2828
45 Ga0070695_100109845 3300005545 Bacteria 1869
46 Ga0068855_100002550 3300005563 Bacteria 22446
47 Ga0068855_100015175 3300005563 Bacteria 9277
48 Ga0068855_100046102 3300005563 Bacteria 5154
49 Ga0068855_100362487 3300005563 Bacteria 1595
50 Ga0070664_100053040 3300005564 Bacteria 3436
51 Ga0068852_100003155 3300005616 Bacteria 11496
52 Ga0081538_10035899 3300005981 Bacteria 3247
53 Ga0075365_10049409 3300006038 Bacteria 2771
54 Ga0075365_10171634 3300006038 Bacteria 1514
55 Ga0075368_10011152 3300006042 Bacteria 3265
56 Ga0075363_100013275 3300006048 Bacteria 3987
57 Ga0075363_100031268 3300006048 Bacteria 2759
58 Ga0075364_10028578 3300006051 Bacteria 3570
59 Ga0075367_10024175 3300006178 Bacteria 3426
60 Ga0075367_10128471 3300006178 Bacteria 1565
61 Ga0075366_10001529 3300006195 Bacteria 11567
62 Ga0075370_10008007 3300006353 Bacteria 5417
63 Ga0105251_10000289 3300009011 Bacteria 50651
64 Ga0105251_10003344 3300009011 Bacteria 11684
65 Ga0105244_10042867 3300009036 Bacteria 2337
66 Ga0105240_10001836 3300009093 Bacteria 35576
67 Ga0105240_10004687 3300009093 Bacteria 20679
68 Ga0105240_10152422 3300009093 Bacteria 2752
69 Ga0105240_10280288 3300009093 Bacteria 1915
70 Ga0105240_10310420 3300009093 Bacteria 1801
71 Ga0111539_10154374 3300009094 Bacteria 2687
72 Ga0114129_10035592 3300009147 Bacteria 7034
73 Ga0114129_10071128 3300009147 Bacteria 4851
74 Ga0105237_10004028 3300009545 Bacteria 17166
75 Ga0105237_10080744 3300009545 Bacteria 3242
76 Ga0105237_10168231 3300009545 Bacteria 2191
77 Ga0105238_10015560 3300009551 Bacteria 7702
78 Ga0123341_1002056 3300009765 Bacteria 16111
79 Ga0105239_10004937 3300010375 Bacteria 15745
80 Ga0105239_10024910 3300010375 Bacteria 6590
81 Ga0105239_10440605 3300010375 Bacteria 1477
82 Ga0157373_10001515 3300013100 Bacteria 17709
83 Ga0157373_10070049 3300013100 Bacteria 2479
84 Ga0157370_10000729 3300013104 Bacteria 41283
85 Ga0157370_10001391 3300013104 Bacteria 29983
86 Ga0157370_10133016 3300013104 Bacteria 2319
87 Ga0157370_10158881 3300013104 Bacteria 2103
88 Ga0157370_10162844 3300013104 Bacteria 2075
89 Ga0157370_10249643 3300013104 Bacteria 1641
90 Ga0157369_10000092 3300013105 Bacteria 123849
91 Ga0157369_10018572 3300013105 Bacteria 7794
92 Ga0157374_10000053 3300013296 Bacteria 123609
93 Ga0157374_10143955 3300013296 Bacteria 2315
94 Ga0163162_10002349 3300013306 Bacteria 17778
95 Ga0157372_10000903 3300013307 Bacteria 32251
96 Ga0157375_10041221 3300013308 Bacteria 4456
97 Ga0182007_10001667 3300015262 Bacteria 11763
98 Ga0182007_10006076 3300015262 Bacteria 5221
99 Ga0182007_10028153 3300015262 Bacteria 1932
100 Ga0182005_1020792 3300015265 Bacteria 1803
101 Ga0183361_10003 3300016635 Bacteria 577277
102 Ga0206353_11214724 3300020082 Bacteria 5955
103 Ga0214544_1000018 3300021320 Bacteria 187095
104 Ga0214542_1001937 3300021321 Bacteria 42815
105 Ga0214542_1020848 3300021321 Bacteria 4686
106 Ga0214543_1000042 3300021327 Bacteria 164433
107 Ga0214543_1000162 3300021327 Bacteria 96261
108 Ga0213875_10011636 3300021388 Bacteria 4372
109 Ga0209674_100144 3300025226 Bacteria 107160
110 Ga0209672_100035 3300025228 Bacteria 303111
111 Ga0209672_100969 3300025228 Bacteria 12730
112 Ga0209147_100041 3300025229 Bacteria 303111
113 Ga0209258_100063 3300025242 Bacteria 303577
114 Ga0209148_1000088 3300025254 Bacteria 258188
115 Ga0209759_1000008 3300025256 Bacteria 461395
116 Ga0209759_1004213 3300025256 Bacteria 5453
117 Ga0209759_1004748 3300025256 Bacteria 4968
118 Ga0209129_1002275 3300025258 Bacteria 9588
119 Ga0209565_1016228 3300025263 Bacteria 1661
120 Ga0209455_1000075 3300025272 Bacteria 285430
121 Ga0209673_1000061 3300025273 Bacteria 262274
122 Ga0209673_1000105 3300025273 Bacteria 186267
123 Ga0209673_1000452 3300025273 Bacteria 69726
124 Ga0209130_1009838 3300025284 Bacteria 2684
125 Ga0209675_1015856 3300025291 Bacteria 2219
126 Ga0209676_1009027 3300025292 Bacteria 4356
127 Ga0209025_1000555 3300025294 Bacteria 69450
128 Ga0209025_1076843 3300025294 Bacteria 1155
129 Ga0209564_1000913 3300025295 Bacteria 38633
130 Ga0209564_1007232 3300025295 Bacteria 5773
131 Ga0209564_1029115 3300025295 Bacteria 1746
132 Ga0209758_1000380 3300025297 Bacteria 77252
133 Ga0209050_1003406 3300025298 Bacteria 11784
134 Ga0209256_1000260 3300025299 Bacteria 93956
135 Ga0209256_1000281 3300025299 Bacteria 89636
136 Ga0209256_1001129 3300025299 Bacteria 30423
137 Ga0207426_1000180 3300025302 Bacteria 158321
138 Ga0207426_1000350 3300025302 Bacteria 84510
139 Ga0209051_1000027 3300025303 Bacteria 412172
140 Ga0209051_1000875 3300025303 Bacteria 30448
141 Ga0209051_1001030 3300025303 Bacteria 26476
142 Ga0209257_1001771 3300025304 Bacteria 23907
143 Ga0209257_1010613 3300025304 Bacteria 4619
144 Ga0207713_1000590 3300025735 Bacteria 35946
145 Ga0207647_10005322 3300025904 Bacteria 9457
146 Ga0207647_10009142 3300025904 Bacteria 7050
147 Ga0207647_10011332 3300025904 Bacteria 6257
148 Ga0207647_10013946 3300025904 Bacteria 5560
149 Ga0207647_10040991 3300025904 Bacteria 2913
150 Ga0207705_10001093 3300025909 Bacteria 22067
151 Ga0207705_10015520 3300025909 Bacteria 5466
152 Ga0207705_10085819 3300025909 Bacteria 2300
153 Ga0207695_10004090 3300025913 Bacteria 20045
154 Ga0207695_10045384 3300025913 Bacteria 4665
155 Ga0207695_10193003 3300025913 Bacteria 1953
156 Ga0207671_10070376 3300025914 Bacteria 2608
157 Ga0207671_10119214 3300025914 Bacteria 2016
158 Ga0207657_10000118 3300025919 Bacteria 78669
159 Ga0207657_10005202 3300025919 Bacteria 13636
160 Ga0207657_10138704 3300025919 Bacteria 1988
161 Ga0207694_10042206 3300025924 Bacteria 3518
162 Ga0207694_10318668 3300025924 Bacteria 1283
163 Ga0207690_10000025 3300025932 Bacteria 179019
164 Ga0207667_10000690 3300025949 Bacteria 43775
165 Ga0207667_10105986 3300025949 Bacteria 2900
166 Ga0207667_10124992 3300025949 Bacteria 2649
167 Ga0207667_10359047 3300025949 Bacteria 1486
168 Ga0207639_10036723 3300026041 Bacteria 3633
169 Ga0207678_10000409 3300026067 Bacteria 38784
170 Ga0207678_10021336 3300026067 Bacteria 5680
171 Ga0207678_10261326 3300026067 Bacteria 1484
172 Ga0207698_10006142 3300026142 Bacteria 7477
173 Ga0209281_1000655 3300027111 Bacteria 37203
174 Ga0209281_1026060 3300027111 Bacteria 1085
175 Ga0209371_1000179 3300027312 Bacteria 93861
176 Ga0207428_10190707 3300027907 Bacteria 1545
177 Ga0307515_10125833 3300028794 Bacteria 2864
178 Ga0268256_1000149 3300030500 Bacteria 93861
179 Ga0307412_10000039 3300031911 Bacteria 182976
180 Ga0307416_100531550 3300032002 Bacteria 1246
181 Ga0307415_100235467 3300032126 Bacteria 1478
182 Ga0316584_0041093 3300036712 Bacteria 3447
183 Ga0395900_0022081 3300037418 Bacteria 6511
184 Ga0395898_0004175 3300037466 Bacteria 15828
185 Ga0395898_0027782 3300037466 Bacteria 5673
186 Ga0395898_0093048 3300037466 Bacteria 2898
187 Ga0395905_0000004 3300037471 Bacteria 674991
188 Ga0395905_0044943 3300037471 Bacteria 4143
189 Ga0395905_0199155 3300037471 Bacteria 1878
190 Ga0436364_0874601 3300037853 Bacteria 1269
191 Ga0436364_1224135 3300037853 Bacteria 88093
192 Ga0395901_0000087 3300038443 Bacteria 125110
193 Ga0395901_0000472 3300038443 Bacteria 46693
194 Ga0451845_0752875 3300041501 Bacteria 1482
195 Ga0451577_0004499 3300042876 Bacteria 14687
196 Ga0466982_0016121 3300044672 Bacteria 4112
197 Ga0466966_0009701 3300044684 Bacteria 6377
198 Ga0466966_0015921 3300044684 Bacteria 4969
199 Ga0466961_0000267 3300044693 Bacteria 34798
200 Ga0466961_0002981 3300044693 Bacteria 10513
201 Ga0466961_0012587 3300044693 Bacteria 5416
202 Ga0466964_0031632 3300044706 Bacteria 2100
203 Ga0466971_0074270 3300044719 Bacteria 1546
204 Ga0466970_0011394 3300044765 Bacteria 4532
205 Ga0466970_0159934 3300044765 Bacteria 1245
206 Ga0466957_0000683 3300044842 Bacteria 17299
207 Ga0466960_0000885 3300044901 Bacteria 10578
208 Ga0466967_0362638 3300045976 Bacteria 1404
209 Ga0495592_0000229 3300046454 Bacteria 48485
210 Ga0495603_0000773 3300046455 Bacteria 18283
211 Ga0495590_0003303 3300046457 Bacteria 6602
212 Ga0495590_0008092 3300046457 Bacteria 4027
213 Ga0495591_000101 3300046458 Bacteria 99240
214 Ga0495629_0000061 3300046459 Bacteria 100620
215 Ga0495629_0001559 3300046459 Bacteria 18009
216 Ga0495638_0005978 3300046460 Bacteria 8930
217 Ga0495638_0013689 3300046460 Bacteria 5511
218 Ga0495638_0068691 3300046460 Bacteria 2172
219 Ga0495651_0042719 3300046462 Bacteria 3518
220 Ga0495653_0015525 3300046463 Bacteria 6206
221 Ga0495653_0020633 3300046463 Bacteria 5339
222 Ga0495650_0000374 3300046471 Bacteria 78199
223 Ga0495580_0000681 3300046472 Bacteria 28955
224 Ga0495580_0002278 3300046472 Bacteria 16753
225 Ga0495580_0003123 3300046472 Bacteria 14192
226 Ga0495580_0003357 3300046472 Bacteria 13677
227 Ga0495582_0001818 3300046473 Bacteria 12061
228 Ga0495605_0015438 3300046474 Bacteria 4153
229 Ga0495639_0010060 3300046475 Bacteria 4065
230 Ga0495662_0036571 3300046476 Bacteria 2369
231 Ga0495664_0000769 3300046477 Bacteria 16399
232 Ga0495664_0038026 3300046477 Bacteria 2840
233 Ga0495596_0000146 3300046500 Bacteria 48977
234 Ga0495596_0054153 3300046500 Bacteria 1569
235 Ga0495583_0000449 3300046506 Bacteria 61654
236 Ga0495606_0002598 3300046507 Bacteria 20659
237 Ga0495606_0017686 3300046507 Bacteria 5379
238 Ga0495606_0110668 3300046507 Bacteria 1657
239 Ga0495608_0000241 3300046511 Bacteria 39695
240 Ga0495608_0259542 3300046511 Bacteria 1082
241 Ga0495610_0001301 3300046512 Bacteria 22255
242 Ga0495618_0003545 3300046514 Bacteria 9671
243 Ga0495620_0039116 3300046515 Bacteria 2099
244 Ga0495628_0006297 3300046516 Bacteria 10366
245 Ga0495628_0011596 3300046516 Bacteria 7452
246 Ga0495628_0012292 3300046516 Bacteria 7216
247 Ga0495628_0035810 3300046516 Bacteria 3987
248 Ga0495628_0052131 3300046516 Bacteria 3232
249 Ga0495630_0000147 3300046517 Bacteria 54656
250 Ga0495630_0172252 3300046517 Bacteria 1649
251 Ga0495644_0093133 3300046523 Bacteria 1138
252 Ga0495648_0000164 3300046524 Bacteria 78546
253 Ga0495666_0000107 3300046526 Bacteria 33827
254 Ga0495642_0001402 3300046528 Bacteria 10797
255 Ga0495642_0033944 3300046528 Bacteria 2053
256 Ga0495652_0007860 3300046529 Bacteria 9795
257 Ga0495652_0105248 3300046529 Bacteria 2280
258 Ga0495665_0000096 3300046531 Bacteria 40491
259 Ga0495665_0000827 3300046531 Bacteria 16201
260 Ga0495665_0116790 3300046531 Bacteria 1398
261 Ga0495586_0060666 3300046535 Bacteria 2057
262 Ga0495587_0001027 3300046536 Bacteria 18351
263 Ga0495597_0081349 3300046542 Bacteria 1385
264 Ga0495645_0000406 3300046543 Bacteria 29641
265 Ga0495667_0023170 3300046559 Bacteria 4184
266 Ga0495667_0043516 3300046559 Bacteria 2975
267 Ga0495668_0097025 3300046616 Bacteria 1613
268 Ga0495634_0004045 3300046642 Bacteria 11617
269 Ga0495611_0124345 3300046648 Bacteria 1203
270 Ga0495625_0005207 3300046660 Bacteria 11982
271 Ga0495635_0000218 3300046663 Bacteria 36175
272 Ga0495661_0001002 3300046665 Bacteria 25389
273 Ga0495657_0059132 3300046675 Bacteria 2543
274 Ga0495599_0036718 3300046678 Bacteria 3078
275 Ga0495623_0003510 3300046679 Bacteria 10378
276 Ga0495623_0023257 3300046679 Bacteria 3999
277 Ga0495646_0000478 3300046680 Bacteria 21305
278 Ga0495646_0024809 3300046680 Bacteria 3774
279 Ga0495646_0055263 3300046680 Bacteria 2385
280 Ga0495669_0034488 3300046684 Bacteria 2231
281 Ga0495613_0000353 3300046689 Bacteria 40648
282 Ga0495613_0056461 3300046689 Bacteria 2883
283 Ga0495624_0000869 3300046690 Bacteria 23955
284 Ga0495624_0002409 3300046690 Bacteria 14210
285 Ga0495670_0012082 3300046691 Bacteria 4247
286 Ga0495671_0009727 3300046692 Bacteria 5359
287 Ga0495649_0000211 3300046694 Bacteria 51291
288 Ga0495649_0013164 3300046694 Bacteria 4778
289 Ga0495649_0100030 3300046694 Bacteria 1542
290 Ga0495649_0132460 3300046694 Bacteria 1315
291 Ga0495589_0000213 3300046794 Bacteria 49333
292 Ga0495589_0008505 3300046794 Bacteria 5353
293 Ga0495589_0013243 3300046794 Bacteria 4256
294 Ga0495589_0019377 3300046794 Bacteria 3488
295 Ga0495600_0000806 3300046809 Bacteria 16629
296 Ga0495604_0002038 3300047317 Bacteria 16329
297 Ga0495604_0038957 3300047317 Bacteria 3737
298 Ga0495674_0001272 3300047319 Bacteria 24491
299 Ga0495674_0032197 3300047319 Bacteria 4758
300 Ga0495674_0053543 3300047319 Bacteria 3547
301 Ga0495674_0054612 3300047319 Bacteria 3507
302 Ga0495674_0196733 3300047319 Bacteria 1674
303 Ga0495672_0001724 3300047320 Bacteria 21158
304 Ga0495672_0001856 3300047320 Bacteria 20144
305 Ga0495676_0001988 3300047321 Bacteria 17979
306 Ga0495680_0007892 3300047322 Bacteria 9714
307 Ga0495680_0190117 3300047322 Bacteria 1477
308 Ga0495683_0000936 3300047323 Bacteria 20571
309 Ga0495683_0001354 3300047323 Bacteria 16331
310 Ga0495683_0002582 3300047323 Bacteria 10873
311 Ga0495683_0019460 3300047323 Bacteria 3503
312 Ga0495687_000305 3300047443 Bacteria 64650
313 Ga0495687_041562 3300047443 Bacteria 2016
314 Ga0495687_059679 3300047443 Bacteria 1576
315 Ga0495675_0000151 3300047444 Bacteria 48734
316 Ga0495675_0016747 3300047444 Bacteria 4635
317 Ga0495675_0035795 3300047444 Bacteria 3170
318 Ga0495679_000093 3300047446 Bacteria 81614
319 Ga0495673_0009269 3300047469 Bacteria 5460
320 Ga0495673_0012740 3300047469 Bacteria 4441
321 Ga0495684_0116116 3300047471 Bacteria 2018
322 Ga0495686_0000012 3300047472 Bacteria 508428
323 Ga0495593_0000123 3300047673 Bacteria 37582
324 Ga0495593_0000411 3300047673 Bacteria 23853
325 Ga0495593_0038002 3300047673 Bacteria 2601
326 Ga0495593_0038536 3300047673 Bacteria 2581
327 Ga0495602_0010286 3300048088 Bacteria 9714
328 Ga0495602_0014104 3300048088 Bacteria 8128
329 Ga0495602_0019708 3300048088 Bacteria 6686
330 Ga0495602_0032293 3300048088 Bacteria 4931
331 Ga0495614_0000524 3300048089 Bacteria 15802
332 Ga0495626_0003437 3300048091 Bacteria 10152
333 Ga0496100_0000313 3300048903 Bacteria 24033
334 Ga0496100_0088717 3300048903 Bacteria 2105
335 Ga0496101_0000892 3300048904 Bacteria 17545
336 Ga0496101_0023672 3300048904 Bacteria 4244
337 Ga0496102_0000734 3300048905 Bacteria 32222
338 Ga0496102_0212327 3300048905 Bacteria 1824
339 Ga0496103_0002991 3300048906 Bacteria 10452
340 Ga0496103_0004833 3300048906 Bacteria 8139
341 Ga0496103_0049758 3300048906 Bacteria 2592
342 Ga0496103_0127936 3300048906 Bacteria 1621
343 Ga0496104_0014261 3300048907 Bacteria 7175
344 Ga0496104_0079371 3300048907 Bacteria 3128
345 Ga0496104_0303975 3300048907 Bacteria 1507
346 Ga0496105_0164255 3300048908 Bacteria 1822
347 Ga0496106_0002793 3300048909 Bacteria 12940
348 Ga0496108_0286693 3300048911 Bacteria 1433
349 Ga0496109_0024896 3300048912 Bacteria 5328
350 Ga0496110_0043845 3300048913 Bacteria 3905
351 Ga0496110_0326972 3300048913 Bacteria 1397
352 Ga0496111_0016432 3300048914 Bacteria 5099
353 Ga0496112_0009464 3300048915 Bacteria 8782
354 Ga0496112_0027265 3300048915 Bacteria 5508
355 Ga0496113_0021558 3300048916 Bacteria 4546
356 Ga0496114_0661994 3300048917 Bacteria 918
357 Ga0496115_0008532 3300048918 Bacteria 7583
358 Ga0496116_0012032 3300048919 Bacteria 7098
359 Ga0496116_0071965 3300048919 Bacteria 2187
360 Ga0496116_0093950 3300048919 Bacteria 1814
361 Ga0496117_0001465 3300048920 Bacteria 33966
362 Ga0496117_0016567 3300048920 Bacteria 6211
363 Ga0496117_0052953 3300048920 Bacteria 2855
364 Ga0496117_0075494 3300048920 Bacteria 2239
365 Ga0496118_0001565 3300048921 Bacteria 33985
366 Ga0496118_0003868 3300048921 Bacteria 18395
367 Ga0496118_0020901 3300048921 Bacteria 5786
368 Ga0496118_0025522 3300048921 Bacteria 5063
369 Ga0496118_0120171 3300048921 Bacteria 1715
370 Ga0496118_0155991 3300048921 Bacteria 1420
371 Ga0496118_0213432 3300048921 Bacteria 1130
372 Ga0496119_0042098 3300048922 Bacteria 2900
373 Ga0496121_0001850 3300048924 Bacteria 34039
374 Ga0496121_0003972 3300048924 Bacteria 20405
375 Ga0496121_0024861 3300048924 Bacteria 5711
376 Ga0496122_0145420 3300048925 Bacteria 1474
377 Ga0496123_0022635 3300048926 Bacteria 4836
378 Ga0496124_0045812 3300048927 Bacteria 3749
379 Ga0496124_0223471 3300048927 Bacteria 1414
380 Ga0496125_0005016 3300048928 Bacteria 14951
381 Ga0496125_0005544 3300048928 Bacteria 13962
382 Ga0496125_0222514 3300048928 Bacteria 1215
383 Ga0466983_0056004 3300048986 Bacteria 3310
384 Ga0495682_0000499 3300049460 Bacteria 27163
385 Ga0501031_0000002 3300049568 Bacteria 217588
386 Ga0501032_0000004 3300049569 Bacteria 310855
387 Ga0501032_0292052 3300049569 Bacteria 1055
388 Ga0501033_0000016 3300049570 Bacteria 217458
389 Ga0501033_0022199 3300049570 Bacteria 4789
390 Ga0501033_0252861 3300049570 Bacteria 1248
391 Ga0501034_0000011 3300049571 Bacteria 310855
392 Ga0501034_0095266 3300049571 Bacteria 2973
393 Ga0501034_0142592 3300049571 Bacteria 2374
394 Ga0501034_0159237 3300049571 Bacteria 2230
395 Ga0501036_0000001 3300049572 Bacteria 310855
396 Ga0501036_0257755 3300049572 Bacteria 1461
397 Ga0501036_0411542 3300049572 Bacteria 1128
398 Ga0501036_0432862 3300049572 Bacteria 1097
399 Ga0501037_0000006 3300049573 Bacteria 217461
400 Ga0501038_0000003 3300049574 Bacteria 310855
401 Ga0501039_0000004 3300049575 Bacteria 310855
402 Ga0501041_0043763 3300049577 Bacteria 2722
403 Ga0501043_0000588 3300049579 Bacteria 32210
404 Ga0501043_0097624 3300049579 Bacteria 2310
405 Ga0501046_0120294 3300049580 Bacteria 1998
406 Ga0501047_0002317 3300049581 Bacteria 18214
407 Ga0501048_0073176 3300049582 Bacteria 2419
408 Ga0501067_0133905 3300049583 Bacteria 1380
409 Ga0501070_0006153 3300049586 Bacteria 10234
410 Ga0501070_0277251 3300049586 Bacteria 1368
411 Ga0501075_0025257 3300049591 Bacteria 4365
412 Ga0501076_0023347 3300049592 Bacteria 4766
413 Ga0501081_0046376 3300049743 Bacteria 2987
414 Ga0501083_0180171 3300049744 Bacteria 1380
415 Ga0501035_0000009 3300049822 Bacteria 310827
416 Ga0501035_0124031 3300049822 Bacteria 2256
417 Ga0501044_0000005 3300049823 Bacteria 310855
418 Ga0501044_0125348 3300049823 Bacteria 2566
419 Ga0501045_0272011 3300049824 Bacteria 1261
420 nmdc:mga03683_29342_c1 3300050489 Bacteria 2193
421 nmdc:mga03n38_22420_c1 3300050490 Bacteria 2555
422 nmdc:mga0yw44_72717_c1 3300050492 Bacteria 2138
423 nmdc:mga0k408_71534_c1 3300050493 Bacteria 2025
424 nmdc:mga06z11_84922_c1 3300050494 Bacteria 1707
425 nmdc:mga07m45_106749_c1 3300050496 Bacteria 1611
426 nmdc:mga07m45_15146_c1 3300050496 Bacteria 4117
427 nmdc:mga05p37_519182_c1 3300050507 Bacteria 1363
428 nmdc:mga08y16_169140_c1 3300050511 Bacteria 2270
429 nmdc:mga08x19_6007_c1 3300050514 Bacteria 7177
430 Ga0495655_0014586 3300053083 Bacteria 1651
431 Ga0500568_0000162 3300053139 Bacteria 57343
432 Ga0500604_0000975 3300053151 Bacteria 7951
433 Ga0500604_0041608 3300053151 Bacteria 1390
434 Ga0500616_0024030 3300053153 Bacteria 3391
435 Ga0500627_0043826 3300053158 Bacteria 1930
436 Ga0501084_0020242 3300054114 Bacteria 5547
437 Ga0501082_0032027 3300060353 Bacteria 4535
438 Ga0530510_0055554 3300061734 Bacteria 2860
439 2952255548 2952252522 Bacteria 4171745
440 2501076051 2501025501 Bacteria 7768574
441 2501409634 2501025504 Bacteria 8008976
442 2503203980 2503198000 Bacteria 6884444
443 2508728277 2508501050 Bacteria 9633614
444 2509126484 2508501125 Bacteria 7208311
445 2509145777 2508501127 Bacteria 7037543
446 2509368995 2509276018 Bacteria 6910194
447 2509442043 2509276033 Bacteria 7180565
448 2510248501 2510065045 Bacteria 7761063
449 2510302951 2510065057 Bacteria 6649661
450 2510316190 2510065059 Bacteria 6847884
451 2511099162 2510917014 Bacteria 8296963
452 2511108734 2510917015 Bacteria 7950052
453 2511496943 2511231052 Bacteria 6974333
454 2512349487 2512047030 Bacteria 9031815
455 2512929230 2512875016 Bacteria 6529530
456 2512964019 2512875024 Bacteria 7195110
457 2513557183 2513237082 Bacteria 8640282
458 2513562829 2513237083 Bacteria 8410967
459 2513583384 2513237086 Bacteria 7265287
460 2513614942 2513237091 Bacteria 6900273
461 2513883938 2513237140 Bacteria 7076289
462 2513901604 2513237143 Bacteria 6664116
463 2513914559 2513237144 Bacteria 7530820
464 2513923921 2513237146 Bacteria 7166346
465 2513958286 2513237151 Bacteria 6309801
466 2514039083 2513237164 Bacteria 7563725
467 2514055000 2513237166 Bacteria 10373764
468 2514423270 2513237305 Bacteria 7293571
469 2515612194 2515154107 Bacteria 6795637
470 2515684207 2515154122 Bacteria 8609520
471 2516019044 2515154189 Bacteria 9629850
472 2516208238 2516143018 Bacteria 6951533
473 2516895827 2516653046 Bacteria 6989037
474 2517409760 2517287029 Bacteria 6905599
475 2517566209 2517487022 Bacteria 7227575
476 2524449171 2524023207 Bacteria 6813453
477 2527077254 2526164713 Bacteria 6780608
478 2551678703 2551306084 Bacteria 8942552
479 2551681941 2551306084 Bacteria 8942552
480 2551683262 2551306085 Bacteria 7347181
481 2551696704 2551306086 Bacteria 6843938
482 2551699868 2551306087 Bacteria 7351905
483 2551714121 2551306089 Bacteria 7162724
484 2551716757 2551306090 Bacteria 7953713
485 2551739069 2551306092 Bacteria 6992595
486 2551744244 2551306093 Bacteria 7064773
487 2555247517 2554235231 Bacteria 5215788
488 2585543458 2585427528 Bacteria 6842387
489 2585841926 2585427593 Bacteria 7141551
490 2586004561 2585427634 Bacteria 6455027
491 2588514776 2588253730 Bacteria 6881675
492 2599415963 2599185170 Bacteria 7295545
493 2600195618 2599185352 Bacteria 7228948
494 2643809554 2643221557 Bacteria 7184309
495 2644048905 2643221607 Bacteria 6314006
496 2644066715 2643221610 Bacteria 7480339
497 2644203695 2643221636 Bacteria 6583769
498 2644375894 2643221668 Bacteria 7306521
499 2644415072 2643221675 Bacteria 7473456
500 2644451483 2643221680 Bacteria 7473610
501 2644482872 2643221686 Bacteria 6310811
502 2644497618 2643221689 Bacteria 6042950
503 2644693141 2643221726 Bacteria 7455827
504 2657685154 2657244999 Bacteria 5946535
505 2687577965 2687453129 Bacteria 4387428
506 2688597845 2687453392 Bacteria 6880454
507 2719643072 2718217991 Bacteria 7829542
508 2723575158 2721755686 Bacteria 7343952
509 2725949616 2724679232 Bacteria 7646494
510 2738819338 2738541296 Bacteria 7285013
511 2738831817 2738541298 Bacteria 7286732
512 2738873345 2738541306 Bacteria 7284992
513 2739035365 2738541333 Bacteria 7106503
514 2739184975 2738543002 Bacteria 7284546
515 2739219944 2738543008 Bacteria 7282815
516 2756676269 2756170246 Bacteria 7451806
517 2770197592 2767802442 Bacteria 5747986
518 2792580917 2791355082 Bacteria 5973319
519 2792839802 2791355137 Bacteria 9654227
520 2793312621 2791355259 Bacteria 7254731
521 2793370352 2791355267 Bacteria 7222458
522 2802754069 2802428863 Bacteria 6410669
523 2804754408 2802429268 Bacteria 6094027
524 2806048287 2802429633 Bacteria 7341974
525 2806056072 2802429634 Bacteria 7083200
526 2806062889 2802429635 Bacteria 7650140
527 2806070493 2802429636 Bacteria 7597525
528 2806077403 2802429637 Bacteria 7067217
529 2817263304 2816332253 Bacteria 6764532
530 2817276685 2816332256 Bacteria 6891714
531 2819619371 2818991450 Bacteria 6962147
532 2834578491 2834578030 Bacteria 3530182
533 2838036079 2838035591 Bacteria 7166484
534 2838078443 2838074704 Bacteria 6785777
535 2838667355 2838661181 Bacteria 7385261
536 2841865942 2841864319 Bacteria 6742987
537 2842334196 2842333319 Bacteria 8899485
538 2842364188 2842363717 Bacteria 6844742
539 2842397198 2842395702 Bacteria 6780583
540 2842458039 2842454564 Bacteria 8730687
541 2844004812 2844002411 Bacteria 7168230
542 2844009656 2844009547 Bacteria 6728125
543 2854913499 2854911287 Bacteria 5582813
544 2855829356 2855825444 Bacteria 6785811
545 2855844455 2855839649 Bacteria 7135830
546 2856329944 2856328259 Bacteria 6528202
547 2856337098 2856334872 Bacteria 7037011
548 2856346946 2856342000 Bacteria 7176905
549 2856358942 2856356410 Bacteria 6297484
550 2857371536 2857367948 Bacteria 6965560
551 2858806084 2858800743 Bacteria 6603254
552 2863426696 2863421361 Bacteria 7300805
553 2869170322 2869169390 Bacteria 6659796
554 2869246219 2869242130 Bacteria 6609239
555 2869250204 2869249662 Bacteria 6868783
556 2869257306 2869256925 Bacteria 6981691
557 2869270402 2869264136 Bacteria 6880765
558 2869273207 2869271264 Bacteria 6908218
559 2871440605 2871435913 Bacteria 6880295
560 2871457518 2871451962 Bacteria 7336357
561 2871460367 2871459585 Bacteria 6866887
562 2871468577 2871466892 Bacteria 6923287
563 2871477568 2871474448 Bacteria 6806570
564 2871482985 2871481445 Bacteria 6700002
565 2871492052 2871488783 Bacteria 6929816
566 2874112153 2874109183 Bacteria 6517025
567 2874117777 2874116593 Bacteria 6674494
568 2874130938 2874123672 Bacteria 7238285
569 2874131920 2874131515 Bacteria 6820270
570 2874163927 2874162495 Bacteria 6174670
571 2874171248 2874168670 Bacteria 8062617
572 2876367214 2876363079 Bacteria 6544991
573 2876392047 2876386047 Bacteria 6698674
574 2876401585 2876399893 Bacteria 6927900
575 2876407261 2876406927 Bacteria 6191900
576 2876422958 2876420981 Bacteria 6687741
577 2878736974 2878730984 Bacteria 6380721
578 2878754770 2878753008 Bacteria 6922523
579 2878776938 2878774303 Bacteria 6108671
580 2878787763 2878781027 Bacteria 6834456
581 2878797023 2878788777 Bacteria 6567085
582 2881863226 2881861095 Bacteria 7128710
583 2882463633 2882456835 Bacteria 6863978
584 2882638913 2882632389 Bacteria 8154593
585 2882639279 2882632389 Bacteria 8154593
586 2882917055 2882912400 Bacteria 6801539
587 2883087669 2883087390 Bacteria 9532701
588 2885273554 2885270888 Bacteria 9831543
589 2885318391 2885312484 Bacteria 6415165
590 2888346614 2888343758 Bacteria 6611049
591 2896389464 2896384573 Bacteria 7700774
592 2902687454 2902682994 Bacteria 8951596
593 2903453318 2903448605 Bacteria 7357801
594 2903504896 2903492973 Bacteria 13473544
595 2903519623 2903513507 Bacteria 6344008
596 2903526705 2903521522 Bacteria 6525694
597 2903530676 2903528002 Bacteria 6586099
598 2903531340 2903528002 Bacteria 6586099
599 2904566775 2904564687 Bacteria 7609577
600 2904573820 2904571731 Bacteria 7608790
601 2904621546 2904615490 Bacteria 10047340
602 2906364017 2906363423 Bacteria 6856682
603 2906371703 2906370794 Bacteria 6881062
604 2906385882 2906378014 Bacteria 6911440
605 2906393430 2906386501 Bacteria 5977019
606 2906407773 2906401398 Bacteria 6693206
607 2906409614 2906408224 Bacteria 6162342
608 2906433365 2906427513 Bacteria 6375796
609 2908673595 2908669403 Bacteria 5740494
610 2909046062 2909042592 Bacteria 6499737
611 2913297166 2913295892 Bacteria 6333755
612 2915988125 2915986958 Bacteria 6739310
613 2915993831 2915993759 Bacteria 7016183
614 2916005466 2916000859 Bacteria 6865702
615 2916008812 2916007675 Bacteria 6898660
616 2916021502 2916014648 Bacteria 6946486
617 2916021663 2916021584 Bacteria 6854472
618 2916028526 2916028427 Bacteria 6748433
619 2916037521 2916035215 Bacteria 6755766
620 2916042015 2916041962 Bacteria 6820487
621 2916048787 2916048683 Bacteria 6543552
622 2916059863 2916055098 Bacteria 6758838
623 2916073897 2916068649 Bacteria 6943657
624 2916077492 2916076590 Bacteria 6596108
625 2919532751 2919527303 Bacteria 7718827
626 2919680608 2919679072 Bacteria 4629602
627 2920765186 2920760137 Bacteria 7427611
628 2921205313 2921201388 Bacteria 6926299
629 2921212103 2921208531 Bacteria 6745326
630 2921237338 2921237296 Bacteria 6876710
631 2921249227 2921244191 Bacteria 6568419
632 2921259458 2921257292 Bacteria 6808382
633 2921268094 2921263974 Bacteria 6864552
634 2921288646 2921282425 Bacteria 6826397
635 2921295098 2921289301 Bacteria 7316391
636 2921298805 2921296804 Bacteria 7176999
637 2921654274 2921643360 Bacteria 11448031
638 2922151600 2922151315 Bacteria 6902399
639 2922172951 2922172374 Bacteria 6167644
640 2922184290 2922178524 Bacteria 6025201
641 2924150427 2924144063 Bacteria 6883928
642 2924157184 2924150972 Bacteria 7169444
643 2924161705 2924158325 Bacteria 7188855
644 2924171198 2924165586 Bacteria 7260590
645 2924175039 2924172951 Bacteria 6749356
646 2924182710 2924179722 Bacteria 6843264
647 2924189121 2924186466 Bacteria 6876637
648 2924196817 2924193448 Bacteria 6955718
649 2924200541 2924200457 Bacteria 6757188
650 2924212090 2924207177 Bacteria 6917007
651 2924217761 2924214083 Bacteria 7080103
652 2924223659 2924221636 Bacteria 7113495
653 2924233400 2924228884 Bacteria 6633132
654 2924740683 2924733363 Bacteria 7574837
655 2924746060 2924741084 Bacteria 6661321
656 2924751017 2924748358 Bacteria 6154725
657 2924760940 2924754689 Bacteria 6774424
658 2924767786 2924762789 Bacteria 6561353
659 2924790990 2924784321 Bacteria 7416538
660 2928111606 2928108538 Bacteria 7360024
661 2928138408 2928135762 Bacteria 7259641
662 2928163527 2928157003 Bacteria 7522202
663 2928166586 2928163908 Bacteria 7561269
664 2928504783 2928503688 Bacteria 7268108
665 2928542948 2928536128 Bacteria 7657547
666 2933018378 2933016740 Bacteria 6355406
667 2936998405 2936996657 Bacteria 6298727
668 2937002997 2937002841 Bacteria 6934057
669 2937009846 2937009748 Bacteria 6746052
670 2937020000 2937016420 Bacteria 6782579
671 2937025164 2937023124 Bacteria 6815156
672 2937049725 2937042894 Bacteria 6741576
673 2937054576 2937049772 Bacteria 6757901
674 2937058650 2937056579 Bacteria 7107896
675 2937063926 2937063883 Bacteria 7199456
676 2937077745 2937071275 Bacteria 6984483
677 2937094418 2937091812 Bacteria 6979387
678 2937101442 2937098957 Bacteria 7249374
679 2937108028 2937106411 Bacteria 6947143
680 2937115426 2937113482 Bacteria 6505872
681 2937120085 2937119839 Bacteria 6597547
682 2937128212 2937126314 Bacteria 6771275
683 2937824083 2937822353 Bacteria 7290551
684 2937841998 2937836603 Bacteria 6811263
685 2937845855 2937843397 Bacteria 5256375
686 2937850259 2937848649 Bacteria 6983481
687 2937865789 2937861824 Bacteria 6660327
688 2937874687 2937868953 Bacteria 6639878
689 2937983617 2937980651 Bacteria 6517427
690 2939671252 2939669807 Bacteria 5028511
691 2945940353 2945934425 Bacteria 7444609
692 2957382273 2957382221 Bacteria 6737050
693 2957395518 2957388812 Bacteria 6778072
694 2957397984 2957395598 Bacteria 6822399
695 2957404281 2957402308 Bacteria 6741770
696 2957414786 2957408893 Bacteria 6558585
697 2957421120 2957415311 Bacteria 6991633
698 2957426708 2957422303 Bacteria 7172205
699 2957431344 2957430029 Bacteria 7022557
700 2957446009 2957443900 Bacteria 6869977
701 2957451110 2957450854 Bacteria 6765715
702 2957461743 2957457609 Bacteria 6967680
703 2957465976 2957464669 Bacteria 6568877
704 2957474525 2957471148 Bacteria 6797643
705 2957483296 2957478035 Bacteria 6756658
706 2957491268 2957484790 Bacteria 6703082
707 2957496573 2957491536 Bacteria 6695180
708 2957502011 2957498199 Bacteria 7126688
709 2957505537 2957505466 Bacteria 7253085
710 2958071678 2958071322 Bacteria 6815895
711 2958110669 2958108152 Bacteria 6681128
712 2958130170 2958122699 Bacteria 7280457
713 2958139248 2958137437 Bacteria 6050276
714 2958159280 2958158011 Bacteria 6058449
715 2960584077 2960584000 Bacteria 6864594
716 2960603094 2960597568 Bacteria 6550735
717 2960604154 2960603979 Bacteria 6898737
718 2960610946 2960610863 Bacteria 6691244
719 2960622311 2960617483 Bacteria 6727748
720 2960624371 2960624210 Bacteria 6875384
721 2960637979 2960637947 Bacteria 7296468
722 2960649236 2960645483 Bacteria 7211087
723 2960653282 2960652885 Bacteria 7083688
724 2960663691 2960660292 Bacteria 7041660
725 2960667512 2960667422 Bacteria 6763020
726 2960676577 2960674078 Bacteria 6609048
727 2961139376 2961136820 Bacteria 6775228
728 2961173852 2961170736 Bacteria 7072258
729 2961185842 2961183825 Bacteria 6688536
730 2963650007 2963644680 Bacteria 6530403
731 2964611038 2964607997 Bacteria 7101408
732 2964615467 2964615318 Bacteria 6809089
733 2964628160 2964621998 Bacteria 6834995
734 2964628968 2964628898 Bacteria 7083044
735 2964636074 2964636051 Bacteria 7091832
736 2964643430 2964643177 Bacteria 6820887
737 2964653969 2964649959 Bacteria 6675118
738 2964656670 2964656573 Bacteria 7100150
739 2964664050 2964663802 Bacteria 7019362
740 2964676913 2964670856 Bacteria 6851364
741 2964682325 2964678106 Bacteria 6792020
742 2964690728 2964685014 Bacteria 6839111
743 2964698856 2964698721 Bacteria 6765331
744 2964707582 2964705432 Bacteria 7114648
745 2964717772 2964712639 Bacteria 6695970
746 2964721805 2964719344 Bacteria 7286602
747 2965031133 2965025482 Bacteria 6532201
748 2965039806 2965032056 Bacteria 6887443
749 2965045513 2965040258 Bacteria 6855979
750 2965050910 2965047637 Bacteria 6623551
751 2965090826 2965089291 Bacteria 6866420
752 2967664510 2967664464 Bacteria 6948836
753 2967672457 2967671571 Bacteria 7021409
754 2967683267 2967678726 Bacteria 7264382
755 2967698569 2967693043 Bacteria 6804451
756 2967713892 2967706974 Bacteria 7186053
757 2967718642 2967714385 Bacteria 7000047
758 2967723155 2967721400 Bacteria 7073753
759 2967737462 2967735183 Bacteria 6827012
760 2967748067 2967742019 Bacteria 6794534
761 2967749226 2967748971 Bacteria 6733771
762 2967755978 2967755722 Bacteria 6814706
763 2967762531 2967762386 Bacteria 6923502
764 2967769405 2967769361 Bacteria 6587838
765 2967778396 2967775926 Bacteria 6738189
766 2967999101 2967996073 Bacteria 6787468
767 2968006785 2968003550 Bacteria 6929263
768 2968086682 2968083720 Bacteria 7351627
769 2968141883 2968138860 Bacteria 6605449
770 2970019700 2970019648 Bacteria 7072033
771 2970027026 2970026789 Bacteria 6785236
772 2970033905 2970033650 Bacteria 7118744
773 2970044086 2970040964 Bacteria 6731123
774 2970051038 2970047711 Bacteria 7088379
775 2970058367 2970054988 Bacteria 6611507
776 2970065193 2970061556 Bacteria 7099761
777 2970075856 2970068827 Bacteria 7123112
778 2970077961 2970076120 Bacteria 6697332
779 2970084513 2970082768 Bacteria 6183754
780 2970091858 2970088815 Bacteria 6933825
781 2970097706 2970095765 Bacteria 6936963
782 2970102933 2970102677 Bacteria 6812532
783 2970111386 2970109326 Bacteria 6863976
784 2970119006 2970116247 Bacteria 6501857
785 2970135380 2970129317 Bacteria 6806560
786 2970143511 2970136068 Bacteria 7207982
787 2970152179 2970149975 Bacteria 6779706
788 2970160098 2970156795 Bacteria 7168044
789 2970164818 2970164137 Bacteria 6861252
790 2970171234 2970170962 Bacteria 6876229
791 2970179969 2970177841 Bacteria 6768001
792 2970191445 2970184632 Bacteria 7054431
793 2970195060 2970191845 Bacteria 7032787
794 2970491475 2970489779 Bacteria 6517260
795 2970506481 2970503327 Bacteria 7099517
796 2970517781 2970510686 Bacteria 7006402
797 2970528176 2970524798 Bacteria 6840927
798 2970543769 2970540015 Bacteria 6977556
799 2970554572 2970547951 Bacteria 6931819
800 2970622118 2970619444 Bacteria 6986144
801 2970631240 2970627176 Bacteria 6680862
802 2977521731 2977516862 Bacteria 6940108
803 2977525820 2977523885 Bacteria 6960446
804 2977539887 2977537788 Bacteria 6929320
805 2977556205 2977551784 Bacteria 7125765
806 2977559112 2977558990 Bacteria 6863948
807 2977566030 2977565890 Bacteria 6901543
808 2977574541 2977572785 Bacteria 6763888
809 2977584979 2977579622 Bacteria 6772100
810 2977823987 2977821940 Bacteria 6906439
811 2977834145 2977828996 Bacteria 7007971
812 2977856400 2977851361 Bacteria 6694324
813 2977878625 2977872689 Bacteria 7270173
814 2977902422 2977898635 Bacteria 6675551
815 2977908710 2977907340 Bacteria 6577984
816 2977921513 2977915119 Bacteria 6829656
817 2977927520 2977922695 Bacteria 6956781
818 2977937152 2977935797 Bacteria 6252826
819 2977955507 2977950692 Bacteria 6893264
820 2977990834 2977986579 Bacteria 6581278
821 2979769306 2979764755 Bacteria 6610066
822 2979779413 2979772303 Bacteria 6618277
823 2979799643 2979793036 Bacteria 6808957
824 2979811087 2979808191 Bacteria 7179355
825 2987649795 2987645492 Bacteria 6117018
826 2987671758 2987666974 Bacteria 6509233
827 2987678592 2987673487 Bacteria 6884027
828 2990707481 2990703756 Bacteria 7715990
829 2996337079 2996336353 Bacteria 5511628
830 2996389748 2996386984 Bacteria 6978667
831 3004171977 3004167301 Bacteria 8330599
832 3004198166 3004195979 Bacteria 6776956
833 3004213563 3004211236 Bacteria 7417683
834 3004223154 3004218560 Bacteria 7421728
835 3004235247 3004232784 Bacteria 6662140
836 3004243832 3004239961 Bacteria 6892290
837 3004252323 3004248173 Bacteria 6563236
838 3004271504 3004268573 Bacteria 7043476
839 3004338720 3004334049 Bacteria 8449246
840 642423921 641736151 Bacteria 7477263
841 642414442 641736154 Bacteria 7689995
842 642595631 642555112 Bacteria 8676562
843 8003955966 8003955200 Bacteria 8601927
844 8003996979 8003992118 Bacteria 7266902
845 8004304029 8004300914 Bacteria 6132239
846 8004315636 8004312739 Bacteria 7444653
847 8004369181 8004361976 Bacteria 6858373
848 8004376352 8004374579 Bacteria 6898112
849 8004403635 8004395343 Bacteria 6620908
850 8004639162 8004633249 Bacteria 6723080
851 8004700986 8004695233 Bacteria 6731676
852 8004728424 8004727605 Bacteria 6643904
853 8005571597 8005570704 Bacteria 6957481
854 8005685941 8005682033 Bacteria 6726518
855 8020812301 8020807995 Bacteria 6801506
856 8020941508 8020938398 Bacteria 7472757
857 8020955474 8020953355 Bacteria 7439080
858 8039099607 8039098773 Bacteria 6602928
859 8040172008 8040167225 Bacteria 6542727
860 8040177971 8040173305 Bacteria 6827067
861 8055272116 8055266321 Bacteria 7999742
862 8055620310 8055617313 Bacteria 7548464
863 8056377873 8056375014 Bacteria 7006639
864 8057135584 8057132660 Bacteria 4061191
865 8057160890 8057160832 Bacteria 3268302
866 JGI24739J22299_10000182
867 JGI24739J22299_10000607
868 JGI24739J22299_10010426
869 JGI24735J21928_10000090
870 JGI24735J21928_10003930
871 JGI24735J21928_10035655
872 JGI24738J21930_10000351
873 JGI25151J46595_10002908
874 rootH1_10086515
875 JGI25160J50197_1001489
876 JGI25160J50197_1011650
877 JGI25161J50226_1002195
878 Ga0055533_1001478
879 Ga0055532_1000327
880 Ga0055527_1000150
881 Ga0055527_1007753
882 Ga0055535_1000202
883 Ga0055542_1000237
884 Ga0055529_1000257
885 Ga0055526_1013097
886 Ga0055524_1000517
887 Ga0055528_1000858
888 Ga0055528_1000982
889 Ga0055540_1000096
890 Ga0055540_1023505
891 Ga0055531_10038529
892 Ga0055543_1002427
893 Ga0065165_1003243
894 Ga0070658_10016807
895 Ga0070658_10060702
896 Ga0070658_10089396
897 Ga0070670_100216060
898 Ga0070660_100000057
899 Ga0070660_100010160
900 Ga0070660_100133925
901 Ga0070660_100202125
902 Ga0070659_100000097
903 Ga0070667_100120355
904 Ga0070708_100059501
905 Ga0070663_100005322
906 Ga0070663_100056233
907 Ga0070663_100356276
908 Ga0070681_10244787
909 Ga0070684_100083656
910 Ga0070695_100109845
911 Ga0068855_100002550
912 Ga0068855_100015175
913 Ga0068855_100046102
914 Ga0068855_100362487
915 Ga0070664_100053040
916 Ga0068852_100003155
917 Ga0081538_10035899
918 Ga0075365_10049409
919 Ga0075365_10171634
920 Ga0075368_10011152
921 Ga0075363_100013275
922 Ga0075363_100031268
923 Ga0075364_10028578
924 Ga0075367_10024175
925 Ga0075367_10128471
926 Ga0075366_10001529
927 Ga0075370_10008007
928 Ga0105251_10000289
929 Ga0105251_10003344
930 Ga0105244_10042867
931 Ga0105240_10001836
932 Ga0105240_10004687
933 Ga0105240_10152422
934 Ga0105240_10280288
935 Ga0105240_10310420
936 Ga0111539_10154374
937 Ga0114129_10035592
938 Ga0114129_10071128
939 Ga0105237_10004028
940 Ga0105237_10080744
941 Ga0105237_10168231
942 Ga0105238_10015560
943 Ga0123341_1002056
944 Ga0105239_10004937
945 Ga0105239_10024910
946 Ga0105239_10440605
947 Ga0157373_10001515
948 Ga0157373_10070049
949 Ga0157370_10000729
950 Ga0157370_10001391
951 Ga0157370_10133016
952 Ga0157370_10158881
953 Ga0157370_10162844
954 Ga0157370_10249643
955 Ga0157369_10000092
956 Ga0157369_10018572
957 Ga0157374_10000053
958 Ga0157374_10143955
959 Ga0163162_10002349
960 Ga0157372_10000903
961 Ga0157375_10041221
962 Ga0182007_10001667
963 Ga0182007_10006076
964 Ga0182007_10028153
965 Ga0182005_1020792
966 Ga0183361_10003
967 Ga0206353_11214724
968 Ga0214544_1000018
969 Ga0214542_1001937
970 Ga0214542_1020848
971 Ga0214543_1000042
972 Ga0214543_1000162
973 Ga0213875_10011636
974 Ga0209674_100144
975 Ga0209672_100035
976 Ga0209672_100969
977 Ga0209147_100041
978 Ga0209258_100063
979 Ga0209148_1000088
980 Ga0209759_1000008
981 Ga0209759_1004213
982 Ga0209759_1004748
983 Ga0209129_1002275
984 Ga0209565_1016228
985 Ga0209455_1000075
986 Ga0209673_1000061
987 Ga0209673_1000105
988 Ga0209673_1000452
989 Ga0209130_1009838
990 Ga0209675_1015856
991 Ga0209676_1009027
992 Ga0209025_1000555
993 Ga0209025_1076843
994 Ga0209564_1000913
995 Ga0209564_1007232
996 Ga0209564_1029115
997 Ga0209758_1000380
998 Ga0209050_1003406
999 Ga0209256_1000260
1000 Ga0209256_1000281
1001 Ga0209256_1001129
1002 Ga0207426_1000180
1003 Ga0207426_1000350
1004 Ga0209051_1000027
1005 Ga0209051_1000875
1006 Ga0209051_1001030
1007 Ga0209257_1001771
1008 Ga0209257_1010613
1009 Ga0207713_1000590
1010 Ga0207647_10005322
1011 Ga0207647_10009142
1012 Ga0207647_10011332
1013 Ga0207647_10013946
1014 Ga0207647_10040991
1015 Ga0207705_10001093
1016 Ga0207705_10015520
1017 Ga0207705_10085819
1018 Ga0207695_10004090
1019 Ga0207695_10045384
1020 Ga0207695_10193003
1021 Ga0207671_10070376
1022 Ga0207671_10119214
1023 Ga0207657_10000118
1024 Ga0207657_10005202
1025 Ga0207657_10138704
1026 Ga0207694_10042206
1027 Ga0207694_10318668
1028 Ga0207690_10000025
1029 Ga0207667_10000690
1030 Ga0207667_10105986
1031 Ga0207667_10124992
1032 Ga0207667_10359047
1033 Ga0207639_10036723
1034 Ga0207678_10000409
1035 Ga0207678_10021336
1036 Ga0207678_10261326
1037 Ga0207698_10006142
1038 Ga0209281_1000655
1039 Ga0209281_1026060
1040 Ga0209371_1000179
1041 Ga0207428_10190707
1042 Ga0307515_10125833
1043 Ga0268256_1000149
1044 Ga0307412_10000039
1045 Ga0307416_100531550
1046 Ga0307415_100235467
1047 Ga0316584_0041093
1048 Ga0395900_0022081
1049 Ga0395898_0004175
1050 Ga0395898_0027782
1051 Ga0395898_0093048
1052 Ga0395905_0000004
1053 Ga0395905_0044943
1054 Ga0395905_0199155
1055 Ga0436364_0874601
1056 Ga0436364_1224135
1057 Ga0395901_0000087
1058 Ga0395901_0000472
1059 Ga0451845_0752875
1060 Ga0451577_0004499
1061 Ga0466982_0016121
1062 Ga0466966_0009701
1063 Ga0466966_0015921
1064 Ga0466961_0000267
1065 Ga0466961_0002981
1066 Ga0466961_0012587
1067 Ga0466964_0031632
1068 Ga0466971_0074270
1069 Ga0466970_0011394
1070 Ga0466970_0159934
1071 Ga0466957_0000683
1072 Ga0466960_0000885
1073 Ga0466967_0362638
1074 Ga0495592_0000229
1075 Ga0495603_0000773
1076 Ga0495590_0003303
1077 Ga0495590_0008092
1078 Ga0495591_000101
1079 Ga0495629_0000061
1080 Ga0495629_0001559
1081 Ga0495638_0005978
1082 Ga0495638_0013689
1083 Ga0495638_0068691
1084 Ga0495651_0042719
1085 Ga0495653_0015525
1086 Ga0495653_0020633
1087 Ga0495650_0000374
1088 Ga0495580_0000681
1089 Ga0495580_0002278
1090 Ga0495580_0003123
1091 Ga0495580_0003357
1092 Ga0495582_0001818
1093 Ga0495605_0015438
1094 Ga0495639_0010060
1095 Ga0495662_0036571
1096 Ga0495664_0000769
1097 Ga0495664_0038026
1098 Ga0495596_0000146
1099 Ga0495596_0054153
1100 Ga0495583_0000449
1101 Ga0495606_0002598
1102 Ga0495606_0017686
1103 Ga0495606_0110668
1104 Ga0495608_0000241
1105 Ga0495608_0259542
1106 Ga0495610_0001301
1107 Ga0495618_0003545
1108 Ga0495620_0039116
1109 Ga0495628_0006297
1110 Ga0495628_0011596
1111 Ga0495628_0012292
1112 Ga0495628_0035810
1113 Ga0495628_0052131
1114 Ga0495630_0000147
1115 Ga0495630_0172252
1116 Ga0495644_0093133
1117 Ga0495648_0000164
1118 Ga0495666_0000107
1119 Ga0495642_0001402
1120 Ga0495642_0033944
1121 Ga0495652_0007860
1122 Ga0495652_0105248
1123 Ga0495665_0000096
1124 Ga0495665_0000827
1125 Ga0495665_0116790
1126 Ga0495586_0060666
1127 Ga0495587_0001027
1128 Ga0495597_0081349
1129 Ga0495645_0000406
1130 Ga0495667_0023170
1131 Ga0495667_0043516
1132 Ga0495668_0097025
1133 Ga0495634_0004045
1134 Ga0495611_0124345
1135 Ga0495625_0005207
1136 Ga0495635_0000218
1137 Ga0495661_0001002
1138 Ga0495657_0059132
1139 Ga0495599_0036718
1140 Ga0495623_0003510
1141 Ga0495623_0023257
1142 Ga0495646_0000478
1143 Ga0495646_0024809
1144 Ga0495646_0055263
1145 Ga0495669_0034488
1146 Ga0495613_0000353
1147 Ga0495613_0056461
1148 Ga0495624_0000869
1149 Ga0495624_0002409
1150 Ga0495670_0012082
1151 Ga0495671_0009727
1152 Ga0495649_0000211
1153 Ga0495649_0013164
1154 Ga0495649_0100030
1155 Ga0495649_0132460
1156 Ga0495589_0000213
1157 Ga0495589_0008505
1158 Ga0495589_0013243
1159 Ga0495589_0019377
1160 Ga0495600_0000806
1161 Ga0495604_0002038
1162 Ga0495604_0038957
1163 Ga0495674_0001272
1164 Ga0495674_0032197
1165 Ga0495674_0053543
1166 Ga0495674_0054612
1167 Ga0495674_0196733
1168 Ga0495672_0001724
1169 Ga0495672_0001856
1170 Ga0495676_0001988
1171 Ga0495680_0007892
1172 Ga0495680_0190117
1173 Ga0495683_0000936
1174 Ga0495683_0001354
1175 Ga0495683_0002582
1176 Ga0495683_0019460
1177 Ga0495687_000305
1178 Ga0495687_041562
1179 Ga0495687_059679
1180 Ga0495675_0000151
1181 Ga0495675_0016747
1182 Ga0495675_0035795
1183 Ga0495679_000093
1184 Ga0495673_0009269
1185 Ga0495673_0012740
1186 Ga0495684_0116116
1187 Ga0495686_0000012
1188 Ga0495593_0000123
1189 Ga0495593_0000411
1190 Ga0495593_0038002
1191 Ga0495593_0038536
1192 Ga0495602_0010286
1193 Ga0495602_0014104
1194 Ga0495602_0019708
1195 Ga0495602_0032293
1196 Ga0495614_0000524
1197 Ga0495626_0003437
1198 Ga0496100_0000313
1199 Ga0496100_0088717
1200 Ga0496101_0000892
1201 Ga0496101_0023672
1202 Ga0496102_0000734
1203 Ga0496102_0212327
1204 Ga0496103_0002991
1205 Ga0496103_0004833
1206 Ga0496103_0049758
1207 Ga0496103_0127936
1208 Ga0496104_0014261
1209 Ga0496104_0079371
1210 Ga0496104_0303975
1211 Ga0496105_0164255
1212 Ga0496106_0002793
1213 Ga0496108_0286693
1214 Ga0496109_0024896
1215 Ga0496110_0043845
1216 Ga0496110_0326972
1217 Ga0496111_0016432
1218 Ga0496112_0009464
1219 Ga0496112_0027265
1220 Ga0496113_0021558
1221 Ga0496114_0661994
1222 Ga0496115_0008532
1223 Ga0496116_0012032
1224 Ga0496116_0071965
1225 Ga0496116_0093950
1226 Ga0496117_0001465
1227 Ga0496117_0016567
1228 Ga0496117_0052953
1229 Ga0496117_0075494
1230 Ga0496118_0001565
1231 Ga0496118_0003868
1232 Ga0496118_0020901
1233 Ga0496118_0025522
1234 Ga0496118_0120171
1235 Ga0496118_0155991
1236 Ga0496118_0213432
1237 Ga0496119_0042098
1238 Ga0496121_0001850
1239 Ga0496121_0003972
1240 Ga0496121_0024861
1241 Ga0496122_0145420
1242 Ga0496123_0022635
1243 Ga0496124_0045812
1244 Ga0496124_0223471
1245 Ga0496125_0005016
1246 Ga0496125_0005544
1247 Ga0496125_0222514
1248 Ga0466983_0056004
1249 Ga0495682_0000499
1250 Ga0501031_0000002
1251 Ga0501032_0000004
1252 Ga0501032_0292052
1253 Ga0501033_0000016
1254 Ga0501033_0022199
1255 Ga0501033_0252861
1256 Ga0501034_0000011
1257 Ga0501034_0095266
1258 Ga0501034_0142592
1259 Ga0501034_0159237
1260 Ga0501036_0000001
1261 Ga0501036_0257755
1262 Ga0501036_0411542
1263 Ga0501036_0432862
1264 Ga0501037_0000006
1265 Ga0501038_0000003
1266 Ga0501039_0000004
1267 Ga0501041_0043763
1268 Ga0501043_0000588
1269 Ga0501043_0097624
1270 Ga0501046_0120294
1271 Ga0501047_0002317
1272 Ga0501048_0073176
1273 Ga0501067_0133905
1274 Ga0501070_0006153
1275 Ga0501070_0277251
1276 Ga0501075_0025257
1277 Ga0501076_0023347
1278 Ga0501081_0046376
1279 Ga0501083_0180171
1280 Ga0501035_0000009
1281 Ga0501035_0124031
1282 Ga0501044_0000005
1283 Ga0501044_0125348
1284 Ga0501045_0272011
1285 nmdc:mga03683_29342_c1
1286 nmdc:mga03n38_22420_c1
1287 nmdc:mga0yw44_72717_c1
1288 nmdc:mga0k408_71534_c1
1289 nmdc:mga06z11_84922_c1
1290 nmdc:mga07m45_106749_c1
1291 nmdc:mga07m45_15146_c1
1292 nmdc:mga05p37_519182_c1
1293 nmdc:mga08y16_169140_c1
1294 nmdc:mga08x19_6007_c1
1295 Ga0495655_0014586
1296 Ga0500568_0000162
1297 Ga0500604_0000975
1298 Ga0500604_0041608
1299 Ga0500616_0024030
1300 Ga0500627_0043826
1301 Ga0501084_0020242
1302 Ga0501082_0032027
1303 Ga0530510_0055554
1304 2952255548
1305 2501076051
1306 2501409634
1307 2503203980
1308 2508728277
1309 2509126484
1310 2509145777
1311 2509368995
1312 2509442043
1313 2510248501
1314 2510302951
1315 2510316190
1316 2511099162
1317 2511108734
1318 2511496943
1319 2512349487
1320 2512929230
1321 2512964019
1322 2513557183
1323 2513562829
1324 2513583384
1325 2513614942
1326 2513883938
1327 2513901604
1328 2513914559
1329 2513923921
1330 2513958286
1331 2514039083
1332 2514055000
1333 2514423270
1334 2515612194
1335 2515684207
1336 2516019044
1337 2516208238
1338 2516895827
1339 2517409760
1340 2517566209
1341 2524449171
1342 2527077254
1343 2551678703
1344 2551681941
1345 2551683262
1346 2551696704
1347 2551699868
1348 2551714121
1349 2551716757
1350 2551739069
1351 2551744244
1352 2555247517
1353 2585543458
1354 2585841926
1355 2586004561
1356 2588514776
1357 2599415963
1358 2600195618
1359 2643809554
1360 2644048905
1361 2644066715
1362 2644203695
1363 2644375894
1364 2644415072
1365 2644451483
1366 2644482872
1367 2644497618
1368 2644693141
1369 2657685154
1370 2687577965
1371 2688597845
1372 2719643072
1373 2723575158
1374 2725949616
1375 2738819338
1376 2738831817
1377 2738873345
1378 2739035365
1379 2739184975
1380 2739219944
1381 2756676269
1382 2770197592
1383 2792580917
1384 2792839802
1385 2793312621
1386 2793370352
1387 2802754069
1388 2804754408
1389 2806048287
1390 2806056072
1391 2806062889
1392 2806070493
1393 2806077403
1394 2817263304
1395 2817276685
1396 2819619371
1397 2834578491
1398 2838036079
1399 2838078443
1400 2838667355
1401 2841865942
1402 2842334196
1403 2842364188
1404 2842397198
1405 2842458039
1406 2844004812
1407 2844009656
1408 2854913499
1409 2855829356
1410 2855844455
1411 2856329944
1412 2856337098
1413 2856346946
1414 2856358942
1415 2857371536
1416 2858806084
1417 2863426696
1418 2869170322
1419 2869246219
1420 2869250204
1421 2869257306
1422 2869270402
1423 2869273207
1424 2871440605
1425 2871457518
1426 2871460367
1427 2871468577
1428 2871477568
1429 2871482985
1430 2871492052
1431 2874112153
1432 2874117777
1433 2874130938
1434 2874131920
1435 2874163927
1436 2874171248
1437 2876367214
1438 2876392047
1439 2876401585
1440 2876407261
1441 2876422958
1442 2878736974
1443 2878754770
1444 2878776938
1445 2878787763
1446 2878797023
1447 2881863226
1448 2882463633
1449 2882638913
1450 2882639279
1451 2882917055
1452 2883087669
1453 2885273554
1454 2885318391
1455 2888346614
1456 2896389464
1457 2902687454
1458 2903453318
1459 2903504896
1460 2903519623
1461 2903526705
1462 2903530676
1463 2903531340
1464 2904566775
1465 2904573820
1466 2904621546
1467 2906364017
1468 2906371703
1469 2906385882
1470 2906393430
1471 2906407773
1472 2906409614
1473 2906433365
1474 2908673595
1475 2909046062
1476 2913297166
1477 2915988125
1478 2915993831
1479 2916005466
1480 2916008812
1481 2916021502
1482 2916021663
1483 2916028526
1484 2916037521
1485 2916042015
1486 2916048787
1487 2916059863
1488 2916073897
1489 2916077492
1490 2919532751
1491 2919680608
1492 2920765186
1493 2921205313
1494 2921212103
1495 2921237338
1496 2921249227
1497 2921259458
1498 2921268094
1499 2921288646
1500 2921295098
1501 2921298805
1502 2921654274
1503 2922151600
1504 2922172951
1505 2922184290
1506 2924150427
1507 2924157184
1508 2924161705
1509 2924171198
1510 2924175039
1511 2924182710
1512 2924189121
1513 2924196817
1514 2924200541
1515 2924212090
1516 2924217761
1517 2924223659
1518 2924233400
1519 2924740683
1520 2924746060
1521 2924751017
1522 2924760940
1523 2924767786
1524 2924790990
1525 2928111606
1526 2928138408
1527 2928163527
1528 2928166586
1529 2928504783
1530 2928542948
1531 2933018378
1532 2936998405
1533 2937002997
1534 2937009846
1535 2937020000
1536 2937025164
1537 2937049725
1538 2937054576
1539 2937058650
1540 2937063926
1541 2937077745
1542 2937094418
1543 2937101442
1544 2937108028
1545 2937115426
1546 2937120085
1547 2937128212
1548 2937824083
1549 2937841998
1550 2937845855
1551 2937850259
1552 2937865789
1553 2937874687
1554 2937983617
1555 2939671252
1556 2945940353
1557 2957382273
1558 2957395518
1559 2957397984
1560 2957404281
1561 2957414786
1562 2957421120
1563 2957426708
1564 2957431344
1565 2957446009
1566 2957451110
1567 2957461743
1568 2957465976
1569 2957474525
1570 2957483296
1571 2957491268
1572 2957496573
1573 2957502011
1574 2957505537
1575 2958071678
1576 2958110669
1577 2958130170
1578 2958139248
1579 2958159280
1580 2960584077
1581 2960603094
1582 2960604154
1583 2960610946
1584 2960622311
1585 2960624371
1586 2960637979
1587 2960649236
1588 2960653282
1589 2960663691
1590 2960667512
1591 2960676577
1592 2961139376
1593 2961173852
1594 2961185842
1595 2963650007
1596 2964611038
1597 2964615467
1598 2964628160
1599 2964628968
1600 2964636074
1601 2964643430
1602 2964653969
1603 2964656670
1604 2964664050
1605 2964676913
1606 2964682325
1607 2964690728
1608 2964698856
1609 2964707582
1610 2964717772
1611 2964721805
1612 2965031133
1613 2965039806
1614 2965045513
1615 2965050910
1616 2965090826
1617 2967664510
1618 2967672457
1619 2967683267
1620 2967698569
1621 2967713892
1622 2967718642
1623 2967723155
1624 2967737462
1625 2967748067
1626 2967749226
1627 2967755978
1628 2967762531
1629 2967769405
1630 2967778396
1631 2967999101
1632 2968006785
1633 2968086682
1634 2968141883
1635 2970019700
1636 2970027026
1637 2970033905
1638 2970044086
1639 2970051038
1640 2970058367
1641 2970065193
1642 2970075856
1643 2970077961
1644 2970084513
1645 2970091858
1646 2970097706
1647 2970102933
1648 2970111386
1649 2970119006
1650 2970135380
1651 2970143511
1652 2970152179
1653 2970160098
1654 2970164818
1655 2970171234
1656 2970179969
1657 2970191445
1658 2970195060
1659 2970491475
1660 2970506481
1661 2970517781
1662 2970528176
1663 2970543769
1664 2970554572
1665 2970622118
1666 2970631240
1667 2977521731
1668 2977525820
1669 2977539887
1670 2977556205
1671 2977559112
1672 2977566030
1673 2977574541
1674 2977584979
1675 2977823987
1676 2977834145
1677 2977856400
1678 2977878625
1679 2977902422
1680 2977908710
1681 2977921513
1682 2977927520
1683 2977937152
1684 2977955507
1685 2977990834
1686 2979769306
1687 2979779413
1688 2979799643
1689 2979811087
1690 2987649795
1691 2987671758
1692 2987678592
1693 2990707481
1694 2996337079
1695 2996389748
1696 3004171977
1697 3004198166
1698 3004213563
1699 3004223154
1700 3004235247
1701 3004243832
1702 3004252323
1703 3004271504
1704 3004338720
1705 642423921
1706 642414442
1707 642595631
1708 8003955966
1709 8003996979
1710 8004304029
1711 8004315636
1712 8004369181
1713 8004376352
1714 8004403635
1715 8004639162
1716 8004700986
1717 8004728424
1718 8005571597
1719 8005685941
1720 8020812301
1721 8020941508
1722 8020955474
1723 8039099607
1724 8040172008
1725 8040177971
1726 8055272116
1727 8055620310
1728 8056377873
1729 8057135584
1730 8057160890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24827

47

235

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6twm-assembly13.cif.gz_D product bound structure of the ectoine utilization protein eute (doeb) from ruegeria pomeroyi 0.9799 1 332
6twm-assembly10.cif.gz_J product bound structure of the ectoine utilization protein eute (doeb) from ruegeria pomeroyi 0.978 2 332
6twm-assembly14.cif.gz_L product bound structure of the ectoine utilization protein eute (doeb) from ruegeria pomeroyi 0.9748 2 332
6twm-assembly13.cif.gz_D product bound structure of the ectoine utilization protein eute (doeb) from ruegeria pomeroyi 0.974 1 332
6twm-assembly10.cif.gz_J product bound structure of the ectoine utilization protein eute (doeb) from ruegeria pomeroyi 0.9721 2 332
ID Description Score Start End Superfamily
3na6A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9588 2 333 3.40.630.10
3na6A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9529 2 333 3.40.630.10
3cdxD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9475 4 334 3.40.630.10
3cdxD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9447 4 334 3.40.630.10
2qj8A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9191 3 336 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A355JS16-F1-model_v4 deleted 0.9978 1 170
AF-A0A6N9AZ58-F1-model_v4 N-alpha-acetyl diaminobutyric acid deacetylase DoeB 0.9961 1 122 GO:0016788
GO:0046872
AF-A0A7G2LZ91-F1-model_v4 N-alpha-acetyl diaminobutyric acid deacetylase DoeB 0.9954 1 148 GO:0016788
GO:0046872
AF-A0A531KBW6-F1-model_v4 N-alpha-acetyl diaminobutyric acid deacetylase DoeB 0.9949 1 95 GO:0016788
GO:0046872
AF-A0A381U6R9-F1-model_v4 Peptidase M14 carboxypeptidase A domain-containing protein 0.9948 1 102 GO:0016788
GO:0046872

Map