F484015

General Info

Members Datasets Scaffolds Average Seq Length
865 532 711 382

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8048127548|8048136738
Length 473
Sequence ALHSDADPHGEPHADPHGAPRGGTDPRGGNAPHSAPAPHSAPASHSDQAPHSAPASHGEAPHSGADPNHGHSQGDQERLRRWRLVLGGQGADGTGCSLSGADAAMDRTLEALYGSGGGGGSGGDGATAGRGGGSQGAASGARSGGLGGSAPQVARWLGDIRTYFPTSVVQVMQRDAIDRLGLSALLLEPEMLEAVEADVHLVGTLLSLNKAMPETTKNTARAVVRKVVADLEKRLATRTRATLTGALDRSARISRPRHRDIDWDRTIRANLKNYLPDHRTVVPERLIGFGRAARGVKKDVVLCIDQSGSMAASVVYASVFGAVLASMRSLATRLVVFDTSVVDLTEELDDPVDVLFGTQLGGGTDINRALAYCQSQITRPADTVVVLISDLYEGGIREEMLGRVAAMKASGVQFVALLALSDEGAPSYDREHAAALAALGAPAFACTPDLFPEVMAAAIERRQLPIPDMAMHQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
3 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
4 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
5 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
6 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
7 2547132424 Nocardia nova SH22a Isolate Unclassified
8 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
9 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
10 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
11 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
12 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
13 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
14 2643221548 Streptomyces sp. Root55 Isolate Unclassified
15 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
16 2643221578 Streptomyces sp. Root63 Isolate Unclassified
17 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
18 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
19 2643221641 Nocardioides sp. Root122 Isolate Unclassified
20 2643221670 Streptomyces sp. Root431 Isolate Unclassified
21 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
22 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
23 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
24 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
25 2643221692 Nocardia sp. Root136 Isolate Unclassified
26 2643221714 Streptomyces sp. Root264 Isolate Unclassified
27 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
28 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
29 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
30 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
31 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
32 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
33 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
34 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
35 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
36 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
37 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
38 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
39 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
40 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
41 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
42 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
43 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
44 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
45 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
46 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
47 2842711865 Duganella sp. R-73148 Isolate Unclassified
48 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
49 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
50 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
51 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
52 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
53 2862574272 Streptomyces sp. AcE210 Isolate Nodule
54 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
55 2867369537 Streptomyces sp. Z26 Isolate Unclassified
56 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
57 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
58 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
59 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
60 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
61 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
62 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
63 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
64 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
65 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
66 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
67 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
68 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
69 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
70 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
71 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
72 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
73 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
74 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
75 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
76 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
77 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
78 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
79 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
80 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
81 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
82 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
83 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
84 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
85 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
86 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
87 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
88 2922554459 Rhodococcus sp. 66b Isolate Unclassified
89 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
90 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
91 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
92 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
93 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
94 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
95 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
96 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
97 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
98 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
99 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
100 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
101 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
102 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
103 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
104 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
105 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
106 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
107 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
108 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
109 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
110 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
111 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
112 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
113 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
114 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
115 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
116 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
117 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
118 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
119 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
120 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
121 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
122 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
123 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
124 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
125 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
126 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
127 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
128 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
129 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
130 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
131 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
132 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
133 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
134 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
135 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
136 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
137 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
138 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
139 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
140 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
141 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
142 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
143 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
144 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
145 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
146 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
147 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
148 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
149 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
150 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
151 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
152 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
153 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
154 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
155 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
156 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
157 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
158 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
159 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
160 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
161 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
162 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
163 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
164 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
165 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
166 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
167 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
168 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
169 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
170 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
171 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
172 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
173 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
174 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
175 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
176 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
177 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
178 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
179 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
180 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
181 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
182 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
183 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
184 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
185 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
186 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
187 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
188 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
189 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
190 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
191 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
192 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
193 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
194 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
195 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
196 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
197 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
198 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
199 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
200 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
201 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
202 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
203 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
204 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
205 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
206 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
207 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
208 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
209 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
210 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
211 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
212 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
213 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
214 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
215 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
216 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
217 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
218 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
219 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
220 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
221 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
222 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
223 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
224 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
225 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
226 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
227 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
228 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
229 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
230 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
231 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
232 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
233 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
234 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
235 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
236 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
237 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
238 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
239 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
240 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
241 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
242 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
243 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
244 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
245 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
246 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
247 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
248 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
249 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
250 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
251 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
252 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
253 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
254 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
255 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
256 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
257 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
258 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
259 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
260 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
261 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
262 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
263 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
264 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
265 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
267 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
268 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
270 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
272 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
275 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
326 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
327 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
331 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
332 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
333 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
334 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
335 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
336 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
337 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
338 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
339 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
340 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
341 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
342 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
343 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
344 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
345 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
346 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
347 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
348 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
349 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
350 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
351 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
352 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
353 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
354 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
355 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
356 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
357 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
358 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
359 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
360 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
361 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
362 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
363 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
364 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
365 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
366 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
367 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
368 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
369 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
370 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
371 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
372 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
373 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
374 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
375 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
376 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
377 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
378 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
379 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
380 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
381 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
382 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
383 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
384 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
385 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
386 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
387 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
388 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
389 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
390 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
391 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
392 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
393 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
394 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
395 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
396 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
397 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
398 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
399 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
400 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
401 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
402 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
403 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
404 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
405 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
406 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
407 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
408 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
409 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
410 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
411 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
412 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
413 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
414 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
415 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
416 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
417 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
418 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
419 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
420 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
421 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
422 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
423 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
424 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
425 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
426 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
427 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
428 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
429 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
430 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
431 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
432 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
433 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
434 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
435 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
436 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
437 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
438 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
439 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
440 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
441 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
442 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
443 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
444 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
445 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
446 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
447 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
448 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
449 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
450 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
451 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
452 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
453 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
454 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
455 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
456 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
457 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
458 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
459 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
460 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
461 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
462 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
463 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
464 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
465 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
466 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
467 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
468 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
469 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
470 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
471 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
472 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
473 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
474 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
475 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
476 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
477 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
478 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
479 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
480 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
481 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
482 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
483 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
486 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
487 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
488 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
489 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
490 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
491 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
492 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
493 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
494 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
495 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
496 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
497 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
498 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
499 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
500 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
501 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
502 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
503 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
504 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
505 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
506 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
507 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
508 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
509 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
510 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
511 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
512 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
513 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
514 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
515 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
516 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
517 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
518 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
519 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
520 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
521 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
522 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
523 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
524 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
525 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
526 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
527 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
528 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
529 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
530 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
531 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
532 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.2
Metatranscriptomes 0.12
Isolates 17.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 10.06
Nodule 5.32
Rhizoplane 2.31
Rhizosphere 69.48
Stem 0
Stem Tuber 0
Unclassified 12.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1267809 2162886007 Bacteria 14646
2 JGI24739J22299_10015637 3300001989 Bacteria 2757
3 JGI24737J22298_10025636 3300001990 Bacteria 1863
4 JGI25158J39367_1000567 3300002739 Bacteria 7397
5 JGI25150J39212_1001901 3300002774 Bacteria 5487
6 JGI25151J46595_10001059 3300003187 Bacteria 20504
7 JGI25151J46595_10001387 3300003187 Bacteria 16722
8 JGI25406J46586_10002652 3300003203 Bacteria 8431
9 JGI25406J46586_10009297 3300003203 Bacteria 4403
10 JGI25406J46586_10021263 3300003203 Bacteria 2607
11 JGI25165J46597_1000039 3300003214 Bacteria 281327
12 rootH1_10064618 3300003316 Bacteria 5790
13 rootH2_10005368 3300003320 Bacteria 40413
14 rootH2_10144896 3300003320 Bacteria 3809
15 rootH1_10083982 3300003323 Bacteria 5860
16 JGI25407J50210_10027726 3300003373 Bacteria 1469
17 JGI25161J50226_1001752 3300003374 Bacteria 6135
18 Ga0006562J51391_1125310 3300003578 Bacteria 1930
19 JGI25404J52841_10006877 3300003659 Bacteria 2391
20 Ga0055526_1002198 3300003771 Bacteria 13368
21 Ga0055526_1003340 3300003771 Bacteria 10257
22 Ga0055526_1003735 3300003771 Bacteria 9505
23 Ga0055537_1003335 3300003773 Bacteria 4967
24 Ga0055537_1010650 3300003773 Bacteria 1924
25 Ga0055524_1000450 3300003775 Bacteria 34034
26 Ga0055524_1000791 3300003775 Bacteria 21049
27 Ga0055536_1006996 3300003781 Bacteria 5130
28 Ga0055534_1001013 3300003784 Bacteria 12325
29 Ga0055528_1018501 3300003790 Bacteria 2359
30 Ga0055530_10002948 3300003791 Bacteria 10282
31 Ga0055540_1003365 3300003792 Bacteria 7755
32 Ga0055531_10001962 3300003794 Bacteria 14354
33 Ga0065165_1006104 3300005262 Bacteria 6454
34 Ga0070658_10001625 3300005327 Bacteria 18999
35 Ga0070658_10045612 3300005327 Bacteria 3544
36 Ga0070658_10115006 3300005327 Bacteria 2232
37 Ga0070683_100000671 3300005329 Bacteria 24760
38 Ga0070683_100001811 3300005329 Bacteria 16656
39 Ga0068869_100024799 3300005334 Bacteria 4157
40 Ga0068869_100104963 3300005334 Bacteria 2142
41 Ga0070682_100096187 3300005337 Bacteria 1946
42 Ga0070682_100196309 3300005337 Bacteria 1421
43 Ga0068868_100091754 3300005338 Bacteria 2447
44 Ga0070660_100132708 3300005339 Bacteria 1994
45 Ga0070660_100146798 3300005339 Bacteria 1895
46 Ga0070691_10071870 3300005341 Bacteria 1680
47 Ga0070661_100011520 3300005344 Bacteria 6159
48 Ga0070661_100040979 3300005344 Bacteria 3379
49 Ga0070675_100000369 3300005354 Bacteria 30439
50 Ga0070671_100027614 3300005355 Bacteria 4673
51 Ga0070659_100006971 3300005366 Bacteria 8182
52 Ga0070659_100021238 3300005366 Bacteria 4939
53 Ga0070659_100039202 3300005366 Bacteria 3698
54 Ga0070667_100144212 3300005367 Bacteria 2087
55 Ga0070714_100059490 3300005435 Bacteria 3276
56 Ga0070714_100096985 3300005435 Bacteria 2591
57 Ga0070714_100251398 3300005435 Bacteria 1634
58 Ga0070713_100417549 3300005436 Bacteria 1255
59 Ga0070710_10009896 3300005437 Bacteria 4673
60 Ga0070711_100039410 3300005439 Bacteria 3183
61 Ga0070705_100085478 3300005440 Bacteria 1950
62 Ga0070700_100059747 3300005441 Bacteria 2401
63 Ga0070708_100019427 3300005445 Bacteria 5708
64 Ga0070708_100051262 3300005445 Bacteria 3656
65 Ga0070663_100102684 3300005455 Bacteria 2136
66 Ga0070678_100065444 3300005456 Bacteria 2699
67 Ga0070681_10046107 3300005458 Bacteria 4358
68 Ga0070681_10088822 3300005458 Bacteria 3042
69 Ga0070681_10104143 3300005458 Bacteria 2780
70 Ga0070681_10197585 3300005458 Bacteria 1930
71 Ga0070706_100115397 3300005467 Bacteria 2500
72 Ga0070707_100038868 3300005468 Bacteria 4546
73 Ga0070707_100086237 3300005468 Bacteria 3036
74 Ga0070698_100016331 3300005471 Bacteria 7838
75 Ga0070698_100020283 3300005471 Bacteria 6966
76 Ga0070698_100066310 3300005471 Bacteria 3634
77 Ga0070699_100280056 3300005518 Bacteria 1494
78 Ga0070679_100071710 3300005530 Bacteria 3455
79 Ga0070679_100299857 3300005530 Bacteria 1557
80 Ga0070684_100012852 3300005535 Bacteria 6726
81 Ga0070684_100027661 3300005535 Bacteria 4789
82 Ga0070684_100101345 3300005535 Bacteria 2573
83 Ga0070684_100174109 3300005535 Bacteria 1955
84 Ga0070684_100276657 3300005535 Bacteria 1537
85 Ga0070697_100008052 3300005536 Bacteria 8221
86 Ga0068853_100031289 3300005539 Bacteria 4501
87 Ga0068853_100284578 3300005539 Bacteria 1524
88 Ga0070695_100129979 3300005545 Bacteria 1735
89 Ga0070696_100032382 3300005546 Bacteria 3586
90 Ga0070696_100138958 3300005546 Bacteria 1773
91 Ga0070693_100105596 3300005547 Bacteria 1723
92 Ga0070665_100001114 3300005548 Bacteria 33120
93 Ga0070665_100023955 3300005548 Bacteria 6147
94 Ga0070704_100084124 3300005549 Bacteria 2351
95 Ga0070704_100092883 3300005549 Bacteria 2253
96 Ga0068855_100153436 3300005563 Bacteria 2618
97 Ga0068855_100210081 3300005563 Bacteria 2187
98 Ga0068855_100454757 3300005563 Bacteria 1397
99 Ga0070664_100000532 3300005564 Bacteria 29069
100 Ga0070664_100003301 3300005564 Bacteria 13031
101 Ga0070664_100242262 3300005564 Bacteria 1619
102 Ga0068857_100040971 3300005577 Bacteria 4106
103 Ga0068857_100163975 3300005577 Bacteria 2017
104 Ga0068857_100278575 3300005577 Bacteria 1538
105 Ga0068857_100363315 3300005577 Bacteria 1342
106 Ga0068854_100006144 3300005578 Bacteria 7622
107 Ga0068856_100079285 3300005614 Bacteria 3256
108 Ga0068856_100296408 3300005614 Bacteria 1634
109 Ga0068856_100326355 3300005614 Bacteria 1552
110 Ga0068852_100124886 3300005616 Bacteria 2361
111 Ga0068852_100170587 3300005616 Bacteria 2039
112 Ga0068864_100412060 3300005618 Bacteria 1286
113 Ga0068866_10006030 3300005718 Bacteria 5043
114 Ga0068861_100330252 3300005719 Bacteria 1331
115 Ga0068851_10050907 3300005834 Bacteria 2104
116 Ga0068863_100020744 3300005841 Bacteria 6276
117 Ga0068863_100040401 3300005841 Bacteria 4435
118 Ga0068863_100259097 3300005841 Bacteria 1681
119 Ga0068860_100000071 3300005843 Bacteria 178413
120 Ga0068860_100000255 3300005843 Bacteria 78861
121 Ga0068860_100161277 3300005843 Bacteria 2162
122 Ga0068860_100176653 3300005843 Bacteria 2064
123 Ga0068862_100005493 3300005844 Bacteria 10592
124 Ga0068862_100072050 3300005844 Bacteria 2984
125 Ga0081455_10004863 3300005937 Bacteria 14908
126 Ga0081538_10001154 3300005981 Bacteria 27904
127 Ga0081538_10013228 3300005981 Bacteria 6547
128 Ga0081540_1000015 3300005983 Bacteria 178704
129 Ga0081540_1001911 3300005983 Bacteria 17449
130 Ga0081540_1004872 3300005983 Bacteria 10110
131 Ga0081539_10000004 3300005985 Bacteria 555600
132 Ga0081539_10000451 3300005985 Bacteria 87519
133 Ga0081539_10000467 3300005985 Bacteria 85390
134 Ga0081539_10001898 3300005985 Bacteria 32399
135 Ga0081539_10006126 3300005985 Bacteria 11721
136 Ga0081539_10006835 3300005985 Bacteria 10670
137 Ga0081539_10042833 3300005985 Bacteria 2632
138 Ga0070717_10012318 3300006028 Bacteria 6520
139 Ga0070717_10030855 3300006028 Bacteria 4307
140 Ga0070717_10090369 3300006028 Unclassified 2584
141 Ga0075365_10003004 3300006038 Bacteria 8545
142 Ga0075365_10004609 3300006038 Bacteria 7334
143 Ga0075365_10122000 3300006038 Bacteria 1798
144 Ga0075364_10066982 3300006051 Bacteria 2360
145 Ga0075364_10186742 3300006051 Bacteria 1404
146 Ga0075364_10194894 3300006051 Bacteria 1372
147 Ga0075432_10000047 3300006058 Bacteria 23585
148 Ga0070716_100046612 3300006173 Bacteria 2440
149 Ga0075369_10024745 3300006186 Bacteria 2491
150 Ga0075366_10005045 3300006195 Bacteria 7135
151 Ga0075370_10001643 3300006353 Bacteria 9868
152 Ga0075428_100003309 3300006844 Bacteria 17624
153 Ga0075428_100045640 3300006844 Bacteria 4814
154 Ga0075430_100001290 3300006846 Bacteria 20218
155 Ga0075430_100005621 3300006846 Bacteria 10586
156 Ga0075430_100236181 3300006846 Bacteria 1515
157 Ga0075431_100010614 3300006847 Bacteria 9263
158 Ga0075431_100058906 3300006847 Bacteria 3963
159 Ga0075431_100072337 3300006847 Bacteria 3558
160 Ga0075431_100075559 3300006847 Bacteria 3477
161 Ga0075431_100227080 3300006847 Bacteria 1903
162 Ga0075434_100000827 3300006871 Bacteria 24603
163 Ga0075434_100006533 3300006871 Bacteria 10693
164 Ga0075434_100304704 3300006871 Bacteria 1613
165 Ga0075429_100000537 3300006880 Bacteria 28841
166 Ga0075429_100079454 3300006880 Bacteria 2859
167 Ga0068865_100018795 3300006881 Bacteria 4466
168 Ga0068865_100021210 3300006881 Bacteria 4223
169 Ga0075436_100018212 3300006914 Bacteria 4810
170 Ga0075435_100000832 3300007076 Bacteria 19263
171 Ga0075435_100001304 3300007076 Bacteria 16034
172 Ga0105251_10000041 3300009011 Bacteria 115207
173 Ga0105240_10054444 3300009093 Bacteria 5014
174 Ga0105240_10178645 3300009093 Bacteria 2507
175 Ga0105240_10255687 3300009093 Bacteria 2023
176 Ga0105240_10336930 3300009093 Bacteria 1714
177 Ga0111539_10000480 3300009094 Bacteria 50456
178 Ga0111539_10321853 3300009094 Bacteria 1799
179 Ga0105245_10058773 3300009098 Bacteria 3461
180 Ga0105247_10140881 3300009101 Bacteria 1580
181 Ga0114129_10001682 3300009147 Bacteria 30160
182 Ga0114129_10033119 3300009147 Bacteria 7303
183 Ga0114129_10150287 3300009147 Bacteria 3187
184 Ga0105243_10011746 3300009148 Bacteria 6622
185 Ga0105241_10273655 3300009174 Bacteria 1440
186 Ga0105242_10242970 3300009176 Bacteria 1619
187 Ga0105248_10025817 3300009177 Bacteria 6533
188 Ga0105237_10001657 3300009545 Bacteria 28897
189 Ga0105237_10032791 3300009545 Bacteria 5259
190 Ga0105237_10037081 3300009545 Bacteria 4929
191 Ga0105238_10000004 3300009551 Bacteria 390514
192 Ga0105238_10021926 3300009551 Bacteria 6508
193 Ga0105249_10010321 3300009553 Bacteria 8208
194 Ga0105249_10099301 3300009553 Bacteria 2735
195 Ga0099796_10036742 3300010159 Bacteria 1633
196 Ga0105239_10001124 3300010375 Bacteria 36876
197 Ga0105239_10026627 3300010375 Bacteria 6364
198 Ga0105239_10034240 3300010375 Bacteria 5577
199 Ga0105239_10246401 3300010375 Bacteria 2006
200 Ga0157373_10009233 3300013100 Bacteria 7291
201 Ga0157373_10076211 3300013100 Bacteria 2367
202 Ga0157373_10134816 3300013100 Bacteria 1736
203 Ga0157371_10012563 3300013102 Bacteria 6468
204 Ga0157370_10000627 3300013104 Bacteria 44044
205 Ga0157370_10046598 3300013104 Bacteria 4156
206 Ga0157369_10007469 3300013105 Bacteria 12585
207 Ga0157369_10145036 3300013105 Bacteria 2510
208 Ga0157378_10168094 3300013297 Bacteria 2055
209 Ga0163162_10174095 3300013306 Bacteria 2277
210 Ga0157372_10028130 3300013307 Bacteria 6133
211 Ga0157372_10085383 3300013307 Bacteria 3579
212 Ga0157372_10145736 3300013307 Bacteria 2731
213 Ga0157372_10159026 3300013307 Bacteria 2610
214 Ga0157372_10310372 3300013307 Bacteria 1836
215 Ga0157375_10087246 3300013308 Bacteria 3172
216 Ga0163163_10006460 3300014325 Bacteria 10254
217 Ga0163163_10008884 3300014325 Bacteria 8947
218 Ga0163163_10039681 3300014325 Bacteria 4596
219 Ga0163163_10068004 3300014325 Bacteria 3544
220 Ga0182008_10003788 3300014497 Bacteria 8991
221 Ga0182008_10075848 3300014497 Bacteria 1654
222 Ga0157377_10032620 3300014745 Bacteria 2837
223 Ga0157379_10010078 3300014968 Bacteria 8238
224 Ga0157379_10038798 3300014968 Bacteria 4249
225 Ga0157379_10052216 3300014968 Bacteria 3651
226 Ga0157376_10020637 3300014969 Bacteria 5102
227 Ga0182006_1001099 3300015261 Bacteria 17308
228 Ga0182007_10003249 3300015262 Bacteria 7735
229 Ga0182007_10018442 3300015262 Bacteria 2527
230 Ga0163161_10000142 3300017792 Bacteria 66331
231 Ga0163161_10031482 3300017792 Bacteria 3780
232 Ga0213876_10010848 3300021384 Bacteria 4880
233 Ga0213875_10000331 3300021388 Bacteria 44957
234 Ga0213875_10004055 3300021388 Bacteria 8150
235 Ga0213875_10037269 3300021388 Bacteria 2291
236 Ga0213875_10056079 3300021388 Bacteria 1845
237 Ga0209436_101227 3300025208 Bacteria 9281
238 Ga0207425_1000056 3300025245 Bacteria 151802
239 Ga0207425_1000151 3300025245 Bacteria 59370
240 Ga0209129_1000038 3300025258 Bacteria 322778
241 Ga0209129_1003627 3300025258 Bacteria 6577
242 Ga0209129_1004124 3300025258 Bacteria 5893
243 Ga0209233_1000052 3300025261 Bacteria 445813
244 Ga0209565_1000501 3300025263 Bacteria 28534
245 Ga0209565_1000502 3300025263 Bacteria 28534
246 Ga0209565_1004868 3300025263 Bacteria 4008
247 Ga0209565_1008129 3300025263 Bacteria 2768
248 Ga0209673_1009204 3300025273 Bacteria 4307
249 Ga0209673_1010066 3300025273 Bacteria 4022
250 Ga0209130_1003667 3300025284 Bacteria 6349
251 Ga0209675_1000558 3300025291 Bacteria 26945
252 Ga0209675_1009032 3300025291 Bacteria 3573
253 Ga0209675_1009200 3300025291 Bacteria 3514
254 Ga0209676_1000416 3300025292 Bacteria 76249
255 Ga0209025_1000290 3300025294 Bacteria 113067
256 Ga0209564_1000129 3300025295 Bacteria 195163
257 Ga0209564_1000311 3300025295 Bacteria 95587
258 Ga0209564_1010763 3300025295 Bacteria 4172
259 Ga0209758_1000177 3300025297 Bacteria 142824
260 Ga0209758_1000197 3300025297 Bacteria 133706
261 Ga0209050_1000011 3300025298 Bacteria 914037
262 Ga0209050_1000164 3300025298 Bacteria 154628
263 Ga0209050_1001877 3300025298 Bacteria 20182
264 Ga0209256_1000660 3300025299 Bacteria 46727
265 Ga0209256_1000702 3300025299 Bacteria 44556
266 Ga0207426_1008183 3300025302 Bacteria 4258
267 Ga0209051_1000389 3300025303 Bacteria 61949
268 Ga0209257_1000003 3300025304 Bacteria 1702593
269 Ga0209257_1011217 3300025304 Bacteria 4352
270 Ga0207656_10028592 3300025321 Bacteria 2289
271 Ga0207696_1015392 3300025711 Bacteria 2595
272 Ga0207713_1000776 3300025735 Bacteria 29490
273 Ga0207692_10068894 3300025898 Bacteria 1857
274 Ga0207688_10010839 3300025901 Bacteria 4959
275 Ga0207647_10005500 3300025904 Bacteria 9274
276 Ga0207699_10018571 3300025906 Bacteria 3687
277 Ga0207699_10019736 3300025906 Bacteria 3600
278 Ga0207699_10031049 3300025906 Bacteria 2996
279 Ga0207699_10098151 3300025906 Bacteria 1852
280 Ga0207643_10010314 3300025908 Bacteria 5029
281 Ga0207705_10029260 3300025909 Bacteria 3927
282 Ga0207654_10083168 3300025911 Bacteria 1932
283 Ga0207695_10001226 3300025913 Bacteria 43942
284 Ga0207695_10041847 3300025913 Bacteria 4900
285 Ga0207695_10077208 3300025913 Bacteria 3384
286 Ga0207671_10015271 3300025914 Bacteria 6027
287 Ga0207663_10237426 3300025916 Bacteria 1335
288 Ga0207660_10042774 3300025917 Unclassified 3181
289 Ga0207660_10068256 3300025917 Bacteria 2578
290 Ga0207662_10119748 3300025918 Bacteria 1650
291 Ga0207657_10015924 3300025919 Bacteria 7264
292 Ga0207657_10098975 3300025919 Bacteria 2423
293 Ga0207649_10008179 3300025920 Bacteria 5695
294 Ga0207649_10112645 3300025920 Bacteria 1820
295 Ga0207652_10193469 3300025921 Bacteria 1829
296 Ga0207652_10255747 3300025921 Bacteria 1580
297 Ga0207646_10042682 3300025922 Bacteria 4073
298 Ga0207646_10124762 3300025922 Bacteria 2315
299 Ga0207694_10000021 3300025924 Bacteria 300246
300 Ga0207659_10008569 3300025926 Bacteria 6357
301 Ga0207664_10000778 3300025929 Bacteria 21525
302 Ga0207664_10051907 3300025929 Bacteria 3240
303 Ga0207664_10082181 3300025929 Bacteria 2623
304 Ga0207664_10141329 3300025929 Bacteria 2037
305 Ga0207664_10165152 3300025929 Bacteria 1891
306 Ga0207690_10058506 3300025932 Bacteria 2607
307 Ga0207690_10078437 3300025932 Bacteria 2298
308 Ga0207690_10114158 3300025932 Bacteria 1950
309 Ga0207690_10125823 3300025932 Bacteria 1869
310 Ga0207706_10008456 3300025933 Bacteria 9494
311 Ga0207706_10027722 3300025933 Bacteria 5064
312 Ga0207686_10011919 3300025934 Bacteria 4771
313 Ga0207686_10048146 3300025934 Bacteria 2639
314 Ga0207709_10000159 3300025935 Bacteria 91803
315 Ga0207709_10000195 3300025935 Bacteria 80988
316 Ga0207709_10064486 3300025935 Bacteria 2300
317 Ga0207669_10008983 3300025937 Bacteria 4727
318 Ga0207665_10003476 3300025939 Bacteria 10525
319 Ga0207665_10017054 3300025939 Bacteria 4769
320 Ga0207665_10207193 3300025939 Bacteria 1431
321 Ga0207691_10045724 3300025940 Bacteria 4024
322 Ga0207689_10005696 3300025942 Bacteria 11078
323 Ga0207689_10010688 3300025942 Bacteria 7897
324 Ga0207689_10260614 3300025942 Bacteria 1434
325 Ga0207661_10053780 3300025944 Bacteria 3223
326 Ga0207661_10059103 3300025944 Bacteria 3088
327 Ga0207661_10181988 3300025944 Bacteria 1836
328 Ga0207661_10230636 3300025944 Bacteria 1639
329 Ga0207679_10039445 3300025945 Bacteria 3372
330 Ga0207679_10211438 3300025945 Bacteria 1627
331 Ga0207667_10000019 3300025949 Bacteria 386233
332 Ga0207667_10325864 3300025949 Bacteria 1568
333 Ga0207712_10031583 3300025961 Bacteria 3568
334 Ga0207712_10132825 3300025961 Bacteria 1899
335 Ga0207668_10018896 3300025972 Bacteria 4345
336 Ga0207668_10039250 3300025972 Bacteria 3185
337 Ga0207640_10057398 3300025981 Bacteria 2560
338 Ga0207658_10029535 3300025986 Bacteria 3873
339 Ga0207677_10207273 3300026023 Bacteria 1563
340 Ga0207703_10193940 3300026035 Bacteria 1801
341 Ga0207639_10054204 3300026041 Bacteria 3064
342 Ga0207639_10167097 3300026041 Bacteria 1860
343 Ga0207678_10017147 3300026067 Bacteria 6359
344 Ga0207708_10001255 3300026075 Bacteria 19111
345 Ga0207708_10021046 3300026075 Bacteria 4921
346 Ga0207702_10050707 3300026078 Bacteria 3504
347 Ga0207702_10058948 3300026078 Bacteria 3268
348 Ga0207641_10012083 3300026088 Bacteria 7081
349 Ga0207641_10072829 3300026088 Bacteria 2959
350 Ga0207648_10176944 3300026089 Bacteria 1887
351 Ga0207674_10022475 3300026116 Bacteria 6771
352 Ga0207674_10122006 3300026116 Bacteria 2573
353 Ga0207675_100035330 3300026118 Bacteria 4662
354 Ga0207675_100042623 3300026118 Bacteria 4237
355 Ga0207675_100084095 3300026118 Bacteria 2986
356 Ga0207683_10005721 3300026121 Bacteria 10665
357 Ga0207683_10035854 3300026121 Bacteria 4315
358 Ga0209281_1000007 3300027111 Bacteria 938265
359 Ga0207428_10000414 3300027907 Bacteria 53083
360 Ga0268266_10004227 3300028379 Bacteria 13827
361 Ga0268266_10038304 3300028379 Bacteria 4081
362 Ga0268265_10025280 3300028380 Bacteria 4213
363 Ga0268265_10055793 3300028380 Bacteria 3003
364 Ga0268264_10000073 3300028381 Bacteria 260615
365 Ga0268264_10000639 3300028381 Bacteria 41587
366 Ga0307517_10000024 3300028786 Bacteria 185597
367 Ga0307511_10001572 3300030521 Bacteria 24234
368 Ga0307511_10026321 3300030521 Bacteria 5336
369 Ga0307511_10087285 3300030521 Bacteria 2142
370 Ga0307512_10009048 3300030522 Bacteria 9636
371 Ga0307512_10012763 3300030522 Bacteria 7909
372 Ga0307512_10039559 3300030522 Bacteria 3949
373 Ga0307513_10002712 3300031456 Bacteria 24370
374 Ga0307513_10023105 3300031456 Bacteria 7277
375 Ga0307513_10049426 3300031456 Bacteria 4556
376 Ga0307513_10188923 3300031456 Bacteria 1914
377 Ga0307509_10026600 3300031507 Bacteria 6447
378 Ga0307408_100000490 3300031548 Bacteria 34547
379 Ga0307408_100012715 3300031548 Bacteria 5582
380 Ga0307408_100020852 3300031548 Bacteria 4427
381 Ga0307408_100028710 3300031548 Bacteria 3847
382 Ga0307408_100273277 3300031548 Bacteria 1404
383 Ga0307408_100308651 3300031548 Bacteria 1328
384 Ga0307508_10000010 3300031616 Bacteria 255747
385 Ga0307508_10025129 3300031616 Bacteria 5402
386 Ga0307508_10144184 3300031616 Bacteria 1985
387 Ga0307516_10013071 3300031730 Bacteria 8878
388 Ga0307516_10042597 3300031730 Bacteria 4503
389 Ga0307516_10051425 3300031730 Bacteria 4038
390 Ga0307405_10007934 3300031731 Bacteria 5350
391 Ga0307413_10004031 3300031824 Bacteria 6314
392 Ga0307413_10040339 3300031824 Bacteria 2723
393 Ga0307410_10001395 3300031852 Bacteria 10871
394 Ga0307410_10001692 3300031852 Bacteria 10151
395 Ga0307410_10016233 3300031852 Bacteria 4436
396 Ga0307410_10085876 3300031852 Bacteria 2222
397 Ga0307406_10000283 3300031901 Bacteria 29780
398 Ga0307406_10032269 3300031901 Bacteria 3196
399 Ga0307406_10055120 3300031901 Bacteria 2540
400 Ga0307406_10068532 3300031901 Bacteria 2316
401 Ga0307406_10100425 3300031901 Bacteria 1970
402 Ga0307407_10000367 3300031903 Bacteria 13553
403 Ga0307412_10002033 3300031911 Bacteria 11246
404 Ga0307412_10014402 3300031911 Bacteria 4663
405 Ga0307412_10047784 3300031911 Bacteria 2812
406 Ga0307412_10103291 3300031911 Bacteria 2020
407 Ga0307409_100001323 3300031995 Bacteria 12010
408 Ga0307409_100001488 3300031995 Bacteria 11562
409 Ga0307409_100004026 3300031995 Bacteria 8159
410 Ga0307409_100106663 3300031995 Bacteria 2338
411 Ga0307409_100152808 3300031995 Bacteria 2007
412 Ga0307416_100000191 3300032002 Bacteria 32678
413 Ga0307416_100004329 3300032002 Bacteria 8535
414 Ga0307416_100005336 3300032002 Bacteria 7881
415 Ga0307414_10006691 3300032004 Bacteria 6447
416 Ga0307411_10002539 3300032005 Bacteria 8132
417 Ga0307411_10005582 3300032005 Bacteria 6199
418 Ga0307415_100000194 3300032126 Bacteria 27099
419 Ga0307415_100008010 3300032126 Bacteria 5827
420 Ga0307415_100068277 3300032126 Bacteria 2487
421 Ga0307510_10000017 3300033180 Bacteria 195521
422 Ga0307510_10016626 3300033180 Bacteria 8683
423 Ga0373926_0001540 3300035083 Bacteria 7070
424 Ga0373944_0002196 3300035089 Bacteria 4966
425 Ga0373952_0023767 3300035092 Bacteria 1311
426 Ga0373923_0000054 3300035111 Bacteria 17730
427 Ga0373932_0018844 3300035112 Bacteria 1791
428 Ga0373936_0002716 3300035113 Bacteria 6591
429 Ga0373953_0022194 3300035117 Bacteria 2391
430 Ga0373954_0004963 3300035118 Bacteria 5743
431 Ga0373954_0005901 3300035118 Bacteria 5324
432 Ga0373954_0105312 3300035118 Bacteria 1362
433 Ga0373956_0011200 3300035119 Bacteria 3693
434 Ga0373943_0213351 3300035170 Bacteria 1073
435 Ga0373946_0000165 3300035171 Bacteria 20225
436 Ga0373946_0000348 3300035171 Bacteria 14964
437 Ga0373955_0007906 3300035172 Bacteria 4910
438 Ga0373955_0035886 3300035172 Bacteria 2628
439 Ga0373942_0006099 3300035207 Bacteria 2780
440 Ga0373935_0001355 3300035692 Bacteria 13558
441 Ga0373935_0003382 3300035692 Bacteria 9256
442 Ga0373935_0024589 3300035692 Bacteria 3709
443 Ga0373935_0027400 3300035692 Bacteria 3521
444 Ga0373927_0003290 3300035695 Bacteria 11624
445 Ga0373927_0010972 3300035695 Bacteria 6033
446 Ga0373933_0003652 3300035724 Bacteria 8525
447 Ga0373933_0022164 3300035724 Bacteria 3614
448 Ga0373947_0006996 3300035725 Bacteria 6536
449 Ga0373937_0009033 3300036401 Bacteria 8651
450 Ga0373937_0047096 3300036401 Bacteria 3944
451 Ga0373925_0000035 3300037068 Bacteria 144077
452 Ga0373925_0005071 3300037068 Bacteria 9853
453 Ga0373925_0007089 3300037068 Bacteria 8190
454 Ga0373925_0165940 3300037068 Bacteria 1741
455 Ga0395900_0200675 3300037418 Bacteria 2018
456 Ga0395905_0344400 3300037471 Bacteria 1382
457 Ga0436364_0890719 3300037853 Bacteria 2344
458 Ga0436364_1401395 3300037853 Bacteria 4337
459 Ga0237819_00294 3300038705 Bacteria 18381
460 Ga0400489_80170 3300039093 Bacteria 2042
461 Ga0237816_00412 3300039145 Bacteria 3641
462 Ga0436365_0131163 3300039437 Bacteria 16884
463 Ga0436361_0877021 3300039447 Bacteria 1377
464 Ga0439436_0029423 3300041404 Bacteria 1600
465 Ga0439465_0005187 3300041413 Bacteria 4179
466 Ga0451853_2161654 3300041512 Bacteria 3624
467 Ga0439452_007479 3300042010 Bacteria 3344
468 Ga0439463_000572 3300042016 Bacteria 10307
469 Ga0439463_011931 3300042016 Bacteria 2135
470 Ga0450923_003317 3300042125 Bacteria 2416
471 Ga0450888_002879 3300042126 Bacteria 1718
472 Ga0450894_001247 3300042131 Bacteria 3728
473 Ga0450906_000390 3300042145 Bacteria 8988
474 Ga0450910_000271 3300042147 Bacteria 5982
475 Ga0439434_0001562 3300042435 Bacteria 6605
476 Ga0439434_0034594 3300042435 Bacteria 1543
477 Ga0439435_0012565 3300042436 Bacteria 2055
478 Ga0439464_0000901 3300042439 Bacteria 6647
479 Ga0439440_0001068 3300042993 Bacteria 4884
480 Ga0439440_0018304 3300042993 Bacteria 1550
481 Ga0466969_0001546 3300044656 Bacteria 12368
482 Ga0466972_0005668 3300044658 Bacteria 6264
483 Ga0466972_0016768 3300044658 Bacteria 3662
484 Ga0466966_0011362 3300044684 Bacteria 5906
485 Ga0466966_0023152 3300044684 Bacteria 4068
486 Ga0466961_0001080 3300044693 Bacteria 16822
487 Ga0466961_0005618 3300044693 Bacteria 7923
488 Ga0466961_0010698 3300044693 Bacteria 5860
489 Ga0466961_0013094 3300044693 Bacteria 5307
490 Ga0466961_0017393 3300044693 Bacteria 4618
491 Ga0466961_0031466 3300044693 Bacteria 3411
492 Ga0466971_0000227 3300044719 Bacteria 21540
493 Ga0466971_0053526 3300044719 Bacteria 1819
494 Ga0466971_0068446 3300044719 Bacteria 1610
495 Ga0466968_0005590 3300044735 Bacteria 4707
496 Ga0466968_0036287 3300044735 Bacteria 2065
497 Ga0466968_0036853 3300044735 Unclassified 2050
498 Ga0466970_0006863 3300044765 Bacteria 5701
499 Ga0466970_0012634 3300044765 Bacteria 4320
500 Ga0466970_0020522 3300044765 Bacteria 3434
501 Ga0466957_0002736 3300044842 Bacteria 9539
502 Ga0466957_0019356 3300044842 Bacteria 4004
503 Ga0466960_0005572 3300044901 Bacteria 4993
504 Ga0466959_0003797 3300045049 Bacteria 10018
505 Ga0466959_0079713 3300045049 Bacteria 2361
506 Ga0466959_0111171 3300045049 Bacteria 1955
507 Ga0466959_0115041 3300045049 Bacteria 1916
508 Ga0466959_0236025 3300045049 Bacteria 1264
509 Ga0451576_0027699 3300045051 Bacteria 6083
510 Ga0466958_0014986 3300045836 Bacteria 4435
511 Ga0466958_0131469 3300045836 Unclassified 1572
512 Ga0466967_0040950 3300045976 Bacteria 3990
513 Ga0466967_0141733 3300045976 Bacteria 2239
514 Ga0466967_0244822 3300045976 Bacteria 1711
515 Ga0495592_0001387 3300046454 Bacteria 16766
516 Ga0495592_0005732 3300046454 Bacteria 9190
517 Ga0495592_0056145 3300046454 Bacteria 2911
518 Ga0495603_0154813 3300046455 Bacteria 1330
519 Ga0495629_0001180 3300046459 Bacteria 20626
520 Ga0495629_0026676 3300046459 Bacteria 4103
521 Ga0495638_0001303 3300046460 Bacteria 23135
522 Ga0495641_0007120 3300046461 Bacteria 7071
523 Ga0495651_0003089 3300046462 Bacteria 12855
524 Ga0495651_0068608 3300046462 Bacteria 2702
525 Ga0495651_0084388 3300046462 Bacteria 2393
526 Ga0495651_0101240 3300046462 Bacteria 2144
527 Ga0495653_0009909 3300046463 Bacteria 7793
528 Ga0495653_0011536 3300046463 Bacteria 7216
529 Ga0495653_0019964 3300046463 Bacteria 5431
530 Ga0495653_0132038 3300046463 Bacteria 1766
531 Ga0495639_0002442 3300046475 Bacteria 8117
532 Ga0495662_0000361 3300046476 Bacteria 19981
533 Ga0495664_0014754 3300046477 Bacteria 4433
534 Ga0495664_0084998 3300046477 Bacteria 1899
535 Ga0495594_0002593 3300046499 Bacteria 9400
536 Ga0495594_0009204 3300046499 Bacteria 5097
537 Ga0495608_0034874 3300046511 Bacteria 3396
538 Ga0495608_0082584 3300046511 Bacteria 2086
539 Ga0495616_0017096 3300046513 Bacteria 4004
540 Ga0495618_0004676 3300046514 Bacteria 8373
541 Ga0495618_0040590 3300046514 Bacteria 2929
542 Ga0495620_0008355 3300046515 Bacteria 5562
543 Ga0495628_0032235 3300046516 Bacteria 4231
544 Ga0495628_0054376 3300046516 Bacteria 3157
545 Ga0495630_0003326 3300046517 Bacteria 11200
546 Ga0495630_0007274 3300046517 Bacteria 7901
547 Ga0495637_0015868 3300046520 Bacteria 3527
548 Ga0495637_0017243 3300046520 Bacteria 3370
549 Ga0495643_0000095 3300046522 Bacteria 148901
550 Ga0495643_0006546 3300046522 Bacteria 7665
551 Ga0495663_0000719 3300046525 Bacteria 11383
552 Ga0495642_0031526 3300046528 Bacteria 2126
553 Ga0495652_0034697 3300046529 Bacteria 4395
554 Ga0495652_0050849 3300046529 Bacteria 3541
555 Ga0495665_0005945 3300046531 Bacteria 6572
556 Ga0495665_0008997 3300046531 Bacteria 5420
557 Ga0495665_0034168 3300046531 Bacteria 2719
558 Ga0495640_0025798 3300046533 Bacteria 4256
559 Ga0495586_0020235 3300046535 Bacteria 3544
560 Ga0495586_0038525 3300046535 Bacteria 2568
561 Ga0495587_0002112 3300046536 Bacteria 13283
562 Ga0495587_0008652 3300046536 Bacteria 6540
563 Ga0495597_0005059 3300046542 Bacteria 7055
564 Ga0495645_0016027 3300046543 Bacteria 5342
565 Ga0495622_0041740 3300046557 Bacteria 2133
566 Ga0495622_0043141 3300046557 Bacteria 2097
567 Ga0495667_0003013 3300046559 Bacteria 11294
568 Ga0495667_0004182 3300046559 Bacteria 9714
569 Ga0495668_0000360 3300046616 Bacteria 60235
570 Ga0495634_0001051 3300046642 Bacteria 25853
571 Ga0495611_0117865 3300046648 Bacteria 1237
572 Ga0495625_0006326 3300046660 Bacteria 10585
573 Ga0495635_0006621 3300046663 Bacteria 8086
574 Ga0495635_0015825 3300046663 Bacteria 5268
575 Ga0495635_0114210 3300046663 Bacteria 1843
576 Ga0495588_0029253 3300046674 Bacteria 2763
577 Ga0495657_0014506 3300046675 Bacteria 5782
578 Ga0495657_0149222 3300046675 Bacteria 1452
579 Ga0495599_0061273 3300046678 Bacteria 2351
580 Ga0495646_0030280 3300046680 Bacteria 3379
581 Ga0495647_0002662 3300046681 Bacteria 5667
582 Ga0495658_0003053 3300046683 Bacteria 8383
583 Ga0495613_0002194 3300046689 Bacteria 14784
584 Ga0495613_0003757 3300046689 Bacteria 11378
585 Ga0495624_0004892 3300046690 Bacteria 9728
586 Ga0495649_0002710 3300046694 Bacteria 12331
587 Ga0495649_0018318 3300046694 Bacteria 3941
588 Ga0495589_0013785 3300046794 Bacteria 4169
589 Ga0495600_0001100 3300046809 Bacteria 14726
590 Ga0495581_0000514 3300047315 Bacteria 19857
591 Ga0495581_0012103 3300047315 Bacteria 4993
592 Ga0495604_0003873 3300047317 Bacteria 11918
593 Ga0495604_0014962 3300047317 Bacteria 6189
594 Ga0495604_0022926 3300047317 Bacteria 4982
595 Ga0495674_0000239 3300047319 Bacteria 46557
596 Ga0495676_0008383 3300047321 Bacteria 9476
597 Ga0495676_0009537 3300047321 Bacteria 8838
598 Ga0495676_0017011 3300047321 Bacteria 6438
599 Ga0495676_0033811 3300047321 Bacteria 4297
600 Ga0495676_0034062 3300047321 Bacteria 4276
601 Ga0495676_0104065 3300047321 Bacteria 2095
602 Ga0495680_0020194 3300047322 Bacteria 5610
603 Ga0495680_0048730 3300047322 Bacteria 3325
604 Ga0495680_0110929 3300047322 Bacteria 2032
605 Ga0495687_000705 3300047443 Bacteria 37210
606 Ga0495687_002551 3300047443 Bacteria 14407
607 Ga0495687_028206 3300047443 Bacteria 2614
608 Ga0495675_0025844 3300047444 Bacteria 3742
609 Ga0495675_0039226 3300047444 Bacteria 3016
610 Ga0495684_0018872 3300047471 Bacteria 5310
611 Ga0495684_0035019 3300047471 Bacteria 3851
612 Ga0495684_0075034 3300047471 Bacteria 2569
613 Ga0495684_0133081 3300047471 Bacteria 1866
614 Ga0495593_0000963 3300047673 Bacteria 16854
615 Ga0495593_0052916 3300047673 Bacteria 2144
616 Ga0495593_0059443 3300047673 Bacteria 2003
617 Ga0495602_0010432 3300048088 Bacteria 9643
618 Ga0495602_0056004 3300048088 Bacteria 3469
619 Ga0495602_0246828 3300048088 Bacteria 1332
620 Ga0495614_0001001 3300048089 Bacteria 12047
621 Ga0495614_0001250 3300048089 Bacteria 10929
622 Ga0496100_0287813 3300048903 Bacteria 1227
623 Ga0496102_0001851 3300048905 Bacteria 18249
624 Ga0496103_0056122 3300048906 Bacteria 2444
625 Ga0496104_0005380 3300048907 Bacteria 11207
626 Ga0496104_0076443 3300048907 Bacteria 3189
627 Ga0496104_0125931 3300048907 Bacteria 2460
628 Ga0496104_0169752 3300048907 Bacteria 2092
629 Ga0496105_0003796 3300048908 Bacteria 11267
630 Ga0496105_0347202 3300048908 Bacteria 1186
631 Ga0496108_0000007 3300048911 Bacteria 351492
632 Ga0496108_0021985 3300048911 Bacteria 5243
633 Ga0496108_0134936 3300048911 Bacteria 2123
634 Ga0496109_0000005 3300048912 Bacteria 358226
635 Ga0496109_0251242 3300048912 Bacteria 1665
636 Ga0496110_0058149 3300048913 Bacteria 3405
637 Ga0496111_0009184 3300048914 Bacteria 6583
638 Ga0496112_0016408 3300048915 Bacteria 6937
639 Ga0496112_0245536 3300048915 Bacteria 1742
640 Ga0496113_0007654 3300048916 Bacteria 6972
641 Ga0496116_0009607 3300048919 Bacteria 8231
642 Ga0496116_0075802 3300048919 Bacteria 2109
643 Ga0496117_0001874 3300048920 Bacteria 28312
644 Ga0496117_0004662 3300048920 Bacteria 14914
645 Ga0496117_0035536 3300048920 Bacteria 3739
646 Ga0496117_0052221 3300048920 Bacteria 2881
647 Ga0496118_0000170 3300048921 Bacteria 117661
648 Ga0496118_0029173 3300048921 Bacteria 4632
649 Ga0496119_0000140 3300048922 Bacteria 101373
650 Ga0496119_0038802 3300048922 Unclassified 3071
651 Ga0496120_0000011 3300048923 Bacteria 365549
652 Ga0496120_0022316 3300048923 Unclassified 3983
653 Ga0496121_0003589 3300048924 Bacteria 21900
654 Ga0496121_0113438 3300048924 Bacteria 2062
655 Ga0496122_0000253 3300048925 Bacteria 120534
656 Ga0496122_0023757 3300048925 Bacteria 5388
657 Ga0496123_0000206 3300048926 Bacteria 120598
658 Ga0496123_0013664 3300048926 Bacteria 6790
659 Ga0496124_0000148 3300048927 Bacteria 144782
660 Ga0496124_0000318 3300048927 Bacteria 89004
661 Ga0496124_0055964 3300048927 Bacteria 3330
662 Ga0496125_0013811 3300048928 Bacteria 7910
663 Ga0496126_0048149 3300048929 Bacteria 3898
664 Ga0501031_0057703 3300049568 Bacteria 2529
665 Ga0501033_0008226 3300049570 Bacteria 8079
666 Ga0501044_0173525 3300049823 Bacteria 2126
667 nmdc:mga03683_47727_c1 3300050489 Bacteria 1777
668 nmdc:mga03683_5569_c1 3300050489 Bacteria 4260
669 nmdc:mga00v17_62914_c1 3300050491 Bacteria 2284
670 nmdc:mga00v17_85811_c1 3300050491 Bacteria 1972
671 nmdc:mga0yw44_112491_c1 3300050492 Bacteria 1746
672 nmdc:mga0yw44_116162_c1 3300050492 Bacteria 1719
673 nmdc:mga0yw44_14097_c1 3300050492 Bacteria 4232
674 nmdc:mga0k408_2181_c1 3300050493 Bacteria 10509
675 nmdc:mga0k408_512_c1 3300050493 Bacteria 21330
676 nmdc:mga07m45_4348_c1 3300050496 Bacteria 6931
677 nmdc:mga07m45_4672_c1 3300050496 Bacteria 6722
678 nmdc:mga07m45_86077_c1 3300050496 Bacteria 1798
679 nmdc:mga07m45_8635_c1 3300050496 Bacteria 5246
680 nmdc:mga05p37_275595_c1 3300050507 Bacteria 2009
681 nmdc:mga05p37_6258_c1 3300050507 Bacteria 14018
682 nmdc:mga05p37_87494_c1 3300050507 Bacteria 3840
683 nmdc:mga0qj67_17136_c1 3300050509 Bacteria 5505
684 nmdc:mga06r32_19462_c2 3300050510 Bacteria 3579
685 nmdc:mga06r32_37026_c1 3300050510 Bacteria 4615
686 nmdc:mga08y16_1812_c1 3300050511 Bacteria 21659
687 nmdc:mga08y16_53351_c1 3300050511 Bacteria 4228
688 nmdc:mga0n895_407_c1 3300050512 Bacteria 28809
689 nmdc:mga0n895_409842_c1 3300050512 Bacteria 1370
690 nmdc:mga0n895_5615_c1 3300050512 Bacteria 10508
691 nmdc:mga0rr50_723_c1 3300050513 Bacteria 17800
692 nmdc:mga08x19_2264_c1 3300050514 Bacteria 11705
693 nmdc:mga0a205_290_c1 3300050515 Bacteria 37012
694 Ga0495612_0007886 3300053078 Bacteria 4340
695 Ga0500610_0020212 3300053079 Bacteria 3248
696 Ga0495595_0009242 3300053084 Bacteria 4071
697 Ga0495619_0002401 3300053085 Bacteria 12300
698 Ga0495619_0148700 3300053085 Bacteria 1615
699 Ga0500583_0003516 3300053092 Bacteria 4941
700 Ga0500556_0000249 3300053104 Bacteria 43718
701 Ga0500617_041453 3300053124 Bacteria 2058
702 Ga0500617_049386 3300053124 Bacteria 1879
703 Ga0500588_0000048 3300053146 Bacteria 20352
704 Ga0500590_016406 3300053148 Bacteria 3828
705 Ga0500616_0000382 3300053153 Bacteria 62004
706 Ga0500620_000026 3300053155 Bacteria 30246
707 Ga0500636_0058029 3300053177 Bacteria 2264
708 Ga0500645_000522 3300053730 Bacteria 25720
709 Ga0466962_0000593 3300061719 Bacteria 15987
710 Ga0466962_0060493 3300061719 Bacteria 1808
711 Ga0466962_0078426 3300061719 Bacteria 1579

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_116162_c1 nmdc:mga0yw44_116162_c1_22_1035 312
2 3300050491 nmdc:mga00v17_85811_c1 nmdc:mga00v17_85811_c1_19_1032 316
3 3300035112 Ga0373932_0018844 Ga0373932_0018844_413_1570 319
4 3300035170 Ga0373943_0213351 Ga0373943_0213351_13_993 321
5 3300035117 Ga0373953_0022194 Ga0373953_0022194_762_1967 322
6 3300035119 Ga0373956_0011200 Ga0373956_0011200_1581_2786 322
7 3300035172 Ga0373955_0035886 Ga0373955_0035886_1165_2370 322
8 3300046463 Ga0495653_0009909 Ga0495653_0009909_2396_3601 322
9 3300046511 Ga0495608_0034874 Ga0495608_0034874_426_1631 322
10 3300046663 Ga0495635_0006621 Ga0495635_0006621_2842_4047 322
11 3300046674 Ga0495588_0029253 Ga0495588_0029253_40_1185 323
12 3300005458 Ga0070681_10046107 Ga0070681_100461073 324
13 3300031730 Ga0307516_10013071 Ga0307516_100130712 325
14 3300006173 Ga0070716_100046612 Ga0070716_1000466122 326
15 3300006871 Ga0075434_100304704 Ga0075434_1003047042 327
16 3300025906 Ga0207699_10018571 Ga0207699_100185712 328
17 3300005435 Ga0070714_100059490 Ga0070714_1000594903 330
18 3300025929 Ga0207664_10000778 Ga0207664_1000077810 330
19 3300035113 Ga0373936_0002716 Ga0373936_0002716_2280_3485 330
20 3300035118 Ga0373954_0005901 Ga0373954_0005901_2311_3516 330
21 3300035692 Ga0373935_0027400 Ga0373935_0027400_46_1251 330
22 3300035724 Ga0373933_0003652 Ga0373933_0003652_1115_2320 330
23 3300046454 Ga0495592_0056145 Ga0495592_0056145_431_1636 330
24 3300046462 Ga0495651_0101240 Ga0495651_0101240_650_1855 330
25 3300046559 Ga0495667_0003013 Ga0495667_0003013_3454_4659 330
26 3300046675 Ga0495657_0014506 Ga0495657_0014506_2441_3646 330
27 3300047322 Ga0495680_0048730 Ga0495680_0048730_1426_2631 330
28 3300047471 Ga0495684_0035019 Ga0495684_0035019_2292_3497 330
29 3300006028 Ga0070717_10012318 Ga0070717_100123182 331
30 3300033180 Ga0307510_10000017 Ga0307510_1000001769 333
31 3300005440 Ga0070705_100085478 Ga0070705_1000854782 334
32 3300005435 Ga0070714_100251398 Ga0070714_1002513982 335
33 3300005548 Ga0070665_100023955 Ga0070665_1000239555 335
34 3300005844 Ga0068862_100072050 Ga0068862_1000720502 335
35 3300009093 Ga0105240_10054444 Ga0105240_100544444 335
36 3300009553 Ga0105249_10010321 Ga0105249_100103215 335
37 3300025913 Ga0207695_10041847 Ga0207695_100418474 335
38 3300025929 Ga0207664_10165152 Ga0207664_101651522 335
39 3300025961 Ga0207712_10132825 Ga0207712_101328251 335
40 3300028379 Ga0268266_10038304 Ga0268266_100383042 335
41 3300028380 Ga0268265_10055793 Ga0268265_100557932 335
42 3300005445 Ga0070708_100051262 Ga0070708_1000512622 336
43 3300047471 Ga0495684_0075034 Ga0495684_0075034_739_1872 336
44 3300045976 Ga0466967_0141733 Ga0466967_0141733_235_1410 337
45 3300046455 Ga0495603_0154813 Ga0495603_0154813_241_1320 337
46 3300046463 Ga0495653_0011536 Ga0495653_0011536_5493_6644 338
47 3300046511 Ga0495608_0082584 Ga0495608_0082584_243_1394 338
48 3300050489 nmdc:mga03683_47727_c1 nmdc:mga03683_47727_c1_155_1387 338
49 3300005468 Ga0070707_100086237 Ga0070707_1000862372 340
50 3300005536 Ga0070697_100008052 Ga0070697_1000080527 340
51 3300006028 Ga0070717_10030855 Ga0070717_100308553 340
52 3300047443 Ga0495687_002551 Ga0495687_002551_11901_13136 340
53 3300005436 Ga0070713_100417549 Ga0070713_1004175491 341
54 3300005437 Ga0070710_10009896 Ga0070710_100098964 341
55 3300005983 Ga0081540_1004872 Ga0081540_10048725 341
56 3300031616 Ga0307508_10025129 Ga0307508_100251292 341
57 3300037068 Ga0373925_0165940 Ga0373925_0165940_337_1539 341
58 3300005549 Ga0070704_100092883 Ga0070704_1000928833 342
59 3300010159 Ga0099796_10036742 Ga0099796_100367422 342
60 3300026089 Ga0207648_10176944 Ga0207648_101769442 342
61 3300035089 Ga0373944_0002196 Ga0373944_0002196_596_1807 342
62 3300035111 Ga0373923_0000054 Ga0373923_0000054_16346_17557 342
63 3300035118 Ga0373954_0004963 Ga0373954_0004963_4165_5376 342
64 3300035171 Ga0373946_0000165 Ga0373946_0000165_18718_19929 342
65 3300035172 Ga0373955_0007906 Ga0373955_0007906_2840_4051 342
66 3300035692 Ga0373935_0003382 Ga0373935_0003382_7872_9083 342
67 3300035695 Ga0373927_0010972 Ga0373927_0010972_4183_5394 342
68 3300035724 Ga0373933_0022164 Ga0373933_0022164_153_1364 342
69 3300037068 Ga0373925_0007089 Ga0373925_0007089_6934_8145 342
70 3300046454 Ga0495592_0005732 Ga0495592_0005732_4054_5265 342
71 3300046459 Ga0495629_0026676 Ga0495629_0026676_46_1257 342
72 3300046461 Ga0495641_0007120 Ga0495641_0007120_5506_6717 342
73 3300046462 Ga0495651_0068608 Ga0495651_0068608_395_1606 342
74 3300046463 Ga0495653_0019964 Ga0495653_0019964_46_1257 342
75 3300046475 Ga0495639_0002442 Ga0495639_0002442_3594_4805 342
76 3300046476 Ga0495662_0000361 Ga0495662_0000361_10771_11982 342
77 3300046499 Ga0495594_0009204 Ga0495594_0009204_337_1548 342
78 3300046514 Ga0495618_0004676 Ga0495618_0004676_3513_4724 342
79 3300046516 Ga0495628_0032235 Ga0495628_0032235_2847_4058 342
80 3300046517 Ga0495630_0007274 Ga0495630_0007274_3143_4354 342
81 3300046529 Ga0495652_0050849 Ga0495652_0050849_1821_3032 342
82 3300046531 Ga0495665_0005945 Ga0495665_0005945_1436_2647 342
83 3300046535 Ga0495586_0020235 Ga0495586_0020235_1822_3033 342
84 3300046536 Ga0495587_0008652 Ga0495587_0008652_281_1492 342
85 3300046557 Ga0495622_0043141 Ga0495622_0043141_575_1786 342
86 3300046559 Ga0495667_0004182 Ga0495667_0004182_8458_9669 342
87 3300046642 Ga0495634_0001051 Ga0495634_0001051_13872_15083 342
88 3300046663 Ga0495635_0015825 Ga0495635_0015825_510_1721 342
89 3300046680 Ga0495646_0030280 Ga0495646_0030280_2123_3334 342
90 3300046681 Ga0495647_0002662 Ga0495647_0002662_4270_5481 342
91 3300046683 Ga0495658_0003053 Ga0495658_0003053_3797_5008 342
92 3300046689 Ga0495613_0002194 Ga0495613_0002194_11753_12964 342
93 3300046690 Ga0495624_0004892 Ga0495624_0004892_5503_6714 342
94 3300046809 Ga0495600_0001100 Ga0495600_0001100_8545_9756 342
95 3300047315 Ga0495581_0000514 Ga0495581_0000514_308_1519 342
96 3300047317 Ga0495604_0003873 Ga0495604_0003873_1235_2446 342
97 3300047321 Ga0495676_0008383 Ga0495676_0008383_7756_8967 342
98 3300047444 Ga0495675_0025844 Ga0495675_0025844_2251_3462 342
99 3300047471 Ga0495684_0018872 Ga0495684_0018872_3926_5137 342
100 3300047673 Ga0495593_0000963 Ga0495593_0000963_46_1257 342
101 3300048089 Ga0495614_0001001 Ga0495614_0001001_8336_9547 342
102 3300053078 Ga0495612_0007886 Ga0495612_0007886_397_1608 342
103 3300053084 Ga0495595_0009242 Ga0495595_0009242_1844_3055 342
104 3300053085 Ga0495619_0002401 Ga0495619_0002401_2210_3421 342
105 3300005262 Ga0065165_1006104 Ga0065165_10061043 343
106 3300005471 Ga0070698_100066310 Ga0070698_1000663102 343
107 3300025906 Ga0207699_10098151 Ga0207699_100981512 343
108 3300025916 Ga0207663_10237426 Ga0207663_102374261 343
109 3300025922 Ga0207646_10124762 Ga0207646_101247622 343
110 3300025939 Ga0207665_10003476 Ga0207665_100034765 343
111 3300005327 Ga0070658_10045612 Ga0070658_100456121 344
112 3300005334 Ga0068869_100104963 Ga0068869_1001049631 344
113 3300005355 Ga0070671_100027614 Ga0070671_1000276143 344
114 3300005367 Ga0070667_100144212 Ga0070667_1001442122 344
115 3300005455 Ga0070663_100102684 Ga0070663_1001026842 344
116 3300005458 Ga0070681_10088822 Ga0070681_100888222 344
117 3300005530 Ga0070679_100299857 Ga0070679_1002998572 344
118 3300005535 Ga0070684_100276657 Ga0070684_1002766572 344
119 3300005539 Ga0068853_100284578 Ga0068853_1002845781 344
120 3300005546 Ga0070696_100138958 Ga0070696_1001389582 344
121 3300005547 Ga0070693_100105596 Ga0070693_1001055962 344
122 3300005616 Ga0068852_100124886 Ga0068852_1001248862 344
123 3300005841 Ga0068863_100040401 Ga0068863_1000404014 344
124 3300009553 Ga0105249_10099301 Ga0105249_100993012 344
125 3300013100 Ga0157373_10134816 Ga0157373_101348162 344
126 3300013102 Ga0157371_10012563 Ga0157371_100125632 344
127 3300013297 Ga0157378_10168094 Ga0157378_101680942 344
128 3300014745 Ga0157377_10032620 Ga0157377_100326202 344
129 3300025901 Ga0207688_10010839 Ga0207688_100108392 344
130 3300025906 Ga0207699_10019736 Ga0207699_100197362 344
131 3300025908 Ga0207643_10010314 Ga0207643_100103144 344
132 3300025918 Ga0207662_10119748 Ga0207662_101197481 344
133 3300025919 Ga0207657_10015924 Ga0207657_100159246 344
134 3300025920 Ga0207649_10112645 Ga0207649_101126452 344
135 3300025929 Ga0207664_10051907 Ga0207664_100519072 344
136 3300025933 Ga0207706_10027722 Ga0207706_100277224 344
137 3300025934 Ga0207686_10048146 Ga0207686_100481462 344
138 3300025939 Ga0207665_10017054 Ga0207665_100170544 344
139 3300025940 Ga0207691_10045724 Ga0207691_100457243 344
140 3300025942 Ga0207689_10005696 Ga0207689_1000569610 344
141 3300025972 Ga0207668_10018896 Ga0207668_100188963 344
142 3300026067 Ga0207678_10017147 Ga0207678_100171472 344
143 3300026075 Ga0207708_10021046 Ga0207708_100210464 344
144 3300026118 Ga0207675_100042623 Ga0207675_1000426234 344
145 3300026121 Ga0207683_10005721 Ga0207683_100057215 344
146 3300035083 Ga0373926_0001540 Ga0373926_0001540_2952_4163 344
147 3300035092 Ga0373952_0023767 Ga0373952_0023767_72_1247 344
148 3300035171 Ga0373946_0000348 Ga0373946_0000348_10766_11977 344
149 3300035207 Ga0373942_0006099 Ga0373942_0006099_869_2044 344
150 3300035692 Ga0373935_0001355 Ga0373935_0001355_4107_5318 344
151 3300035695 Ga0373927_0003290 Ga0373927_0003290_5859_7070 344
152 3300035725 Ga0373947_0006996 Ga0373947_0006996_4335_5546 344
153 3300037068 Ga0373925_0005071 Ga0373925_0005071_5507_6718 344
154 3300046462 Ga0495651_0084388 Ga0495651_0084388_994_2205 344
155 3300046517 Ga0495630_0003326 Ga0495630_0003326_5625_6836 344
156 3300046531 Ga0495665_0008997 Ga0495665_0008997_3243_4454 344
157 3300046663 Ga0495635_0114210 Ga0495635_0114210_537_1748 344
158 3300046678 Ga0495599_0061273 Ga0495599_0061273_1128_2339 344
159 3300047315 Ga0495581_0012103 Ga0495581_0012103_3138_4349 344
160 3300047319 Ga0495674_0000239 Ga0495674_0000239_3309_4520 344
161 3300047321 Ga0495676_0104065 Ga0495676_0104065_210_1421 344
162 3300047322 Ga0495680_0020194 Ga0495680_0020194_806_2017 344
163 3300048907 Ga0496104_0076443 Ga0496104_0076443_730_1905 344
164 3300048914 Ga0496111_0009184 Ga0496111_0009184_4959_6134 344
165 3300005341 Ga0070691_10071870 Ga0070691_100718701 345
166 3300005563 Ga0068855_100153436 Ga0068855_1001534362 345
167 3300005614 Ga0068856_100079285 Ga0068856_1000792854 345
168 3300005843 Ga0068860_100176653 Ga0068860_1001766532 345
169 3300013105 Ga0157369_10145036 Ga0157369_101450362 345
170 3300014325 Ga0163163_10008884 Ga0163163_100088844 345
171 3300014968 Ga0157379_10052216 Ga0157379_100522162 345
172 3300014969 Ga0157376_10020637 Ga0157376_100206374 345
173 3300025898 Ga0207692_10068894 Ga0207692_100688942 345
174 3300025906 Ga0207699_10031049 Ga0207699_100310492 345
175 3300025939 Ga0207665_10207193 Ga0207665_102071932 345
176 3300026078 Ga0207702_10050707 Ga0207702_100507074 345
177 3300046648 Ga0495611_0117865 Ga0495611_0117865_72_1214 345
178 3300048907 Ga0496104_0005380 Ga0496104_0005380_4977_6254 345
179 3300048908 Ga0496105_0003796 Ga0496105_0003796_7140_8426 345
180 3300048913 Ga0496110_0058149 Ga0496110_0058149_1423_2709 345
181 3300030521 Ga0307511_10026321 Ga0307511_100263212 346
182 3300033180 Ga0307510_10016626 Ga0307510_100166264 346
183 3300037471 Ga0395905_0344400 Ga0395905_0344400_288_1340 347
184 3300046675 Ga0495657_0149222 Ga0495657_0149222_95_1300 347
185 3300031730 Ga0307516_10051425 Ga0307516_100514254 348
186 3300048088 Ga0495602_0246828 Ga0495602_0246828_46_1254 348
187 3300050496 nmdc:mga07m45_86077_c1 nmdc:mga07m45_86077_c1_126_1358 348
188 3300009101 Ga0105247_10140881 Ga0105247_101408812 349
189 3300046794 Ga0495589_0013785 Ga0495589_0013785_1243_2445 349
190 3300047321 Ga0495676_0033811 Ga0495676_0033811_1675_2877 349
191 3300047321 Ga0495676_0034062 Ga0495676_0034062_2729_3931 349
192 3300048911 Ga0496108_0000007 Ga0496108_0000007_246464_247639 349
193 3300048927 Ga0496124_0000318 Ga0496124_0000318_51369_52541 349
194 3300002739 JGI25158J39367_1000567 JGI25158J39367_10005675 350
195 3300003374 JGI25161J50226_1001752 JGI25161J50226_10017524 350
196 3300003771 Ga0055526_1003340 Ga0055526_10033408 350
197 3300003773 Ga0055537_1003335 Ga0055537_10033352 350
198 3300003773 Ga0055537_1010650 Ga0055537_10106502 350
199 3300003775 Ga0055524_1000450 Ga0055524_100045023 350
200 3300003775 Ga0055524_1000791 Ga0055524_100079122 350
201 3300003784 Ga0055534_1001013 Ga0055534_10010139 350
202 3300003790 Ga0055528_1018501 Ga0055528_10185012 350
203 3300003791 Ga0055530_10002948 Ga0055530_100029488 350
204 3300003794 Ga0055531_10001962 Ga0055531_1000196212 350
205 3300025208 Ga0209436_101227 Ga0209436_1012275 350
206 3300025263 Ga0209565_1000501 Ga0209565_10005016 350
207 3300025263 Ga0209565_1000502 Ga0209565_100050223 350
208 3300025263 Ga0209565_1004868 Ga0209565_10048682 350
209 3300025263 Ga0209565_1008129 Ga0209565_10081292 350
210 3300025273 Ga0209673_1010066 Ga0209673_10100662 350
211 3300025284 Ga0209130_1003667 Ga0209130_10036672 350
212 3300025291 Ga0209675_1000558 Ga0209675_10005585 350
213 3300025291 Ga0209675_1009200 Ga0209675_10092002 350
214 3300025295 Ga0209564_1000311 Ga0209564_10003112 350
215 3300025295 Ga0209564_1010763 Ga0209564_10107632 350
216 3300025298 Ga0209050_1000011 Ga0209050_1000011177 350
217 3300025298 Ga0209050_1000164 Ga0209050_100016488 350
218 3300025298 Ga0209050_1001877 Ga0209050_10018772 350
219 3300025299 Ga0209256_1000660 Ga0209256_100066043 350
220 3300025299 Ga0209256_1000702 Ga0209256_100070212 350
221 3300025302 Ga0207426_1008183 Ga0207426_10081832 350
222 3300025304 Ga0209257_1000003 Ga0209257_1000003949 350
223 3300025304 Ga0209257_1011217 Ga0209257_10112172 350
224 3300031548 Ga0307408_100000490 Ga0307408_10000049036 350
225 3300046515 Ga0495620_0008355 Ga0495620_0008355_1462_2661 350
226 3300046522 Ga0495643_0006546 Ga0495643_0006546_927_2132 350
227 3300046528 Ga0495642_0031526 Ga0495642_0031526_840_2039 350
228 3300046694 Ga0495649_0018318 Ga0495649_0018318_2502_3707 350
229 3300047443 Ga0495687_028206 Ga0495687_028206_1387_2592 350
230 3300005985 Ga0081539_10042833 Ga0081539_100428333 351
231 3300046689 Ga0495613_0003757 Ga0495613_0003757_4815_5957 351
232 3300048908 Ga0496105_0347202 Ga0496105_0347202_38_1129 351
233 3300002774 JGI25150J39212_1001901 JGI25150J39212_10019014 352
234 3300003771 Ga0055526_1003735 Ga0055526_10037354 352
235 3300005445 Ga0070708_100019427 Ga0070708_1000194273 352
236 3300005468 Ga0070707_100038868 Ga0070707_1000388682 352
237 3300005471 Ga0070698_100016331 Ga0070698_1000163312 352
238 3300005518 Ga0070699_100280056 Ga0070699_1002800561 352
239 3300025245 Ga0207425_1000056 Ga0207425_100005626 352
240 3300025258 Ga0209129_1003627 Ga0209129_10036272 352
241 3300025922 Ga0207646_10042682 Ga0207646_100426823 352
242 3300031616 Ga0307508_10000010 Ga0307508_1000001034 352
243 3300041512 Ga0451853_2161654 Ga0451853_2161654_1978_3180 352
244 3300005545 Ga0070695_100129979 Ga0070695_1001299792 353
245 3300005546 Ga0070696_100032382 Ga0070696_1000323822 353
246 3300005549 Ga0070704_100084124 Ga0070704_1000841241 353
247 3300030522 Ga0307512_10009048 Ga0307512_100090482 353
248 3300031995 Ga0307409_100152808 Ga0307409_1001528082 353
249 3300003203 JGI25406J46586_10009297 JGI25406J46586_100092974 354
250 3300005985 Ga0081539_10000004 Ga0081539_1000000430 354
251 3300030521 Ga0307511_10001572 Ga0307511_1000157213 354
252 3300005539 Ga0068853_100031289 Ga0068853_1000312893 355
253 3300005985 Ga0081539_10006126 Ga0081539_1000612610 355
254 3300006038 Ga0075365_10004609 Ga0075365_100046095 355
255 3300030522 Ga0307512_10039559 Ga0307512_100395592 355
256 3300031616 Ga0307508_10144184 Ga0307508_101441841 355
257 3300035118 Ga0373954_0105312 Ga0373954_0105312_112_1338 355
258 3300042131 Ga0450894_001247 Ga0450894_001247_1002_2240 355
259 3300046454 Ga0495592_0001387 Ga0495592_0001387_11681_12907 355
260 3300046477 Ga0495664_0014754 Ga0495664_0014754_636_1862 355
261 3300046535 Ga0495586_0038525 Ga0495586_0038525_709_1935 355
262 3300046536 Ga0495587_0002112 Ga0495587_0002112_9846_11072 355
263 3300046543 Ga0495645_0016027 Ga0495645_0016027_1941_3167 355
264 3300046557 Ga0495622_0041740 Ga0495622_0041740_751_1923 355
265 3300047317 Ga0495604_0022926 Ga0495604_0022926_779_2005 355
266 3300047321 Ga0495676_0017011 Ga0495676_0017011_1752_2924 355
267 3300047322 Ga0495680_0110929 Ga0495680_0110929_208_1434 355
268 3300047444 Ga0495675_0039226 Ga0495675_0039226_1305_2531 355
269 3300047471 Ga0495684_0133081 Ga0495684_0133081_581_1807 355
270 3300047673 Ga0495593_0052916 Ga0495593_0052916_849_2075 355
271 3300048088 Ga0495602_0056004 Ga0495602_0056004_940_2166 355
272 3300053085 Ga0495619_0148700 Ga0495619_0148700_171_1397 355
273 3300001989 JGI24739J22299_10015637 JGI24739J22299_100156372 356
274 3300003316 rootH1_10064618 rootH1_100646184 356
275 3300003320 rootH2_10144896 rootH2_101448963 356
276 3300003323 rootH1_10083982 rootH1_100839822 356
277 3300005563 Ga0068855_100210081 Ga0068855_1002100812 356
278 3300010375 Ga0105239_10034240 Ga0105239_100342402 356
279 3300025904 Ga0207647_10005500 Ga0207647_100055005 356
280 3300025949 Ga0207667_10325864 Ga0207667_103258641 356
281 3300026121 Ga0207683_10035854 Ga0207683_100358543 356
282 3300046460 Ga0495638_0001303 Ga0495638_0001303_16944_18101 356
283 3300046529 Ga0495652_0034697 Ga0495652_0034697_3010_4236 356
284 iso_pu_bacteria 2906427513 2906431985 356
285 3300005577 Ga0068857_100163975 Ga0068857_1001639752 357
286 3300009551 Ga0105238_10021926 Ga0105238_100219262 357
287 3300013307 Ga0157372_10159026 Ga0157372_101590262 357
288 3300025929 Ga0207664_10082181 Ga0207664_100821812 357
289 3300036401 Ga0373937_0047096 Ga0373937_0047096_2417_3673 357
290 3300046463 Ga0495653_0132038 Ga0495653_0132038_358_1614 357
291 3300047321 Ga0495676_0009537 Ga0495676_0009537_7013_8155 357
292 3300047673 Ga0495593_0059443 Ga0495593_0059443_630_1772 357
293 3300048089 Ga0495614_0001250 Ga0495614_0001250_2781_3923 357
294 3300050512 nmdc:mga0n895_409842_c1 nmdc:mga0n895_409842_c1_78_1310 357
295 3300014497 Ga0182008_10003788 Ga0182008_100037882 358
296 3300015262 Ga0182007_10003249 Ga0182007_100032496 358
297 3300021388 Ga0213875_10037269 Ga0213875_100372692 358
298 3300037853 Ga0436364_1401395 Ga0436364_1401395_535_1656 358
299 3300044765 Ga0466970_0020522 Ga0466970_0020522_204_1400 358
300 3300046513 Ga0495616_0017096 Ga0495616_0017096_1312_2511 358
301 3300046520 Ga0495637_0017243 Ga0495637_0017243_1962_3161 358
302 3300053104 Ga0500556_0000249 Ga0500556_0000249_37793_38992 358
303 3300053730 Ga0500645_000522 Ga0500645_000522_13572_14771 358
304 iso_pu_bacteria 3006321560 3006324247 358
305 3300044684 Ga0466966_0011362 Ga0466966_0011362_86_1222 359
306 3300044693 Ga0466961_0001080 Ga0466961_0001080_10898_12034 359
307 3300044719 Ga0466971_0000227 Ga0466971_0000227_9379_10515 359
308 3300044735 Ga0466968_0036853 Ga0466968_0036853_536_1672 359
309 3300044842 Ga0466957_0002736 Ga0466957_0002736_8255_9391 359
310 3300045049 Ga0466959_0003797 Ga0466959_0003797_7846_8982 359
311 3300045836 Ga0466958_0131469 Ga0466958_0131469_211_1347 359
312 3300061719 Ga0466962_0000593 Ga0466962_0000593_11434_12570 359
313 3300005843 Ga0068860_100000255 Ga0068860_10000025512 360
314 3300006880 Ga0075429_100079454 Ga0075429_1000794542 360
315 3300025986 Ga0207658_10029535 Ga0207658_100295352 360
316 3300028381 Ga0268264_10000639 Ga0268264_100006398 360
317 3300031548 Ga0307408_100012715 Ga0307408_1000127152 361
318 3300031852 Ga0307410_10001692 Ga0307410_100016929 361
319 3300031901 Ga0307406_10000283 Ga0307406_1000028311 361
320 3300031911 Ga0307412_10103291 Ga0307412_101032912 361
321 3300031995 Ga0307409_100001323 Ga0307409_1000013237 361
322 3300032002 Ga0307416_100000191 Ga0307416_10000019135 361
323 3300032005 Ga0307411_10005582 Ga0307411_100055826 361
324 3300032126 Ga0307415_100068277 Ga0307415_1000682772 361
325 3300044656 Ga0466969_0001546 Ga0466969_0001546_2182_3525 361
326 3300044693 Ga0466961_0013094 Ga0466961_0013094_3946_5289 361
327 3300045049 Ga0466959_0111171 Ga0466959_0111171_593_1936 361
328 3300048928 Ga0496125_0013811 Ga0496125_0013811_23_1111 361
329 3300049570 Ga0501033_0008226 Ga0501033_0008226_4465_5643 361
330 3300003578 Ga0006562J51391_1125310 Ga0006562J51391_11253102 362
331 3300046459 Ga0495629_0001180 Ga0495629_0001180_11539_12771 362
332 3300046499 Ga0495594_0002593 Ga0495594_0002593_4263_5495 362
333 3300014325 Ga0163163_10006460 Ga0163163_100064603 363
334 3300014968 Ga0157379_10010078 Ga0157379_100100785 363
335 3300031548 Ga0307408_100308651 Ga0307408_1003086511 363
336 3300031901 Ga0307406_10100425 Ga0307406_101004252 363
337 3300049568 Ga0501031_0057703 Ga0501031_0057703_1103_2311 363
338 3300021384 Ga0213876_10010848 Ga0213876_100108484 364
339 3300021388 Ga0213875_10056079 Ga0213875_100560792 364
340 3300037853 Ga0436364_0890719 Ga0436364_0890719_443_1624 364
341 3300039437 Ga0436365_0131163 Ga0436365_0131163_14549_15730 364
342 3300003659 JGI25404J52841_10006877 JGI25404J52841_100068771 365
343 3300005983 Ga0081540_1000015 Ga0081540_1000015105 365
344 iso_pu_bacteria 2863404153 2863411441 365
345 iso_pu_bacteria 2970627176 2970632234 365
346 3300005535 Ga0070684_100101345 Ga0070684_1001013452 366
347 3300006038 Ga0075365_10122000 Ga0075365_101220002 366
348 3300031507 Ga0307509_10026600 Ga0307509_100266002 366
349 3300050492 nmdc:mga0yw44_112491_c1 nmdc:mga0yw44_112491_c1_97_1326 366
350 iso_pu_bacteria 2554235005 2554256684 366
351 3300005329 Ga0070683_100000671 Ga0070683_1000006713 367
352 3300005535 Ga0070684_100174109 Ga0070684_1001741092 367
353 3300005564 Ga0070664_100242262 Ga0070664_1002422622 367
354 3300005577 Ga0068857_100363315 Ga0068857_1003633151 367
355 3300025944 Ga0207661_10230636 Ga0207661_102306361 367
356 3300025945 Ga0207679_10211438 Ga0207679_102114382 367
357 3300026116 Ga0207674_10122006 Ga0207674_101220062 367
358 3300035692 Ga0373935_0024589 Ga0373935_0024589_1801_2985 367
359 3300041404 Ga0439436_0029423 Ga0439436_0029423_172_1338 367
360 3300046660 Ga0495625_0006326 Ga0495625_0006326_950_2191 367
361 3300053079 Ga0500610_0020212 Ga0500610_0020212_1302_2531 367
362 iso_pu_bacteria 2547132111 2547411774 367
363 iso_pu_bacteria 2643221678 2644439450 367
364 iso_pu_bacteria 2643221714 2644633169 367
365 iso_pu_bacteria 2784132148 2784589846 367
366 iso_pu_bacteria 2808606359 2808843453 367
367 iso_pu_bacteria 2808606375 2808913036 367
368 iso_pu_bacteria 2811994879 2812356589 367
369 iso_pu_bacteria 2811994917 2812479302 367
370 iso_pu_bacteria 2852635781 2852642736 367
371 iso_pu_bacteria 2862281513 2862287130 367
372 iso_pu_bacteria 2862290372 2862290533 367
373 iso_pu_bacteria 2862507626 2862512003 367
374 iso_pu_bacteria 2912715099 2912718324 367
375 iso_pu_bacteria 2919468124 2919470349 367
376 iso_pu_bacteria 2946064051 2946069280 367
377 iso_pu_bacteria 2946072368 2946077226 367
378 iso_pu_bacteria 2947224130 2947227642 367
379 iso_pu_bacteria 2954002825 2954004864 367
380 iso_pu_bacteria 2997451912 2997457905 367
381 iso_pu_bacteria 3006493962 3006498933 367
382 iso_pu_bacteria 8023623736 8023625557 367
383 3300005467 Ga0070706_100115397 Ga0070706_1001153972 368
384 3300005618 Ga0068864_100412060 Ga0068864_1004120601 368
385 3300005719 Ga0068861_100330252 Ga0068861_1003302521 368
386 3300006058 Ga0075432_10000047 Ga0075432_100000474 368
387 3300006871 Ga0075434_100000827 Ga0075434_10000082718 368
388 3300006881 Ga0068865_100018795 Ga0068865_1000187952 368
389 3300006914 Ga0075436_100018212 Ga0075436_1000182123 368
390 3300007076 Ga0075435_100000832 Ga0075435_1000008322 368
391 3300009094 Ga0111539_10000480 Ga0111539_100004809 368
392 3300009176 Ga0105242_10242970 Ga0105242_102429701 368
393 3300013306 Ga0163162_10174095 Ga0163162_101740952 368
394 3300013308 Ga0157375_10087246 Ga0157375_100872462 368
395 3300025935 Ga0207709_10064486 Ga0207709_100644862 368
396 3300026023 Ga0207677_10207273 Ga0207677_102072732 368
397 3300026088 Ga0207641_10072829 Ga0207641_100728292 368
398 3300026118 Ga0207675_100084095 Ga0207675_1000840952 368
399 3300027907 Ga0207428_10000414 Ga0207428_1000041433 368
400 3300050511 nmdc:mga08y16_53351_c1 nmdc:mga08y16_53351_c1_1115_2329 368
401 3300050512 nmdc:mga0n895_407_c1 nmdc:mga0n895_407_c1_15401_16615 368
402 3300050513 nmdc:mga0rr50_723_c1 nmdc:mga0rr50_723_c1_1912_3126 368
403 3300050514 nmdc:mga08x19_2264_c1 nmdc:mga08x19_2264_c1_1685_2899 368
404 3300050515 nmdc:mga0a205_290_c1 nmdc:mga0a205_290_c1_17312_18526 368
405 iso_pu_bacteria 2582581314 2585320637 368
406 iso_pu_bacteria 2862574272 2862578064 368
407 iso_pu_bacteria 2873151551 2873154601 368
408 3300044658 Ga0466972_0005668 Ga0466972_0005668_833_2032 369
409 3300044658 Ga0466972_0016768 Ga0466972_0016768_20_1231 369
410 3300044684 Ga0466966_0023152 Ga0466966_0023152_577_1776 369
411 3300044693 Ga0466961_0017393 Ga0466961_0017393_2967_4166 369
412 3300044719 Ga0466971_0068446 Ga0466971_0068446_201_1400 369
413 3300044735 Ga0466968_0005590 Ga0466968_0005590_2515_3714 369
414 3300044735 Ga0466968_0036287 Ga0466968_0036287_795_2006 369
415 3300061719 Ga0466962_0060493 Ga0466962_0060493_41_1240 369
416 iso_pu_bacteria 2877676314 2877679680 369
417 iso_pu_bacteria 2935390628 2935395312 369
418 iso_pu_bacteria 3006486233 3006491077 369
419 iso_pu_bacteria 8025530807 8025532554 369
420 3300006051 Ga0075364_10066982 Ga0075364_100669822 370
421 3300009094 Ga0111539_10321853 Ga0111539_103218532 370
422 3300009147 Ga0114129_10150287 Ga0114129_101502872 370
423 3300009174 Ga0105241_10273655 Ga0105241_102736551 370
424 3300025911 Ga0207654_10083168 Ga0207654_100831681 370
425 3300025913 Ga0207695_10077208 Ga0207695_100772085 370
426 3300030521 Ga0307511_10087285 Ga0307511_100872851 370
427 3300031731 Ga0307405_10007934 Ga0307405_100079344 370
428 3300042016 Ga0439463_011931 Ga0439463_011931_515_1675 370
429 3300042993 Ga0439440_0018304 Ga0439440_0018304_69_1241 370
430 3300046533 Ga0495640_0025798 Ga0495640_0025798_2394_3596 370
431 3300047317 Ga0495604_0014962 Ga0495604_0014962_3079_4281 370
432 3300053092 Ga0500583_0003516 Ga0500583_0003516_43_1170 370
433 3300053124 Ga0500617_049386 Ga0500617_049386_350_1477 370
434 iso_pu_bacteria 2643221554 2643792188 370
435 iso_pu_bacteria 2818991463 2819695128 370
436 iso_pu_bacteria 2842711865 2842716642 370
437 iso_pu_bacteria 2997600082 2997600477 370
438 iso_pu_bacteria 8025478263 8025480132 370
439 iso_pu_bacteria 8056667051 8056669695 370
440 iso_pu_bacteria 8056829672 8056837503 370
441 3300005339 Ga0070660_100146798 Ga0070660_1001467981 371
442 3300005841 Ga0068863_100020744 Ga0068863_1000207442 371
443 3300005843 Ga0068860_100000071 Ga0068860_10000007114 371
444 3300005981 Ga0081538_10013228 Ga0081538_100132282 371
445 3300013104 Ga0157370_10046598 Ga0157370_100465983 371
446 3300014325 Ga0163163_10039681 Ga0163163_100396814 371
447 3300014325 Ga0163163_10068004 Ga0163163_100680042 371
448 3300014968 Ga0157379_10038798 Ga0157379_100387982 371
449 3300025919 Ga0207657_10098975 Ga0207657_100989752 371
450 3300025932 Ga0207690_10125823 Ga0207690_101258231 371
451 3300026035 Ga0207703_10193940 Ga0207703_101939401 371
452 3300026088 Ga0207641_10012083 Ga0207641_100120837 371
453 3300028381 Ga0268264_10000073 Ga0268264_1000007383 371
454 3300039447 Ga0436361_0877021 Ga0436361_0877021_93_1256 371
455 3300042126 Ga0450888_002879 Ga0450888_002879_318_1523 371
456 3300042436 Ga0439435_0012565 Ga0439435_0012565_447_1652 371
457 3300048905 Ga0496102_0001851 Ga0496102_0001851_467_1612 371
458 3300048906 Ga0496103_0056122 Ga0496103_0056122_54_1199 371
459 3300048907 Ga0496104_0125931 Ga0496104_0125931_1062_2231 371
460 3300048907 Ga0496104_0169752 Ga0496104_0169752_353_1522 371
461 3300048915 Ga0496112_0016408 Ga0496112_0016408_3054_4223 371
462 3300048919 Ga0496116_0009607 Ga0496116_0009607_4947_6092 371
463 3300048920 Ga0496117_0004662 Ga0496117_0004662_6708_7853 371
464 3300048920 Ga0496117_0035536 Ga0496117_0035536_2278_3435 371
465 3300048921 Ga0496118_0000170 Ga0496118_0000170_49320_50465 371
466 3300048921 Ga0496118_0029173 Ga0496118_0029173_2325_3482 371
467 3300048922 Ga0496119_0038802 Ga0496119_0038802_671_1816 371
468 3300048923 Ga0496120_0022316 Ga0496120_0022316_2419_3549 371
469 3300048924 Ga0496121_0003589 Ga0496121_0003589_631_1788 371
470 3300048924 Ga0496121_0113438 Ga0496121_0113438_807_1952 371
471 3300050511 nmdc:mga08y16_1812_c1 nmdc:mga08y16_1812_c1_142_1272 371
472 3300053148 Ga0500590_016406 Ga0500590_016406_1127_2299 371
473 3300053177 Ga0500636_0058029 Ga0500636_0058029_851_2008 371
474 iso_pu_bacteria 2643221548 2643764662 371
475 iso_pu_bacteria 2643221578 2643903061 371
476 iso_pu_bacteria 2643221673 2644404429 371
477 iso_pu_bacteria 2643221682 2644462047 371
478 iso_pu_bacteria 2918501144 2918505933 371
479 iso_pu_bacteria 2946045630 2946048469 371
480 3300003320 rootH2_10005368 rootH2_100053686 372
481 3300005337 Ga0070682_100096187 Ga0070682_1000961872 372
482 3300005441 Ga0070700_100059747 Ga0070700_1000597471 372
483 3300005718 Ga0068866_10006030 Ga0068866_100060302 372
484 3300006051 Ga0075364_10186742 Ga0075364_101867421 372
485 3300017792 Ga0163161_10031482 Ga0163161_100314822 372
486 3300021388 Ga0213875_10000331 Ga0213875_1000033119 372
487 3300025934 Ga0207686_10011919 Ga0207686_100119192 372
488 3300025937 Ga0207669_10008983 Ga0207669_100089832 372
489 3300025942 Ga0207689_10260614 Ga0207689_102606142 372
490 3300044719 Ga0466971_0053526 Ga0466971_0053526_535_1713 372
491 3300045049 Ga0466959_0079713 Ga0466959_0079713_60_1238 372
492 iso_pu_bacteria 2643221670 2644389512 372
493 iso_pu_bacteria 2643221677 2644428972 372
494 iso_pu_bacteria 2802429296 2804845400 372
495 iso_pu_bacteria 2808606418 2809147783 372
496 iso_pu_bacteria 8025413630 8025419170 372
497 3300005439 Ga0070711_100039410 Ga0070711_1000394101 373
498 3300005458 Ga0070681_10197585 Ga0070681_101975852 373
499 3300005471 Ga0070698_100020283 Ga0070698_1000202836 373
500 3300006028 Ga0070717_10090369 Ga0070717_100903692 373
501 3300009093 Ga0105240_10178645 Ga0105240_101786452 373
502 3300009177 Ga0105248_10025817 Ga0105248_100258174 373
503 3300009545 Ga0105237_10001657 Ga0105237_1000165710 373
504 3300010375 Ga0105239_10246401 Ga0105239_102464012 373
505 3300013307 Ga0157372_10145736 Ga0157372_101457362 373
506 3300025917 Ga0207660_10042774 Ga0207660_100427742 373
507 3300025921 Ga0207652_10255747 Ga0207652_102557472 373
508 3300026078 Ga0207702_10058948 Ga0207702_100589482 373
509 3300031456 Ga0307513_10188923 Ga0307513_101889232 373
510 3300044901 Ga0466960_0005572 Ga0466960_0005572_3734_4888 373
511 3300045976 Ga0466967_0244822 Ga0466967_0244822_17_1174 373
512 3300046520 Ga0495637_0015868 Ga0495637_0015868_1971_3170 373
513 iso_pu_bacteria 2643221601 2644014370 373
514 iso_pu_bacteria 2643221631 2644175807 373
515 iso_pu_bacteria 2867369537 2867373337 373
516 iso_pu_bacteria 2887478801 2887481496 373
517 iso_pu_bacteria 2891088606 2891088863 373
518 iso_pu_bacteria 2984576629 2984577400 373
519 iso_pu_bacteria 2990256926 2990259561 373
520 3300001990 JGI24737J22298_10025636 JGI24737J22298_100256362 374
521 3300003203 JGI25406J46586_10002652 JGI25406J46586_100026525 374
522 3300005327 Ga0070658_10001625 Ga0070658_1000162513 374
523 3300005329 Ga0070683_100001811 Ga0070683_10000181111 374
524 3300005344 Ga0070661_100011520 Ga0070661_1000115202 374
525 3300005366 Ga0070659_100021238 Ga0070659_1000212385 374
526 3300005535 Ga0070684_100012852 Ga0070684_1000128527 374
527 3300005564 Ga0070664_100003301 Ga0070664_1000033017 374
528 3300005834 Ga0068851_10050907 Ga0068851_100509072 374
529 3300005985 Ga0081539_10000467 Ga0081539_1000046718 374
530 3300006846 Ga0075430_100005621 Ga0075430_1000056215 374
531 3300009098 Ga0105245_10058773 Ga0105245_100587732 374
532 3300013307 Ga0157372_10085383 Ga0157372_100853832 374
533 3300025321 Ga0207656_10028592 Ga0207656_100285923 374
534 3300025909 Ga0207705_10029260 Ga0207705_100292604 374
535 3300025920 Ga0207649_10008179 Ga0207649_100081795 374
536 3300025932 Ga0207690_10114158 Ga0207690_101141582 374
537 3300025944 Ga0207661_10053780 Ga0207661_100537802 374
538 3300025945 Ga0207679_10039445 Ga0207679_100394453 374
539 3300026041 Ga0207639_10167097 Ga0207639_101670972 374
540 3300030522 Ga0307512_10012763 Ga0307512_1001276310 374
541 3300036401 Ga0373937_0009033 Ga0373937_0009033_4736_5905 374
542 3300042010 Ga0439452_007479 Ga0439452_007479_1576_2778 374
543 3300046462 Ga0495651_0003089 Ga0495651_0003089_7285_8454 374
544 3300046477 Ga0495664_0084998 Ga0495664_0084998_619_1788 374
545 3300046514 Ga0495618_0040590 Ga0495618_0040590_622_1791 374
546 3300046516 Ga0495628_0054376 Ga0495628_0054376_837_2006 374
547 3300048088 Ga0495602_0010432 Ga0495602_0010432_3887_5056 374
548 3300048912 Ga0496109_0251242 Ga0496109_0251242_65_1234 374
549 3300048916 Ga0496113_0007654 Ga0496113_0007654_4498_5667 374
550 3300050509 nmdc:mga0qj67_17136_c1 nmdc:mga0qj67_17136_c1_1344_2501 374
551 3300053153 Ga0500616_0000382 Ga0500616_0000382_133_1323 374
552 iso_pu_bacteria 2582581312 2585296032 374
553 iso_pu_bacteria 2738541308 2738889106 374
554 iso_pu_bacteria 2791355406 2793983130 374
555 iso_pu_bacteria 2891968417 2891971722 374
556 iso_pu_bacteria 2912723979 2912730676 374
557 iso_pu_bacteria 2966598605 2966601345 374
558 iso_pu_bacteria 3006393351 3006397375 374
559 iso_pu_bacteria 8008558824 8008566674 374
560 iso_pu_bacteria 8047893842 8047898159 374
561 iso_pu_bacteria 8048356638 8048360734 374
562 iso_pu_bacteria 8048369669 8048375122 374
563 iso_pu_bacteria 8048379754 8048383084 374
564 3300003214 JGI25165J46597_1000039 JGI25165J46597_1000039115 375
565 3300005548 Ga0070665_100001114 Ga0070665_10000111414 375
566 3300005983 Ga0081540_1001911 Ga0081540_100191116 375
567 3300006847 Ga0075431_100072337 Ga0075431_1000723372 375
568 3300025261 Ga0209233_1000052 Ga0209233_1000052271 375
569 3300028379 Ga0268266_10004227 Ga0268266_100042277 375
570 3300048912 Ga0496109_0000005 Ga0496109_0000005_188106_189257 375
571 3300053124 Ga0500617_041453 Ga0500617_041453_766_1911 375
572 3300053146 Ga0500588_0000048 Ga0500588_0000048_5393_6538 375
573 iso_pu_bacteria 2565956761 2566993810 375
574 iso_pu_bacteria 2791354901 2791916009 375
575 iso_pu_bacteria 2904535858 2904536901 375
576 iso_pu_bacteria 2922554459 2922555328 375
577 iso_pu_bacteria 8054160619 8054166713 375
578 iso_pu_bacteria 8056447290 8056451056 375
579 3300005985 Ga0081539_10001898 Ga0081539_1000189816 376
580 3300005985 Ga0081539_10006835 Ga0081539_100068357 376
581 3300006847 Ga0075431_100075559 Ga0075431_1000755593 376
582 3300038705 Ga0237819_00294 Ga0237819_00294_10968_12146 376
583 3300039145 Ga0237816_00412 Ga0237816_00412_605_1783 376
584 3300050510 nmdc:mga06r32_19462_c2 nmdc:mga06r32_19462_c2_1365_2516 376
585 iso_pu_bacteria 2523231044 2523388020 376
586 iso_pu_bacteria 2524614857 2526062236 376
587 iso_pu_bacteria 2547132424 2548698608 376
588 iso_pu_bacteria 2551306166 2552110241 376
589 iso_pu_bacteria 2643221692 2644513590 376
590 iso_pu_bacteria 2739367875 2740063581 376
591 3300005435 Ga0070714_100096985 Ga0070714_1000969852 377
592 3300006846 Ga0075430_100001290 Ga0075430_10000129016 377
593 3300006847 Ga0075431_100058906 Ga0075431_1000589062 377
594 3300006880 Ga0075429_100000537 Ga0075429_1000005379 377
595 3300009147 Ga0114129_10033119 Ga0114129_100331194 377
596 3300013307 Ga0157372_10028130 Ga0157372_100281302 377
597 3300021388 Ga0213875_10004055 Ga0213875_100040552 377
598 3300037418 Ga0395900_0200675 Ga0395900_0200675_112_1320 377
599 3300045976 Ga0466967_0040950 Ga0466967_0040950_877_2037 377
600 3300050507 nmdc:mga05p37_87494_c1 nmdc:mga05p37_87494_c1_1588_2751 377
601 iso_pu_bacteria 2616644941 2616903136 377
602 iso_pu_bacteria 2675903059 2676487284 377
603 iso_pu_bacteria 2784746768 2785370895 377
604 iso_pu_bacteria 2811994874 2812330969 377
605 iso_pu_bacteria 2875391855 2875396149 377
606 iso_pu_bacteria 2954682443 2954685809 377
607 iso_pu_bacteria 2954701450 2954710641 377
608 iso_pu_bacteria 8048406513 8048413709 377
609 3300005327 Ga0070658_10115006 Ga0070658_101150061 378
610 3300005337 Ga0070682_100196309 Ga0070682_1001963092 378
611 3300005366 Ga0070659_100039202 Ga0070659_1000392022 378
612 3300005458 Ga0070681_10104143 Ga0070681_101041433 378
613 3300005530 Ga0070679_100071710 Ga0070679_1000717102 378
614 3300013105 Ga0157369_10007469 Ga0157369_1000746910 378
615 3300013307 Ga0157372_10310372 Ga0157372_103103722 378
616 3300025917 Ga0207660_10068256 Ga0207660_100682562 378
617 3300025921 Ga0207652_10193469 Ga0207652_101934692 378
618 3300025932 Ga0207690_10058506 Ga0207690_100585062 378
619 3300025944 Ga0207661_10181988 Ga0207661_101819882 378
620 3300026116 Ga0207674_10022475 Ga0207674_100224755 378
621 3300031911 Ga0307412_10047784 Ga0307412_100477843 378
622 3300031995 Ga0307409_100001488 Ga0307409_1000014883 378
623 3300032002 Ga0307416_100004329 Ga0307416_1000043293 378
624 3300032126 Ga0307415_100000194 Ga0307415_10000019418 378
625 3300037068 Ga0373925_0000035 Ga0373925_0000035_21969_23174 378
626 3300046531 Ga0495665_0034168 Ga0495665_0034168_283_1443 378
627 3300048915 Ga0496112_0245536 Ga0496112_0245536_533_1711 378
628 3300003203 JGI25406J46586_10021263 JGI25406J46586_100212632 379
629 3300005334 Ga0068869_100024799 Ga0068869_1000247992 379
630 3300005338 Ga0068868_100091754 Ga0068868_1000917542 379
631 3300005339 Ga0070660_100132708 Ga0070660_1001327082 379
632 3300005344 Ga0070661_100040979 Ga0070661_1000409792 379
633 3300005354 Ga0070675_100000369 Ga0070675_10000036913 379
634 3300005366 Ga0070659_100006971 Ga0070659_1000069714 379
635 3300005456 Ga0070678_100065444 Ga0070678_1000654442 379
636 3300005535 Ga0070684_100027661 Ga0070684_1000276614 379
637 3300005563 Ga0068855_100454757 Ga0068855_1004547571 379
638 3300005564 Ga0070664_100000532 Ga0070664_10000053210 379
639 3300005577 Ga0068857_100040971 Ga0068857_1000409712 379
640 3300005616 Ga0068852_100170587 Ga0068852_1001705872 379
641 3300005841 Ga0068863_100259097 Ga0068863_1002590971 379
642 3300005843 Ga0068860_100161277 Ga0068860_1001612772 379
643 3300005844 Ga0068862_100005493 Ga0068862_1000054935 379
644 3300005985 Ga0081539_10000451 Ga0081539_1000045182 379
645 3300006844 Ga0075428_100003309 Ga0075428_10000330911 379
646 3300006846 Ga0075430_100236181 Ga0075430_1002361812 379
647 3300006847 Ga0075431_100010614 Ga0075431_1000106145 379
648 3300006871 Ga0075434_100006533 Ga0075434_1000065337 379
649 3300006881 Ga0068865_100021210 Ga0068865_1000212103 379
650 3300007076 Ga0075435_100001304 Ga0075435_10000130411 379
651 3300010375 Ga0105239_10026627 Ga0105239_100266272 379
652 3300025926 Ga0207659_10008569 Ga0207659_100085692 379
653 3300025932 Ga0207690_10078437 Ga0207690_100784372 379
654 3300025933 Ga0207706_10008456 Ga0207706_100084562 379
655 3300025942 Ga0207689_10010688 Ga0207689_100106882 379
656 3300025944 Ga0207661_10059103 Ga0207661_100591032 379
657 3300026075 Ga0207708_10001255 Ga0207708_1000125514 379
658 3300028380 Ga0268265_10025280 Ga0268265_100252802 379
659 3300031456 Ga0307513_10049426 Ga0307513_100494262 379
660 3300031548 Ga0307408_100028710 Ga0307408_1000287103 379
661 3300031824 Ga0307413_10040339 Ga0307413_100403392 379
662 3300031852 Ga0307410_10016233 Ga0307410_100162333 379
663 3300031901 Ga0307406_10032269 Ga0307406_100322692 379
664 3300031995 Ga0307409_100106663 Ga0307409_1001066632 379
665 3300046616 Ga0495668_0000360 Ga0495668_0000360_16829_17992 379
666 3300048911 Ga0496108_0021985 Ga0496108_0021985_3284_4447 379
667 3300050507 nmdc:mga05p37_275595_c1 nmdc:mga05p37_275595_c1_51_1244 379
668 3300050510 nmdc:mga06r32_37026_c1 nmdc:mga06r32_37026_c1_2499_3692 379
669 3300050512 nmdc:mga0n895_5615_c1 nmdc:mga0n895_5615_c1_7526_8719 379
670 iso_pu_bacteria 2643221641 2644228040 379
671 iso_pu_bacteria 2751185782 2753267648 379
672 iso_pu_bacteria 2844009547 2844015921 379
673 iso_pu_bacteria 2869169390 2869171188 379
674 iso_pu_bacteria 2869234852 2869238146 379
675 iso_pu_bacteria 2869242130 2869244483 379
676 iso_pu_bacteria 2869256925 2869258444 379
677 iso_pu_bacteria 2871435913 2871440924 379
678 iso_pu_bacteria 2871481445 2871483741 379
679 iso_pu_bacteria 2874116593 2874121486 379
680 iso_pu_bacteria 2876386047 2876389374 379
681 iso_pu_bacteria 2876420981 2876427633 379
682 iso_pu_bacteria 2878730984 2878732652 379
683 iso_pu_bacteria 2903513507 2903514577 379
684 iso_pu_bacteria 2906401398 2906403659 379
685 iso_pu_bacteria 2919713450 2919719278 379
686 iso_pu_bacteria 2924741084 2924742949 379
687 iso_pu_bacteria 8048127548 8048136738 379
688 3300003373 JGI25407J50210_10027726 JGI25407J50210_100277261 380
689 3300005614 Ga0068856_100326355 Ga0068856_1003263552 380
690 3300005981 Ga0081538_10001154 Ga0081538_1000115420 380
691 3300006844 Ga0075428_100045640 Ga0075428_1000456405 380
692 3300009147 Ga0114129_10001682 Ga0114129_100016826 380
693 3300025961 Ga0207712_10031583 Ga0207712_100315832 380
694 3300025972 Ga0207668_10039250 Ga0207668_100392502 380
695 3300026118 Ga0207675_100035330 Ga0207675_1000353305 380
696 3300031548 Ga0307408_100020852 Ga0307408_1000208524 380
697 3300031824 Ga0307413_10004031 Ga0307413_100040313 380
698 3300031852 Ga0307410_10001395 Ga0307410_100013955 380
699 3300031901 Ga0307406_10055120 Ga0307406_100551202 380
700 3300031901 Ga0307406_10068532 Ga0307406_100685322 380
701 3300031903 Ga0307407_10000367 Ga0307407_100003677 380
702 3300031911 Ga0307412_10014402 Ga0307412_100144024 380
703 3300031995 Ga0307409_100004026 Ga0307409_1000040264 380
704 3300032002 Ga0307416_100005336 Ga0307416_1000053362 380
705 3300032004 Ga0307414_10006691 Ga0307414_100066912 380
706 3300032005 Ga0307411_10002539 Ga0307411_100025395 380
707 3300032126 Ga0307415_100008010 Ga0307415_1000080102 380
708 3300042016 Ga0439463_000572 Ga0439463_000572_1773_2987 380
709 3300042435 Ga0439434_0034594 Ga0439434_0034594_14_1192 380
710 3300042439 Ga0439464_0000901 Ga0439464_0000901_2743_3957 380
711 3300042993 Ga0439440_0001068 Ga0439440_0001068_1721_2935 380
712 3300044693 Ga0466961_0031466 Ga0466961_0031466_232_1428 380
713 3300044765 Ga0466970_0012634 Ga0466970_0012634_2219_3415 380
714 3300045049 Ga0466959_0236025 Ga0466959_0236025_40_1236 380
715 3300050507 nmdc:mga05p37_6258_c1 nmdc:mga05p37_6258_c1_1857_3014 380
716 3300053155 Ga0500620_000026 Ga0500620_000026_1435_2664 380
717 iso_pu_bacteria 2510065059 2510316769 380
718 iso_pu_bacteria 2888337043 2888341990 380
719 iso_pu_bacteria 2906378014 2906379689 380
720 iso_pu_bacteria 2924710171 2924717959 380
721 iso_pu_bacteria 2924718760 2924724975 380
722 iso_pu_bacteria 2924762789 2924762884 380
723 iso_pu_bacteria 2937861824 2937865257 380
724 iso_pu_bacteria 2937980651 2937983913 380
725 iso_pu_bacteria 2958108152 2958110053 380
726 iso_pu_bacteria 2961183825 2961183861 380
727 iso_pu_bacteria 2968128360 2968128432 380
728 iso_pu_bacteria 2968138860 2968143971 380
729 iso_pu_bacteria 2970532167 2970538409 380
730 iso_pu_bacteria 2970619444 2970624647 380
731 iso_pu_bacteria 2977851361 2977854667 380
732 iso_pu_bacteria 2977858184 2977859950 380
733 iso_pu_bacteria 2977898635 2977906368 380
734 iso_pu_bacteria 2977907340 2977913929 380
735 iso_pu_bacteria 2979772303 2979775075 380
736 iso_pu_bacteria 2987666974 2987669485 380
737 iso_pu_bacteria 2996386984 2996391307 380
738 iso_pu_bacteria 3000135777 3000141120 380
739 iso_pu_bacteria 3004232784 3004234136 380
740 iso_pu_bacteria 3004248173 3004251617 380
741 iso_pu_bacteria 3004268573 3004270323 380
742 iso_pu_bacteria 8004312739 8004313003 380
743 iso_pu_bacteria 8004445564 8004451994 380
744 iso_pu_bacteria 8004727605 8004728444 380
745 3300005937 Ga0081455_10004863 Ga0081455_100048637 381
746 3300006847 Ga0075431_100227080 Ga0075431_1002270802 381
747 3300044693 Ga0466961_0005618 Ga0466961_0005618_1724_2923 381
748 3300044765 Ga0466970_0006863 Ga0466970_0006863_458_1657 381
749 3300045836 Ga0466958_0014986 Ga0466958_0014986_2680_3879 381
750 3300048903 Ga0496100_0287813 Ga0496100_0287813_18_1190 381
751 3300048911 Ga0496108_0134936 Ga0496108_0134936_510_1709 381
752 3300061719 Ga0466962_0078426 Ga0466962_0078426_317_1516 381
753 iso_pu_bacteria 2937822353 2937828672 381
754 iso_pu_bacteria 8003856774 8003862198 381
755 iso_pu_bacteria 2885312484 2885315623 382
756 iso_pu_bacteria 2888343758 2888349307 382
757 iso_pu_bacteria 2924754689 2924759276 382
758 3300041413 Ga0439465_0005187 Ga0439465_0005187_2733_3947 383
759 3300042125 Ga0450923_003317 Ga0450923_003317_977_2191 383
760 3300042145 Ga0450906_000390 Ga0450906_000390_4934_6148 383
761 3300042147 Ga0450910_000271 Ga0450910_000271_1198_2412 383
762 3300042435 Ga0439434_0001562 Ga0439434_0001562_3006_4220 383
763 3300050496 nmdc:mga07m45_4672_c1 nmdc:mga07m45_4672_c1_1515_2687 383
764 3300006195 Ga0075366_10005045 Ga0075366_100050452 384
765 3300028786 Ga0307517_10000024 Ga0307517_10000024155 384
766 3300031456 Ga0307513_10023105 Ga0307513_100231053 384
767 3300031548 Ga0307408_100273277 Ga0307408_1002732771 384
768 3300031730 Ga0307516_10042597 Ga0307516_100425972 384
769 3300039093 Ga0400489_80170 Ga0400489_80170_647_1846 384
770 3300046542 Ga0495597_0005059 Ga0495597_0005059_3054_4241 384
771 3300047443 Ga0495687_000705 Ga0495687_000705_8480_9667 384
772 3300050493 nmdc:mga0k408_2181_c1 nmdc:mga0k408_2181_c1_7494_8681 384
773 3300050493 nmdc:mga0k408_512_c1 nmdc:mga0k408_512_c1_12898_14085 384
774 3300050493 nmdc:mga0k408_512_c1 nmdc:mga0k408_512_c1_7246_8433 384
775 3300050496 nmdc:mga07m45_8635_c1 nmdc:mga07m45_8635_c1_1533_2720 384
776 iso_pu_bacteria 2526164512 2526211088 384
777 3300025297 Ga0209758_1000177 Ga0209758_100017797 385
778 3300025929 Ga0207664_10141329 Ga0207664_101413291 385
779 3300031456 Ga0307513_10002712 Ga0307513_1000271225 385
780 3300031852 Ga0307410_10085876 Ga0307410_100858762 385
781 3300003771 Ga0055526_1002198 Ga0055526_10021985 386
782 3300025245 Ga0207425_1000151 Ga0207425_100015110 386
783 3300025258 Ga0209129_1000038 Ga0209129_100003896 386
784 3300025273 Ga0209673_1009204 Ga0209673_10092042 386
785 3300025295 Ga0209564_1000129 Ga0209564_100012991 386
786 3300025297 Ga0209758_1000197 Ga0209758_100019791 386
787 3300049823 Ga0501044_0173525 Ga0501044_0173525_414_1628 386
788 3300009148 Ga0105243_10011746 Ga0105243_100117464 387
789 3300025711 Ga0207696_1015392 Ga0207696_10153922 387
790 3300025935 Ga0207709_10000159 Ga0207709_1000015943 387
791 3300027111 Ga0209281_1000007 Ga0209281_1000007107 387
792 3300044842 Ga0466957_0019356 Ga0466957_0019356_2760_3956 387
793 3300045051 Ga0451576_0027699 Ga0451576_0027699_3286_4476 387
794 3300003781 Ga0055536_1006996 Ga0055536_10069962 388
795 3300003792 Ga0055540_1003365 Ga0055540_10033654 388
796 3300005577 Ga0068857_100278575 Ga0068857_1002785751 388
797 3300006038 Ga0075365_10003004 Ga0075365_100030042 388
798 3300006051 Ga0075364_10194894 Ga0075364_101948942 388
799 3300009093 Ga0105240_10255687 Ga0105240_102556872 388
800 3300009545 Ga0105237_10037081 Ga0105237_100370814 388
801 3300013100 Ga0157373_10076211 Ga0157373_100762112 388
802 3300025291 Ga0209675_1009032 Ga0209675_10090323 388
803 3300025292 Ga0209676_1000416 Ga0209676_100041671 388
804 3300025303 Ga0209051_1000389 Ga0209051_100038958 388
805 3300025935 Ga0207709_10000195 Ga0207709_1000019512 388
806 3300026041 Ga0207639_10054204 Ga0207639_100542042 388
807 3300046522 Ga0495643_0000095 Ga0495643_0000095_71412_72614 388
808 3300046694 Ga0495649_0002710 Ga0495649_0002710_8600_9802 388
809 3300048919 Ga0496116_0075802 Ga0496116_0075802_528_1739 388
810 3300048920 Ga0496117_0052221 Ga0496117_0052221_1606_2817 388
811 3300048927 Ga0496124_0055964 Ga0496124_0055964_75_1289 388
812 3300050489 nmdc:mga03683_5569_c1 nmdc:mga03683_5569_c1_2923_4137 388
813 3300050491 nmdc:mga00v17_62914_c1 nmdc:mga00v17_62914_c1_138_1352 388
814 3300050492 nmdc:mga0yw44_14097_c1 nmdc:mga0yw44_14097_c1_2881_4095 388
815 iso_pu_bacteria 2738543020 2739289896 388
816 iso_pu_bacteria 2738543021 2739295208 388
817 3300003187 JGI25151J46595_10001059 JGI25151J46595_100010597 389
818 3300003187 JGI25151J46595_10001387 JGI25151J46595_100013874 389
819 3300006186 Ga0075369_10024745 Ga0075369_100247452 389
820 3300006353 Ga0075370_10001643 Ga0075370_100016438 389
821 3300013104 Ga0157370_10000627 Ga0157370_100006277 389
822 3300014497 Ga0182008_10075848 Ga0182008_100758482 389
823 3300017792 Ga0163161_10000142 Ga0163161_1000014237 389
824 3300025258 Ga0209129_1004124 Ga0209129_10041242 389
825 3300025294 Ga0209025_1000290 Ga0209025_100029076 389
826 3300031911 Ga0307412_10002033 Ga0307412_100020331 389
827 3300050496 nmdc:mga07m45_4348_c1 nmdc:mga07m45_4348_c1_4762_5979 389
828 iso_pu_bacteria 2839138175 2839142909 389
829 iso_pu_bacteria 2919130084 2919131880 389
830 iso_pu_bacteria 2929195423 2929197758 389
831 iso_pu_bacteria 2945909444 2945914859 389
832 iso_pu_bacteria 8021648035 8021648769 389
833 3300044693 Ga0466961_0010698 Ga0466961_0010698_20_1228 391
834 3300045049 Ga0466959_0115041 Ga0466959_0115041_640_1848 391
835 3300005578 Ga0068854_100006144 Ga0068854_1000061445 392
836 3300005614 Ga0068856_100296408 Ga0068856_1002964081 392
837 3300009093 Ga0105240_10336930 Ga0105240_103369302 392
838 3300009545 Ga0105237_10032791 Ga0105237_100327913 392
839 3300009551 Ga0105238_10000004 Ga0105238_10000004283 392
840 3300010375 Ga0105239_10001124 Ga0105239_100011247 392
841 3300015261 Ga0182006_1001099 Ga0182006_10010996 392
842 3300015262 Ga0182007_10018442 Ga0182007_100184422 392
843 3300025913 Ga0207695_10001226 Ga0207695_1000122630 392
844 3300025914 Ga0207671_10015271 Ga0207671_100152713 392
845 3300025924 Ga0207694_10000021 Ga0207694_10000021201 392
846 3300025949 Ga0207667_10000019 Ga0207667_10000019337 392
847 3300025981 Ga0207640_10057398 Ga0207640_100573982 392
848 3300046525 Ga0495663_0000719 Ga0495663_0000719_4891_6087 392
849 iso_pu_bacteria 2818991449 2819617918 392
850 iso_pu_bacteria 2904439833 2904442063 392
851 iso_pu_bacteria 2904601388 2904601956 392
852 2162886007 SwRhRL2b_contig_1267809 SwRhRL2b_0569.00001690 393
853 3300009011 Ga0105251_10000041 Ga0105251_1000004161 393
854 3300013100 Ga0157373_10009233 Ga0157373_100092334 393
855 3300025735 Ga0207713_1000776 Ga0207713_10007768 393
856 3300048920 Ga0496117_0001874 Ga0496117_0001874_15341_16522 393
857 3300048922 Ga0496119_0000140 Ga0496119_0000140_49943_51124 393
858 3300048923 Ga0496120_0000011 Ga0496120_0000011_167073_168254 393
859 3300048925 Ga0496122_0000253 Ga0496122_0000253_68662_69843 393
860 3300048925 Ga0496122_0023757 Ga0496122_0023757_2721_3902 393
861 3300048926 Ga0496123_0000206 Ga0496123_0000206_50692_51873 393
862 3300048926 Ga0496123_0013664 Ga0496123_0013664_2709_3890 393
863 3300048927 Ga0496124_0000148 Ga0496124_0000148_93510_94691 393
864 3300048929 Ga0496126_0048149 Ga0496126_0048149_2389_3570 393
865 iso_pu_bacteria 2941489479 2941490996 393

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05762

VWA_CoxE

VWA domain containing CoxE-like protein

235

455

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5of4-assembly1.cif.gz_E the cryo-em structure of human tfiih 0.7404 214 375
8jtl-assembly1.cif.gz_B structure of oy phytoplasma sap05 binding with atrpn10 0.7293 214 363
8amz-assembly1.cif.gz_W spinach 19s proteasome 0.7169 214 363
8byq-assembly1.cif.gz_4 rna polymerase ii pre-initiation complex with the proximal +1 nucleosome (pic-nuc10w) 0.7091 213 375
5ln1-assembly1.cif.gz_A-2 structure of ubiquitylated-rpn10 from yeast; 0.7068 213 364
ID Description Score Start End Superfamily
af_P33352_208_374_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.9565 208 372 3.40.50.410
af_P33352_208_374_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.9399 208 372 3.40.50.410
af_Q8IAR6_4_185_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7617 214 355 3.40.50.410
af_Q502W6_508_661_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7103 216 363 3.40.50.410
af_X1WDY9_182_353_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.708 214 361 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A439LV88-F1-model_v4 VWA domain-containing protein 0.9613 229 393
AF-A0A561MMH2-F1-model_v4 deleted 0.9606 226 393
AF-A0A4Q3AK51-F1-model_v4 deleted 0.9573 142 393
AF-A0A7Y6A5C2-F1-model_v4 VWA domain-containing protein 0.9517 218 375
AF-A0A328VI72-F1-model_v4 VWFA domain-containing protein 0.9496 226 393

Feature Viewer

pLDDT pTM Quality
85.37 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map