F484022

General Info

Members Datasets Scaffolds Average Seq Length
866 477 1732 416

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10064200|Ga0105239_100642004
Length 466
Sequence MLRNFAASLLPDRLPIEPLPVISRVSRSEPVTATTRQLAKVIPLRAGHRSPWHVNTHHRANQRVLAQSTKLANVRYEIRGPVNDEAARLEALGHRILKLNIGNPAPFGFEAPTEILNDIVRALPNAQGYSDSKGILSARRAVVARYELVDGFPRFDVDDVYLGNGASELITMTLQALLSDGDQVLLPAPNYPLWTAATALAGGTPVHYLCDETQGWQPDIADIEAKITPRTKAIVVINPNNPTGAVYSRETLLQIAELARQHRLLLLSDEIYDKILYDDAKHVPMAAVAPDLLCLTFNGLSKAYRVAGYRAGWLVITGPKDHARSFLDGISLLTNMRLCPNVPAQHAVQVALGGYQSIDDLVLPGGRLREQRDVAWSKLNGIPGVSCVKPQGALYAFPRLDPEIYPIVDDEKFALDLLVSEKILVTQGTGFNWPAPDHLRIVTLPCASDLSSAIDRLADFLDGYRH

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
166 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
167 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
168 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
199 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
213 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
216 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
217 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
220 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
223 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
224 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
225 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
226 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
227 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
270 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
298 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
299 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
330 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
331 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
351 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
352 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
353 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
354 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
355 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
356 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
363 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
366 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
367 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
368 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
369 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
370 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
371 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
372 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
373 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
374 2547132424 Nocardia nova SH22a Isolate Unclassified
375 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
376 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
377 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
378 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
379 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
380 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
381 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
382 2643221553 Microbacterium sp. Root553 Isolate Unclassified
383 2643221575 Microbacterium sp. Root61 Isolate Unclassified
384 2643221630 Microbacterium sp. Root322 Isolate Unclassified
385 2643221670 Streptomyces sp. Root431 Isolate Unclassified
386 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
387 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
388 2643221692 Nocardia sp. Root136 Isolate Unclassified
389 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
390 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
391 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
392 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
393 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
394 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
395 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
396 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
397 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
398 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
399 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
400 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
401 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
402 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
403 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
404 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
405 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
406 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
407 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
408 2765235841 Pseudomonas putida AA7 Isolate Unclassified
409 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
410 2773857673 Pseudomonas sp. 443 Isolate Unclassified
411 2773857759 Microbacterium sp. 1294 Isolate Unclassified
412 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
413 2784132063 Pseudomonas sp. 424 Isolate Unclassified
414 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
415 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
416 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
417 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
418 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
419 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
420 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
421 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
422 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
423 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
424 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
425 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
426 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
427 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
428 2862574272 Streptomyces sp. AcE210 Isolate Nodule
429 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
430 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
431 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
432 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
433 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
434 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
435 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
436 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
437 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
438 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
439 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
440 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
441 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
442 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
443 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
444 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
445 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
446 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
447 2922554459 Rhodococcus sp. 66b Isolate Unclassified
448 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
449 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
450 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
451 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
452 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
453 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
454 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
455 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
456 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
457 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
458 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
459 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
460 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
461 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
462 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
463 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
464 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
465 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
466 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
467 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
468 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
469 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
470 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
471 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
472 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
473 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
474 8052494512 Pseudomonas putida LD6 Isolate Unclassified
475 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
476 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
477 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.95
Metatranscriptomes 0.69
Isolates 12.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 9.01
Nodule 0.23
Rhizoplane 10.39
Rhizosphere 64.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10064200 3300010375 Bacteria 4031
2 JGI24750J21931_1002942 3300002070 Bacteria 2039
3 JGI24745J21846_1002152 3300002073 Bacteria 1982
4 JGI24744J21845_10001688 3300002077 Bacteria 4421
5 JGI24744J21845_10006437 3300002077 Bacteria 2436
6 rootH2_10176965 3300003320 Bacteria 2440
7 Ga0055540_1000271 3300003792 Bacteria 46708
8 Ga0055540_1005489 3300003792 Bacteria 5313
9 Ga0055540_1006025 3300003792 Bacteria 4910
10 Ga0070658_10162529 3300005327 Bacteria 1874
11 Ga0070683_100029145 3300005329 Bacteria 4994
12 Ga0070683_100039520 3300005329 Bacteria 4332
13 Ga0070683_100197830 3300005329 Bacteria 1909
14 Ga0070690_100007863 3300005330 Bacteria 6116
15 Ga0068869_100010933 3300005334 Bacteria 5941
16 Ga0068869_100026392 3300005334 Bacteria 4044
17 Ga0070666_10030385 3300005335 Bacteria 3559
18 Ga0070680_100015433 3300005336 Bacteria 5988
19 Ga0070680_100070122 3300005336 Bacteria 2879
20 Ga0070682_100003922 3300005337 Bacteria 8255
21 Ga0070682_100107570 3300005337 Bacteria 1852
22 Ga0068868_100002425 3300005338 Bacteria 12921
23 Ga0070660_100150099 3300005339 Bacteria 1873
24 Ga0070689_100115441 3300005340 Bacteria 2140
25 Ga0070691_10004443 3300005341 Bacteria 6372
26 Ga0070668_100000653 3300005347 Bacteria 23464
27 Ga0070668_100057522 3300005347 Bacteria 3005
28 Ga0070669_100000782 3300005353 Bacteria 23077
29 Ga0070669_100137190 3300005353 Bacteria 1882
30 Ga0070669_100191566 3300005353 Bacteria 1604
31 Ga0070674_100002534 3300005356 Bacteria 10117
32 Ga0070674_100132897 3300005356 Bacteria 1858
33 Ga0070667_100001332 3300005367 Bacteria 22171
34 Ga0070667_100099485 3300005367 Bacteria 2510
35 Ga0070709_10006400 3300005434 Bacteria 6415
36 Ga0070709_10021944 3300005434 Bacteria 3727
37 Ga0070709_10046416 3300005434 Bacteria 2701
38 Ga0070709_10048203 3300005434 Bacteria 2658
39 Ga0070714_100001366 3300005435 Bacteria 17675
40 Ga0070714_100049857 3300005435 Bacteria 3564
41 Ga0070714_100269394 3300005435 Bacteria 1579
42 Ga0070714_100324865 3300005435 Bacteria 1440
43 Ga0070713_100024404 3300005436 Bacteria 4708
44 Ga0070713_100026728 3300005436 Bacteria 4536
45 Ga0070713_100206552 3300005436 Bacteria 1776
46 Ga0070710_10001529 3300005437 Bacteria 10928
47 Ga0070710_10082216 3300005437 Bacteria 1882
48 Ga0070701_10002831 3300005438 Bacteria 6759
49 Ga0070701_10050290 3300005438 Bacteria 2157
50 Ga0070711_100000576 3300005439 Bacteria 19172
51 Ga0070711_100046340 3300005439 Bacteria 2962
52 Ga0070700_100001477 3300005441 Bacteria 11701
53 Ga0070694_100005845 3300005444 Bacteria 7465
54 Ga0070708_100075668 3300005445 Bacteria 3039
55 Ga0070708_100235326 3300005445 Bacteria 1719
56 Ga0070663_100024173 3300005455 Bacteria 4085
57 Ga0070678_100000354 3300005456 Bacteria 21295
58 Ga0070681_10008307 3300005458 Bacteria 10166
59 Ga0068867_100008429 3300005459 Bacteria 7271
60 Ga0070685_10022554 3300005466 Bacteria 3434
61 Ga0070706_100036582 3300005467 Bacteria 4534
62 Ga0070707_100028262 3300005468 Bacteria 5336
63 Ga0070698_100002154 3300005471 Bacteria 21853
64 Ga0070698_100017694 3300005471 Bacteria 7507
65 Ga0070698_100059157 3300005471 Bacteria 3871
66 Ga0070699_100004481 3300005518 Bacteria 12354
67 Ga0070679_100119767 3300005530 Bacteria 2617
68 Ga0070684_100209826 3300005535 Bacteria 1775
69 Ga0068853_100002909 3300005539 Bacteria 13012
70 Ga0068853_100099385 3300005539 Bacteria 2570
71 Ga0070672_100051562 3300005543 Bacteria 3210
72 Ga0070686_100100838 3300005544 Bacteria 1950
73 Ga0070695_100018145 3300005545 Bacteria 4272
74 Ga0070696_100109895 3300005546 Bacteria 1984
75 Ga0070693_100051609 3300005547 Bacteria 2356
76 Ga0070693_100108425 3300005547 Bacteria 1704
77 Ga0070665_100008709 3300005548 Bacteria 10266
78 Ga0070665_100024333 3300005548 Bacteria 6098
79 Ga0070665_100157422 3300005548 Bacteria 2273
80 Ga0070665_100189419 3300005548 Bacteria 2058
81 Ga0070665_100198348 3300005548 Bacteria 2008
82 Ga0070665_100326482 3300005548 Bacteria 1539
83 Ga0070704_100004662 3300005549 Bacteria 7931
84 Ga0070704_100030727 3300005549 Bacteria 3602
85 Ga0068855_100038585 3300005563 Bacteria 5674
86 Ga0068855_100252740 3300005563 Bacteria 1965
87 Ga0068857_100240387 3300005577 Bacteria 1658
88 Ga0068854_100000627 3300005578 Bacteria 20901
89 Ga0070702_100002118 3300005615 Bacteria 8423
90 Ga0068852_100054718 3300005616 Bacteria 3441
91 Ga0068852_100085107 3300005616 Bacteria 2816
92 Ga0068859_100002678 3300005617 Bacteria 18089
93 Ga0068859_100023429 3300005617 Bacteria 6195
94 Ga0068866_10000361 3300005718 Bacteria 21425
95 Ga0068861_100014034 3300005719 Bacteria 5618
96 Ga0068863_100000205 3300005841 Bacteria 63387
97 Ga0068863_100005283 3300005841 Bacteria 12749
98 Ga0068863_100060594 3300005841 Bacteria 3579
99 Ga0068863_100196516 3300005841 Bacteria 1939
100 Ga0068858_100000168 3300005842 Bacteria 69381
101 Ga0068858_100001350 3300005842 Bacteria 25306
102 Ga0068860_100000472 3300005843 Bacteria 50060
103 Ga0068860_100001653 3300005843 Bacteria 23853
104 Ga0068862_100000030 3300005844 Bacteria 182487
105 Ga0068862_100010156 3300005844 Bacteria 7767
106 Ga0068862_100042063 3300005844 Bacteria 3891
107 Ga0068862_100239001 3300005844 Bacteria 1651
108 Ga0081455_10062004 3300005937 Bacteria 3144
109 Ga0081538_10059503 3300005981 Bacteria 2206
110 Ga0081540_1057411 3300005983 Bacteria 1882
111 Ga0070717_10226522 3300006028 Bacteria 1645
112 Ga0070717_10262905 3300006028 Bacteria 1527
113 Ga0075365_10001952 3300006038 Bacteria 9733
114 Ga0075368_10001718 3300006042 Bacteria 7049
115 Ga0075363_100000097 3300006048 Bacteria 19438
116 Ga0075363_100002128 3300006048 Bacteria 7958
117 Ga0075363_100003750 3300006048 Bacteria 6541
118 Ga0075363_100009049 3300006048 Bacteria 4671
119 Ga0075363_100031121 3300006048 Bacteria 2765
120 Ga0075364_10005609 3300006051 Bacteria 7317
121 Ga0075364_10008833 3300006051 Bacteria 6031
122 Ga0075364_10009237 3300006051 Bacteria 5909
123 Ga0075364_10018692 3300006051 Bacteria 4343
124 Ga0075364_10028145 3300006051 Bacteria 3596
125 Ga0075364_10028863 3300006051 Bacteria 3554
126 Ga0075364_10051494 3300006051 Bacteria 2690
127 Ga0075364_10056541 3300006051 Bacteria 2569
128 Ga0075364_10061308 3300006051 Bacteria 2467
129 Ga0070715_10006097 3300006163 Bacteria 4074
130 Ga0070716_100002294 3300006173 Bacteria 8803
131 Ga0070716_100008929 3300006173 Bacteria 4985
132 Ga0070716_100016762 3300006173 Bacteria 3787
133 Ga0070712_100003061 3300006175 Bacteria 10344
134 Ga0070712_100008920 3300006175 Bacteria 6315
135 Ga0070712_100041980 3300006175 Bacteria 3143
136 Ga0070712_100063012 3300006175 Bacteria 2623
137 Ga0070712_100127692 3300006175 Bacteria 1923
138 Ga0075362_10041452 3300006177 Bacteria 2031
139 Ga0075367_10030433 3300006178 Bacteria 3096
140 Ga0075369_10004831 3300006186 Bacteria 5013
141 Ga0075369_10010068 3300006186 Bacteria 3692
142 Ga0075369_10011795 3300006186 Bacteria 3442
143 Ga0075369_10026485 3300006186 Bacteria 2417
144 Ga0075369_10034287 3300006186 Bacteria 2154
145 Ga0075369_10035818 3300006186 Bacteria 2111
146 Ga0075369_10046558 3300006186 Bacteria 1868
147 Ga0097621_100046747 3300006237 Bacteria 3504
148 Ga0097621_100118399 3300006237 Bacteria 2245
149 Ga0075370_10002845 3300006353 Bacteria 8123
150 Ga0075370_10007007 3300006353 Bacteria 5716
151 Ga0075370_10027989 3300006353 Bacteria 3130
152 Ga0075370_10039654 3300006353 Bacteria 2654
153 Ga0075370_10091975 3300006353 Bacteria 1750
154 Ga0075428_100204394 3300006844 Bacteria 2135
155 Ga0068865_100000387 3300006881 Bacteria 24426
156 Ga0097620_100002678 3300006931 Bacteria 18089
157 Ga0097620_100023429 3300006931 Bacteria 6195
158 Ga0111539_10209605 3300009094 Bacteria 2271
159 Ga0111539_10296047 3300009094 Bacteria 1883
160 Ga0105245_10001038 3300009098 Bacteria 25213
161 Ga0105245_10046305 3300009098 Bacteria 3887
162 Ga0105247_10000008 3300009101 Bacteria 391450
163 Ga0105247_10001693 3300009101 Bacteria 15561
164 Ga0105247_10004448 3300009101 Bacteria 8934
165 Ga0114129_10013780 3300009147 Bacteria 11521
166 Ga0105243_10000843 3300009148 Bacteria 29147
167 Ga0105243_10163954 3300009148 Bacteria 1919
168 Ga0105241_10022905 3300009174 Bacteria 4631
169 Ga0105242_10007482 3300009176 Bacteria 8405
170 Ga0105242_10136418 3300009176 Bacteria 2124
171 Ga0105248_10000257 3300009177 Bacteria 62094
172 Ga0105248_10004442 3300009177 Bacteria 15534
173 Ga0105248_10142575 3300009177 Bacteria 2703
174 Ga0105237_10056403 3300009545 Bacteria 3932
175 Ga0105237_10220790 3300009545 Bacteria 1895
176 Ga0105238_10168007 3300009551 Bacteria 2169
177 Ga0105238_10248398 3300009551 Bacteria 1757
178 Ga0105249_10000036 3300009553 Bacteria 198578
179 Ga0105249_10000784 3300009553 Bacteria 28520
180 Ga0105249_10009674 3300009553 Bacteria 8446
181 Ga0105249_10229457 3300009553 Bacteria 1831
182 Ga0105239_10028827 3300010375 Bacteria 6103
183 Ga0105239_10102901 3300010375 Bacteria 3161
184 Ga0105246_10105196 3300011119 Bacteria 2062
185 Ga0105246_10210107 3300011119 Bacteria 1519
186 Ga0157369_10058289 3300013105 Bacteria 4165
187 Ga0157374_10146594 3300013296 Bacteria 2293
188 Ga0157378_10003550 3300013297 Bacteria 13818
189 Ga0157378_10036189 3300013297 Bacteria 4369
190 Ga0163162_10007488 3300013306 Bacteria 10623
191 Ga0163162_10036768 3300013306 Bacteria 4883
192 Ga0163162_10080667 3300013306 Bacteria 3322
193 Ga0163162_10129749 3300013306 Bacteria 2629
194 Ga0163162_10298367 3300013306 Bacteria 1743
195 Ga0157372_10009543 3300013307 Bacteria 10315
196 Ga0157372_10038914 3300013307 Bacteria 5249
197 Ga0157372_10292929 3300013307 Bacteria 1893
198 Ga0157375_10004444 3300013308 Bacteria 12182
199 Ga0157380_10003150 3300014326 Bacteria 11264
200 Ga0157379_10007963 3300014968 Bacteria 9195
201 Ga0157379_10015502 3300014968 Bacteria 6690
202 Ga0157379_10102499 3300014968 Bacteria 2569
203 Ga0157376_10117326 3300014969 Bacteria 2353
204 Ga0163161_10001144 3300017792 Bacteria 19959
205 Ga0163161_10090569 3300017792 Bacteria 2263
206 Ga0206351_10537428 3300020077 Bacteria 1780
207 Ga0206353_11506564 3300020082 Bacteria 3150
208 Ga0213876_10000895 3300021384 Bacteria 19907
209 Ga0213876_10009314 3300021384 Bacteria 5289
210 Ga0213876_10080788 3300021384 Bacteria 1719
211 Ga0213875_10001935 3300021388 Bacteria 12807
212 Ga0213875_10039122 3300021388 Bacteria 2234
213 Ga0224712_10016804 3300022467 Bacteria 2412
214 Ga0224712_10063952 3300022467 Bacteria 1474
215 Ga0209646_1000134 3300025246 Bacteria 124492
216 Ga0209673_1016674 3300025273 Bacteria 2735
217 Ga0209051_1000158 3300025303 Bacteria 127723
218 Ga0209051_1001340 3300025303 Bacteria 21401
219 Ga0207692_10001432 3300025898 Bacteria 8929
220 Ga0207642_10000456 3300025899 Bacteria 12464
221 Ga0207710_10000006 3300025900 Bacteria 538831
222 Ga0207710_10000162 3300025900 Bacteria 70808
223 Ga0207688_10001605 3300025901 Bacteria 11946
224 Ga0207688_10048375 3300025901 Bacteria 2376
225 Ga0207680_10094702 3300025903 Bacteria 1907
226 Ga0207647_10050412 3300025904 Bacteria 2577
227 Ga0207685_10009981 3300025905 Bacteria 2782
228 Ga0207685_10039710 3300025905 Bacteria 1749
229 Ga0207699_10002855 3300025906 Bacteria 8178
230 Ga0207699_10120604 3300025906 Bacteria 1695
231 Ga0207705_10022390 3300025909 Bacteria 4506
232 Ga0207654_10145446 3300025911 Bacteria 1516
233 Ga0207693_10000616 3300025915 Bacteria 31851
234 Ga0207693_10005615 3300025915 Bacteria 10430
235 Ga0207693_10058724 3300025915 Bacteria 3013
236 Ga0207693_10090264 3300025915 Bacteria 2402
237 Ga0207693_10267280 3300025915 Bacteria 1340
238 Ga0207663_10022988 3300025916 Bacteria 3572
239 Ga0207663_10043074 3300025916 Bacteria 2761
240 Ga0207663_10098629 3300025916 Bacteria 1957
241 Ga0207660_10071363 3300025917 Bacteria 2527
242 Ga0207660_10165967 3300025917 Bacteria 1706
243 Ga0207657_10233690 3300025919 Bacteria 1470
244 Ga0207681_10039408 3300025923 Bacteria 3137
245 Ga0207650_10055953 3300025925 Bacteria 2930
246 Ga0207687_10004616 3300025927 Bacteria 9165
247 Ga0207700_10035470 3300025928 Bacteria 3593
248 Ga0207664_10217391 3300025929 Bacteria 1656
249 Ga0207664_10243242 3300025929 Bacteria 1568
250 Ga0207644_10073608 3300025931 Bacteria 2505
251 Ga0207690_10088732 3300025932 Bacteria 2179
252 Ga0207706_10002810 3300025933 Bacteria 16897
253 Ga0207686_10007012 3300025934 Bacteria 6062
254 Ga0207686_10063618 3300025934 Bacteria 2347
255 Ga0207709_10064371 3300025935 Bacteria 2302
256 Ga0207709_10081966 3300025935 Bacteria 2082
257 Ga0207669_10000994 3300025937 Bacteria 12070
258 Ga0207669_10109324 3300025937 Bacteria 1848
259 Ga0207704_10001171 3300025938 Bacteria 11694
260 Ga0207665_10001800 3300025939 Bacteria 14438
261 Ga0207665_10008271 3300025939 Bacteria 6869
262 Ga0207691_10061590 3300025940 Bacteria 3408
263 Ga0207711_10000269 3300025941 Bacteria 56180
264 Ga0207711_10031304 3300025941 Bacteria 4491
265 Ga0207711_10046314 3300025941 Bacteria 3716
266 Ga0207689_10015810 3300025942 Bacteria 6390
267 Ga0207689_10019613 3300025942 Bacteria 5699
268 Ga0207661_10016004 3300025944 Bacteria 5529
269 Ga0207661_10101516 3300025944 Bacteria 2417
270 Ga0207712_10000036 3300025961 Bacteria 198586
271 Ga0207712_10012569 3300025961 Bacteria 5410
272 Ga0207712_10016214 3300025961 Bacteria 4819
273 Ga0207668_10000958 3300025972 Bacteria 17393
274 Ga0207668_10091903 3300025972 Bacteria 2232
275 Ga0207640_10014005 3300025981 Bacteria 4607
276 Ga0207658_10000060 3300025986 Bacteria 119956
277 Ga0207658_10004558 3300025986 Bacteria 9612
278 Ga0207677_10003591 3300026023 Bacteria 8218
279 Ga0207703_10000202 3300026035 Bacteria 69516
280 Ga0207703_10024689 3300026035 Bacteria 4729
281 Ga0207639_10032926 3300026041 Bacteria 3820
282 Ga0207639_10062822 3300026041 Bacteria 2873
283 Ga0207678_10019583 3300026067 Bacteria 5948
284 Ga0207678_10021554 3300026067 Bacteria 5651
285 Ga0207678_10074928 3300026067 Bacteria 2899
286 Ga0207708_10001249 3300026075 Bacteria 19169
287 Ga0207702_10174248 3300026078 Bacteria 1975
288 Ga0207641_10000302 3300026088 Bacteria 61385
289 Ga0207641_10000909 3300026088 Bacteria 30650
290 Ga0207641_10158590 3300026088 Bacteria 2055
291 Ga0207648_10002184 3300026089 Bacteria 21231
292 Ga0207648_10054924 3300026089 Bacteria 3477
293 Ga0207674_10016832 3300026116 Bacteria 7989
294 Ga0207674_10039502 3300026116 Bacteria 4891
295 Ga0207675_100001298 3300026118 Bacteria 25048
296 Ga0207675_100007416 3300026118 Bacteria 10364
297 Ga0207675_100180735 3300026118 Bacteria 2020
298 Ga0207683_10000649 3300026121 Bacteria 31834
299 Ga0207683_10020887 3300026121 Bacteria 5603
300 Ga0207698_10084806 3300026142 Bacteria 2570
301 Ga0207698_10119916 3300026142 Bacteria 2224
302 Ga0268266_10009911 3300028379 Bacteria 8370
303 Ga0268266_10013586 3300028379 Bacteria 7013
304 Ga0268266_10063831 3300028379 Bacteria 3180
305 Ga0268266_10238625 3300028379 Bacteria 1677
306 Ga0268265_10000038 3300028380 Bacteria 198640
307 Ga0268265_10106042 3300028380 Bacteria 2282
308 Ga0268264_10000056 3300028381 Bacteria 310339
309 Ga0268264_10001858 3300028381 Bacteria 19205
310 Ga0265337_1003050 3300028556 Bacteria 7395
311 Ga0265319_1005297 3300028563 Bacteria 6207
312 Ga0265334_10001860 3300028573 Bacteria 10049
313 Ga0265338_10001121 3300028800 Bacteria 44524
314 Ga0265338_10005595 3300028800 Bacteria 16340
315 Ga0265324_10003191 3300029957 Bacteria 7935
316 Ga0307511_10067675 3300030521 Bacteria 2647
317 Ga0307512_10058625 3300030522 Bacteria 2997
318 Ga0316181_1057629 3300030744 Bacteria 2337
319 Ga0265332_10044040 3300031238 Bacteria 1925
320 Ga0265320_10027167 3300031240 Bacteria 2987
321 Ga0265340_10008890 3300031247 Bacteria 5414
322 Ga0265327_10000001 3300031251 Bacteria 894475
323 Ga0265327_10000125 3300031251 Bacteria 167832
324 Ga0265327_10001089 3300031251 Bacteria 37752
325 Ga0307408_100150425 3300031548 Bacteria 1837
326 Ga0307408_100159348 3300031548 Bacteria 1791
327 Ga0307508_10057904 3300031616 Bacteria 3429
328 Ga0265314_10007411 3300031711 Bacteria 9514
329 Ga0307516_10000105 3300031730 Bacteria 96224
330 Ga0307516_10043992 3300031730 Bacteria 4421
331 Ga0307516_10050127 3300031730 Bacteria 4097
332 Ga0307405_10001336 3300031731 Bacteria 10336
333 Ga0307405_10106903 3300031731 Bacteria 1888
334 Ga0307405_10118518 3300031731 Bacteria 1807
335 Ga0307405_10173554 3300031731 Bacteria 1540
336 Ga0307413_10037680 3300031824 Bacteria 2795
337 Ga0307410_10023048 3300031852 Bacteria 3862
338 Ga0307410_10037551 3300031852 Bacteria 3165
339 Ga0307410_10074132 3300031852 Bacteria 2369
340 Ga0307410_10143174 3300031852 Bacteria 1771
341 Ga0307406_10002614 3300031901 Bacteria 9810
342 Ga0307406_10009182 3300031901 Bacteria 5539
343 Ga0307406_10010564 3300031901 Bacteria 5211
344 Ga0307406_10013181 3300031901 Bacteria 4731
345 Ga0307406_10051575 3300031901 Bacteria 2613
346 Ga0307406_10092236 3300031901 Bacteria 2042
347 Ga0307407_10118270 3300031903 Bacteria 1675
348 Ga0307412_10053015 3300031911 Bacteria 2688
349 Ga0307409_100000054 3300031995 Bacteria 40959
350 Ga0307409_100010983 3300031995 Bacteria 5674
351 Ga0307416_100006421 3300032002 Bacteria 7361
352 Ga0307416_100008186 3300032002 Bacteria 6722
353 Ga0307416_100246754 3300032002 Bacteria 1735
354 Ga0307414_10005690 3300032004 Bacteria 6881
355 Ga0307414_10050736 3300032004 Bacteria 2876
356 Ga0307414_10060171 3300032004 Bacteria 2685
357 Ga0307415_100003755 3300032126 Bacteria 7781
358 Ga0316593_10003464 3300032168 Bacteria 3919
359 Ga0373934_0049186 3300035086 Bacteria 1669
360 Ga0373945_0048405 3300035116 Bacteria 1557
361 Ga0373953_0014900 3300035117 Bacteria 2806
362 Ga0373954_0040389 3300035118 Bacteria 2173
363 Ga0373956_0016072 3300035119 Bacteria 3139
364 Ga0373955_0046907 3300035172 Bacteria 2337
365 Ga0373961_0030592 3300035241 Bacteria 1499
366 Ga0373935_0055689 3300035692 Bacteria 2520
367 Ga0373927_0168886 3300035695 Bacteria 1434
368 Ga0373947_0047249 3300035725 Bacteria 2579
369 Ga0372808_003264 3300036459 Bacteria 1970
370 Ga0316582_0091703 3300036647 Bacteria 2001
371 Ga0316584_0050791 3300036712 Bacteria 3100
372 Ga0316584_0247090 3300036712 Bacteria 1304
373 Ga0373925_0030571 3300037068 Bacteria 3953
374 Ga0395898_0232009 3300037466 Bacteria 1760
375 Ga0395905_0208285 3300037471 Bacteria 1832
376 Ga0436364_0686614 3300037853 Bacteria 2785
377 Ga0436364_0791704 3300037853 Bacteria 17033
378 Ga0436364_1306017 3300037853 Bacteria 48457
379 Ga0436364_1419871 3300037853 Bacteria 2121
380 Ga0436364_1492125 3300037853 Bacteria 3702
381 Ga0395901_0073029 3300038443 Bacteria 3577
382 Ga0436365_0943842 3300039437 Bacteria 40181
383 Ga0436365_1177772 3300039437 Bacteria 64815
384 Ga0436365_1925863 3300039437 Bacteria 3188
385 Ga0436363_0515244 3300039450 Bacteria 3344
386 Ga0439436_0000595 3300041404 Bacteria 9593
387 Ga0439461_0001310 3300041410 Bacteria 3828
388 Ga0439466_0003018 3300041411 Bacteria 6563
389 Ga0439466_0028451 3300041411 Bacteria 1930
390 Ga0439465_0023924 3300041413 Bacteria 1923
391 Ga0451791_0196447 3300041451 Bacteria 2662
392 Ga0451802_0491012 3300041460 Bacteria 2362
393 Ga0451807_2180301 3300041486 Bacteria 1874
394 Ga0451833_0747008 3300041491 Bacteria 11790
395 Ga0451837_0975337 3300041494 Bacteria 2290
396 Ga0451841_0559703 3300041498 Bacteria 2404
397 Ga0451853_3245237 3300041512 Bacteria 11076
398 Ga0439431_0019254 3300041997 Bacteria 1621
399 Ga0439445_0007998 3300042004 Bacteria 2467
400 Ga0439457_002432 3300042014 Bacteria 5324
401 Ga0450894_000320 3300042131 Bacteria 8573
402 Ga0450896_003367 3300042133 Bacteria 2119
403 Ga0450898_006765 3300042134 Bacteria 1770
404 Ga0450899_001526 3300042135 Bacteria 2575
405 Ga0450903_010793 3300042138 Bacteria 1476
406 Ga0450906_001346 3300042145 Bacteria 5394
407 Ga0439434_0013862 3300042435 Bacteria 2396
408 Ga0439434_0019746 3300042435 Bacteria 2021
409 Ga0466969_0037648 3300044656 Bacteria 2439
410 Ga0466969_0041226 3300044656 Bacteria 2311
411 Ga0466969_0050859 3300044656 Bacteria 2042
412 Ga0466972_0011927 3300044658 Bacteria 4367
413 Ga0466972_0013593 3300044658 Bacteria 4085
414 Ga0466972_0016326 3300044658 Bacteria 3711
415 Ga0466965_0004778 3300044683 Bacteria 6040
416 Ga0466965_0015623 3300044683 Bacteria 3607
417 Ga0466966_0003202 3300044684 Bacteria 10782
418 Ga0466966_0008774 3300044684 Bacteria 6693
419 Ga0466966_0049490 3300044684 Bacteria 2677
420 Ga0466966_0068639 3300044684 Bacteria 2225
421 Ga0466961_0011812 3300044693 Bacteria 5582
422 Ga0466961_0024117 3300044693 Bacteria 3914
423 Ga0466963_0029095 3300044694 Bacteria 3553
424 Ga0466963_0063684 3300044694 Bacteria 2468
425 Ga0466963_0063994 3300044694 Bacteria 2463
426 Ga0466963_0084632 3300044694 Bacteria 2152
427 Ga0466963_0099793 3300044694 Bacteria 1986
428 Ga0466968_0015123 3300044735 Bacteria 3057
429 Ga0466968_0018384 3300044735 Bacteria 2803
430 Ga0466968_0019675 3300044735 Bacteria 2719
431 Ga0466970_0002553 3300044765 Bacteria 8783
432 Ga0466970_0011890 3300044765 Bacteria 4440
433 Ga0466970_0024364 3300044765 Bacteria 3163
434 Ga0466957_0000745 3300044842 Bacteria 16607
435 Ga0466957_0055160 3300044842 Bacteria 2428
436 Ga0466957_0079178 3300044842 Bacteria 2044
437 Ga0466960_0001619 3300044901 Bacteria 8233
438 Ga0466960_0020262 3300044901 Bacteria 2943
439 Ga0466960_0040455 3300044901 Bacteria 2204
440 Ga0466960_0062669 3300044901 Bacteria 1828
441 Ga0466959_0004991 3300045049 Bacteria 9002
442 Ga0466959_0056275 3300045049 Bacteria 2870
443 Ga0466967_0001105 3300045976 Bacteria 14956
444 Ga0466967_0004929 3300045976 Bacteria 9126
445 Ga0466967_0005712 3300045976 Bacteria 8676
446 Ga0466967_0032807 3300045976 Bacteria 4390
447 Ga0466967_0129493 3300045976 Bacteria 2341
448 Ga0466967_0174045 3300045976 Bacteria 2027
449 Ga0495627_004044 3300046453 Bacteria 6253
450 Ga0495629_0021248 3300046459 Bacteria 4632
451 Ga0495629_0027357 3300046459 Bacteria 4048
452 Ga0495638_0012385 3300046460 Bacteria 5847
453 Ga0495641_0016048 3300046461 Bacteria 3961
454 Ga0495651_0006931 3300046462 Bacteria 8663
455 Ga0495653_0098152 3300046463 Bacteria 2127
456 Ga0495582_0034214 3300046473 Bacteria 2794
457 Ga0495582_0040146 3300046473 Bacteria 2577
458 Ga0495605_0012335 3300046474 Bacteria 4743
459 Ga0495662_0014240 3300046476 Bacteria 3870
460 Ga0495585_0028652 3300046492 Bacteria 3175
461 Ga0495594_0013655 3300046499 Bacteria 4243
462 Ga0495606_0008256 3300046507 Bacteria 9087
463 Ga0495608_0044293 3300046511 Bacteria 2970
464 Ga0495610_0031439 3300046512 Bacteria 2769
465 Ga0495616_0015857 3300046513 Bacteria 4179
466 Ga0495618_0031628 3300046514 Bacteria 3311
467 Ga0495628_0199831 3300046516 Bacteria 1506
468 Ga0495630_0097557 3300046517 Bacteria 2223
469 Ga0495631_0008081 3300046518 Bacteria 5316
470 Ga0495643_0001873 3300046522 Bacteria 17832
471 Ga0495648_0007320 3300046524 Bacteria 8847
472 Ga0495666_0123913 3300046526 Bacteria 1209
473 Ga0495642_0041722 3300046528 Bacteria 1867
474 Ga0495652_0018443 3300046529 Bacteria 6220
475 Ga0495652_0067710 3300046529 Bacteria 2993
476 Ga0495654_0019829 3300046530 Bacteria 3512
477 Ga0495665_0050267 3300046531 Bacteria 2210
478 Ga0495640_0008096 3300046533 Bacteria 8255
479 Ga0495640_0020960 3300046533 Bacteria 4805
480 Ga0495640_0043946 3300046533 Bacteria 3108
481 Ga0495640_0053878 3300046533 Bacteria 2757
482 Ga0495587_0002793 3300046536 Bacteria 11666
483 Ga0495587_0037326 3300046536 Bacteria 2918
484 Ga0495609_0014822 3300046538 Bacteria 3657
485 Ga0495597_0010176 3300046542 Bacteria 4608
486 Ga0495645_0128261 3300046543 Bacteria 1780
487 Ga0495633_0017222 3300046558 Bacteria 3702
488 Ga0495667_0003348 3300046559 Bacteria 10735
489 Ga0495668_0000237 3300046616 Bacteria 78532
490 Ga0495668_0069606 3300046616 Bacteria 1935
491 Ga0495611_0040581 3300046648 Bacteria 2075
492 Ga0495625_0033482 3300046660 Bacteria 3800
493 Ga0495625_0063279 3300046660 Bacteria 2613
494 Ga0495635_0041157 3300046663 Bacteria 3192
495 Ga0495661_0009739 3300046665 Bacteria 6580
496 Ga0495599_0009664 3300046678 Bacteria 5904
497 Ga0495623_0078186 3300046679 Bacteria 2051
498 Ga0495646_0090662 3300046680 Bacteria 1766
499 Ga0495647_0011762 3300046681 Bacteria 3003
500 Ga0495647_0028234 3300046681 Bacteria 2068
501 Ga0495658_0050287 3300046683 Bacteria 2357
502 Ga0495613_0103334 3300046689 Bacteria 2057
503 Ga0495671_0110012 3300046692 Bacteria 1346
504 Ga0495660_0024014 3300046810 Bacteria 3474
505 Ga0495581_0049463 3300047315 Bacteria 2427
506 Ga0495581_0179566 3300047315 Bacteria 1238
507 Ga0495604_0029445 3300047317 Bacteria 4368
508 Ga0495636_0010212 3300047318 Bacteria 3704
509 Ga0495636_0013734 3300047318 Bacteria 3214
510 Ga0495674_0006976 3300047319 Bacteria 10810
511 Ga0495674_0026024 3300047319 Bacteria 5354
512 Ga0495672_0050913 3300047320 Bacteria 2442
513 Ga0495672_0093655 3300047320 Bacteria 1644
514 Ga0495676_0052369 3300047321 Bacteria 3259
515 Ga0495676_0113445 3300047321 Bacteria 1984
516 Ga0495680_0044837 3300047322 Bacteria 3494
517 Ga0495683_0000511 3300047323 Bacteria 29848
518 Ga0495687_007829 3300047443 Bacteria 6221
519 Ga0495675_0010322 3300047444 Bacteria 5838
520 Ga0495685_004987 3300047447 Bacteria 4318
521 Ga0495673_0000771 3300047469 Bacteria 30279
522 Ga0495681_0058817 3300047470 Bacteria 1779
523 Ga0495684_0029484 3300047471 Bacteria 4211
524 Ga0495684_0070583 3300047471 Bacteria 2655
525 Ga0495686_0003681 3300047472 Bacteria 13101
526 Ga0495686_0096465 3300047472 Bacteria 1789
527 Ga0496100_0000026 3300048903 Bacteria 115873
528 Ga0496100_0000527 3300048903 Bacteria 18269
529 Ga0496100_0000979 3300048903 Bacteria 13731
530 Ga0496100_0013880 3300048903 Bacteria 4661
531 Ga0496100_0027029 3300048903 Bacteria 3524
532 Ga0496100_0032752 3300048903 Bacteria 3245
533 Ga0496101_0000002 3300048904 Bacteria 410971
534 Ga0496101_0000015 3300048904 Bacteria 252368
535 Ga0496101_0001115 3300048904 Bacteria 15987
536 Ga0496101_0001550 3300048904 Bacteria 13779
537 Ga0496101_0010167 3300048904 Bacteria 6209
538 Ga0496101_0118921 3300048904 Bacteria 1996
539 Ga0496102_0000009 3300048905 Bacteria 344149
540 Ga0496102_0000973 3300048905 Bacteria 26960
541 Ga0496102_0001400 3300048905 Bacteria 21426
542 Ga0496102_0014428 3300048905 Bacteria 6864
543 Ga0496102_0028228 3300048905 Bacteria 5011
544 Ga0496102_0041798 3300048905 Bacteria 4153
545 Ga0496102_0076107 3300048905 Bacteria 3086
546 Ga0496102_0185720 3300048905 Bacteria 1959
547 Ga0496103_0000051 3300048906 Bacteria 150397
548 Ga0496103_0000902 3300048906 Bacteria 21303
549 Ga0496103_0004003 3300048906 Bacteria 8949
550 Ga0496103_0004241 3300048906 Bacteria 8710
551 Ga0496103_0006654 3300048906 Bacteria 6897
552 Ga0496103_0018590 3300048906 Bacteria 4169
553 Ga0496104_0003436 3300048907 Bacteria 13659
554 Ga0496104_0037473 3300048907 Bacteria 4535
555 Ga0496104_0084968 3300048907 Bacteria 3020
556 Ga0496104_0102037 3300048907 Bacteria 2747
557 Ga0496105_0003833 3300048908 Bacteria 11219
558 Ga0496105_0064350 3300048908 Bacteria 3026
559 Ga0496105_0104624 3300048908 Bacteria 2337
560 Ga0496105_0125720 3300048908 Bacteria 2113
561 Ga0496105_0145100 3300048908 Bacteria 1952
562 Ga0496106_0001036 3300048909 Bacteria 20452
563 Ga0496106_0002064 3300048909 Bacteria 15077
564 Ga0496106_0003615 3300048909 Bacteria 11531
565 Ga0496106_0010701 3300048909 Bacteria 6780
566 Ga0496106_0083021 3300048909 Bacteria 2464
567 Ga0496107_0000365 3300048910 Bacteria 24557
568 Ga0496107_0000827 3300048910 Bacteria 18053
569 Ga0496107_0006589 3300048910 Bacteria 7991
570 Ga0496107_0013068 3300048910 Bacteria 5800
571 Ga0496107_0030409 3300048910 Bacteria 3849
572 Ga0496108_0004412 3300048911 Bacteria 11322
573 Ga0496108_0006168 3300048911 Bacteria 9696
574 Ga0496108_0022918 3300048911 Bacteria 5138
575 Ga0496108_0067772 3300048911 Bacteria 3010
576 Ga0496108_0078208 3300048911 Bacteria 2799
577 Ga0496108_0103949 3300048911 Bacteria 2424
578 Ga0496109_0000022 3300048912 Bacteria 188901
579 Ga0496109_0000747 3300048912 Bacteria 27044
580 Ga0496109_0041880 3300048912 Bacteria 4148
581 Ga0496109_0089005 3300048912 Bacteria 2854
582 Ga0496109_0089525 3300048912 Bacteria 2845
583 Ga0496109_0110141 3300048912 Bacteria 2560
584 Ga0496109_0433287 3300048912 Bacteria 1242
585 Ga0496110_0003405 3300048913 Bacteria 12163
586 Ga0496110_0033310 3300048913 Bacteria 4456
587 Ga0496110_0035944 3300048913 Bacteria 4301
588 Ga0496110_0140565 3300048913 Bacteria 2183
589 Ga0496110_0232579 3300048913 Bacteria 1676
590 Ga0496111_0008202 3300048914 Bacteria 6904
591 Ga0496111_0062422 3300048914 Bacteria 2702
592 Ga0496111_0095443 3300048914 Bacteria 2182
593 Ga0496112_0001525 3300048915 Bacteria 17850
594 Ga0496112_0007625 3300048915 Bacteria 9621
595 Ga0496112_0009325 3300048915 Bacteria 8832
596 Ga0496112_0022270 3300048915 Bacteria 6037
597 Ga0496112_0094446 3300048915 Bacteria 2961
598 Ga0496112_0094864 3300048915 Bacteria 2954
599 Ga0496112_0155665 3300048915 Bacteria 2252
600 Ga0496113_0138959 3300048916 Bacteria 1910
601 Ga0496113_0155588 3300048916 Bacteria 1805
602 Ga0496114_0000107 3300048917 Bacteria 59739
603 Ga0496114_0000681 3300048917 Bacteria 25219
604 Ga0496114_0001173 3300048917 Bacteria 19832
605 Ga0496114_0131985 3300048917 Bacteria 2157
606 Ga0496114_0204121 3300048917 Bacteria 1732
607 Ga0496114_0317936 3300048917 Bacteria 1375
608 Ga0496115_0001418 3300048918 Bacteria 17150
609 Ga0496115_0003492 3300048918 Bacteria 11299
610 Ga0496115_0008073 3300048918 Bacteria 7775
611 Ga0496115_0050368 3300048918 Bacteria 3336
612 Ga0496115_0074854 3300048918 Bacteria 2750
613 Ga0496115_0186721 3300048918 Bacteria 1713
614 Ga0496116_0000141 3300048919 Bacteria 150405
615 Ga0496116_0004448 3300048919 Bacteria 13369
616 Ga0496116_0016923 3300048919 Bacteria 5684
617 Ga0496117_0000019 3300048920 Bacteria 469256
618 Ga0496117_0000028 3300048920 Bacteria 407392
619 Ga0496117_0002095 3300048920 Bacteria 26250
620 Ga0496117_0131680 3300048920 Bacteria 1514
621 Ga0496118_0000020 3300048921 Bacteria 470521
622 Ga0496118_0000255 3300048921 Bacteria 94123
623 Ga0496118_0002066 3300048921 Bacteria 28281
624 Ga0496119_0002236 3300048922 Bacteria 21555
625 Ga0496119_0002728 3300048922 Bacteria 19029
626 Ga0496119_0004258 3300048922 Bacteria 14344
627 Ga0496119_0016127 3300048922 Bacteria 5706
628 Ga0496119_0032073 3300048922 Bacteria 3508
629 Ga0496120_0001194 3300048923 Bacteria 32954
630 Ga0496120_0021885 3300048923 Bacteria 4030
631 Ga0496120_0083558 3300048923 Bacteria 1723
632 Ga0496121_0000004 3300048924 Bacteria 1139011
633 Ga0496121_0000890 3300048924 Bacteria 53895
634 Ga0496121_0007909 3300048924 Bacteria 12719
635 Ga0496121_0024612 3300048924 Bacteria 5749
636 Ga0496122_0000257 3300048925 Bacteria 120176
637 Ga0496122_0002520 3300048925 Bacteria 25803
638 Ga0496122_0007274 3300048925 Bacteria 12376
639 Ga0496123_0009374 3300048926 Bacteria 8824
640 Ga0496123_0013978 3300048926 Bacteria 6685
641 Ga0496123_0017604 3300048926 Bacteria 5738
642 Ga0496123_0052780 3300048926 Bacteria 2693
643 Ga0496123_0108220 3300048926 Bacteria 1596
644 Ga0496124_0000012 3300048927 Bacteria 512581
645 Ga0496124_0006087 3300048927 Bacteria 13270
646 Ga0496124_0011155 3300048927 Bacteria 9014
647 Ga0496124_0110452 3300048927 Bacteria 2213
648 Ga0496124_0185653 3300048927 Bacteria 1596
649 Ga0496125_0000003 3300048928 Bacteria 1189767
650 Ga0496125_0000120 3300048928 Bacteria 175991
651 Ga0496125_0005497 3300048928 Bacteria 14056
652 Ga0496125_0006560 3300048928 Bacteria 12541
653 Ga0496125_0017409 3300048928 Bacteria 6851
654 Ga0496125_0021110 3300048928 Bacteria 6085
655 Ga0496126_0000001 3300048929 Bacteria 1139011
656 Ga0496126_0000486 3300048929 Bacteria 78562
657 Ga0496126_0003910 3300048929 Bacteria 18301
658 Ga0496126_0006882 3300048929 Bacteria 12595
659 Ga0496126_0025387 3300048929 Bacteria 5701
660 Ga0496126_0059548 3300048929 Bacteria 3439
661 Ga0496126_0109835 3300048929 Bacteria 2403
662 Ga0495678_043112 3300049459 Bacteria 1794
663 Ga0495682_0045044 3300049460 Bacteria 1613
664 Ga0501032_0002761 3300049569 Bacteria 13674
665 Ga0501032_0055641 3300049569 Bacteria 2661
666 Ga0501032_0069896 3300049569 Bacteria 2342
667 Ga0501033_0032631 3300049570 Bacteria 3911
668 Ga0501033_0074846 3300049570 Bacteria 2486
669 Ga0501034_0000713 3300049571 Bacteria 50531
670 Ga0501034_0001497 3300049571 Bacteria 30701
671 Ga0501034_0007765 3300049571 Bacteria 11410
672 Ga0501034_0052682 3300049571 Bacteria 4099
673 Ga0501036_0048932 3300049572 Bacteria 3579
674 Ga0501037_0000565 3300049573 Bacteria 29305
675 Ga0501037_0003587 3300049573 Bacteria 11265
676 Ga0501037_0050568 3300049573 Bacteria 3041
677 Ga0501037_0054717 3300049573 Bacteria 2918
678 Ga0501038_0005864 3300049574 Bacteria 11364
679 Ga0501039_0004733 3300049575 Bacteria 10304
680 Ga0501042_0110920 3300049578 Bacteria 1975
681 Ga0501043_0003605 3300049579 Bacteria 12714
682 Ga0501043_0022565 3300049579 Bacteria 4935
683 Ga0501043_0079332 3300049579 Bacteria 2579
684 Ga0501046_0003054 3300049580 Bacteria 15460
685 Ga0501046_0142412 3300049580 Bacteria 1813
686 Ga0501047_0000016 3300049581 Bacteria 284621
687 Ga0501047_0004113 3300049581 Bacteria 13690
688 Ga0501047_0045167 3300049581 Bacteria 4259
689 Ga0501047_0082586 3300049581 Bacteria 3088
690 Ga0501048_0003080 3300049582 Bacteria 12710
691 Ga0501048_0049640 3300049582 Bacteria 2990
692 Ga0501048_0217635 3300049582 Bacteria 1354
693 Ga0501070_0002790 3300049586 Bacteria 15252
694 Ga0501070_0003367 3300049586 Bacteria 13867
695 Ga0501070_0004269 3300049586 Bacteria 12289
696 Ga0501070_0031104 3300049586 Bacteria 4471
697 Ga0501070_0109788 3300049586 Bacteria 2279
698 Ga0501073_0052234 3300049589 Bacteria 2862
699 Ga0501077_0038253 3300049593 Bacteria 3055
700 Ga0501080_0057680 3300049742 Bacteria 3615
701 Ga0501035_0000121 3300049822 Bacteria 94497
702 Ga0501035_0006303 3300049822 Bacteria 11149
703 Ga0501035_0265801 3300049822 Bacteria 1453
704 Ga0501044_0001588 3300049823 Bacteria 26614
705 Ga0501044_0007597 3300049823 Bacteria 11918
706 Ga0501044_0025190 3300049823 Bacteria 6308
707 Ga0501044_0100869 3300049823 Bacteria 2904
708 Ga0501044_0202760 3300049823 Bacteria 1941
709 Ga0501045_0181351 3300049824 Bacteria 1569
710 nmdc:mga03683_49174_c1 3300050489 Bacteria 1754
711 nmdc:mga03n38_1060_c1 3300050490 Bacteria 7583
712 nmdc:mga03n38_28205_c1 3300050490 Bacteria 2337
713 nmdc:mga03n38_345_c1 3300050490 Bacteria 11261
714 nmdc:mga03n38_49176_c1 3300050490 Bacteria 1874
715 nmdc:mga03n38_84610_c1 3300050490 Bacteria 1498
716 nmdc:mga03n38_91371_c1 3300050490 Bacteria 1450
717 nmdc:mga00v17_10810_c1 3300050491 Bacteria 5002
718 nmdc:mga00v17_15108_c1 3300050491 Bacteria 4328
719 nmdc:mga00v17_163958_c1 3300050491 Bacteria 1432
720 nmdc:mga00v17_18770_c1 3300050491 Bacteria 3935
721 nmdc:mga00v17_3609_c1 3300050491 Bacteria 7996
722 nmdc:mga00v17_57113_c1 3300050491 Bacteria 2387
723 nmdc:mga00v17_58867_c1 3300050491 Bacteria 2355
724 nmdc:mga00v17_71870_c1 3300050491 Bacteria 2146
725 nmdc:mga00v17_79601_c1 3300050491 Bacteria 2044
726 nmdc:mga00v17_86340_c1 3300050491 Bacteria 1966
727 nmdc:mga0yw44_42070_c1 3300050492 Bacteria 2723
728 nmdc:mga0yw44_51420_c1 3300050492 Bacteria 2495
729 nmdc:mga0yw44_72686_c1 3300050492 Bacteria 2138
730 nmdc:mga0yw44_89202_c1 3300050492 Bacteria 1945
731 nmdc:mga06z11_2666_c1 3300050494 Bacteria 6837
732 nmdc:mga06z11_28409_c1 3300050494 Bacteria 2684
733 nmdc:mga06z11_78777_c1 3300050494 Bacteria 1762
734 nmdc:mga04h51_12735_c1 3300050495 Bacteria 2368
735 nmdc:mga07m45_168_c1 3300050496 Bacteria 26249
736 nmdc:mga07m45_56790_c1 3300050496 Bacteria 2213
737 nmdc:mga07m45_58696_c2 3300050496 Bacteria 1690
738 nmdc:mga07m45_70835_c1 3300050496 Bacteria 1983
739 nmdc:mga07m45_848_c1 3300050496 Bacteria 13274
740 nmdc:mga07m45_90581_c1 3300050496 Bacteria 1752
741 nmdc:mga05p37_23599_c1 3300050507 Bacteria 7465
742 nmdc:mga06r32_12556_c1 3300050510 Bacteria 7648
743 nmdc:mga08y16_229415_c1 3300050511 Bacteria 1920
744 nmdc:mga0sz30_10464_c1 3300050516 Bacteria 3558
745 nmdc:mga0sz30_12067_c1 3300050516 Bacteria 3353
746 nmdc:mga0sz30_35686_c1 3300050516 Bacteria 2076
747 nmdc:mga0sz30_7062_c1 3300050516 Bacteria 4198
748 Ga0495601_0044342 3300053077 Bacteria 2795
749 Ga0500635_0014531 3300053080 Bacteria 2309
750 Ga0495595_0015522 3300053084 Bacteria 3249
751 Ga0495619_0017630 3300053085 Bacteria 4523
752 Ga0495619_0046536 3300053085 Bacteria 2853
753 Ga0500643_003177 3300053087 Bacteria 8027
754 Ga0500641_0000736 3300053096 Bacteria 11863
755 Ga0500652_000274 3300053131 Bacteria 19163
756 Ga0500600_0035040 3300053149 Bacteria 2927
757 Ga0500616_0053717 3300053153 Bacteria 2113
758 Ga0500616_0072254 3300053153 Bacteria 1754
759 Ga0466962_0017938 3300061719 Bacteria 3405
760 2510285070 2510065053 Bacteria 5005518
761 2510294093 2510065055 Bacteria 5037935
762 2510313127 2510065058 Bacteria 5005894
763 2548699553 2547132424 Bacteria 8348532
764 2552111395 2551306166 Bacteria 9731570
765 2554259099 2554235005 Bacteria 6457341
766 2555246416 2554235231 Bacteria 5215788
767 2566991632 2565956761 Bacteria 6601618
768 2585314853 2582581314 Bacteria 11452267
769 2616702027 2616644814 Bacteria 11555299
770 2643734181 2643221542 Bacteria 3563959
771 2643785284 2643221553 Bacteria 3544260
772 2643888519 2643221575 Bacteria 4022601
773 2644170767 2643221630 Bacteria 3601215
774 2644387531 2643221670 Bacteria 6497041
775 2644457451 2643221681 Bacteria 3707866
776 2644487513 2643221687 Bacteria 6500351
777 2644517868 2643221692 Bacteria 7282860
778 2644523697 2643221694 Bacteria 4392972
779 2644537283 2643221697 Bacteria 3575694
780 2644639105 2643221715 Bacteria 6671032
781 2644679622 2643221724 Bacteria 3593515
782 2645719327 2643221961 Bacteria 3919167
783 2645726244 2643221962 Bacteria 3874254
784 2730229132 2728369380 Bacteria 3620317
785 2731908365 2731639228 Bacteria 4187555
786 2738667888 2738541264 Bacteria 5935393
787 2738702442 2738541274 Bacteria 6909446
788 2738887985 2738541308 Bacteria 7020677
789 2739146958 2738541356 Bacteria 5935017
790 2739206464 2738543005 Bacteria 5278128
791 2739237478 2738543011 Bacteria 5731169
792 2739331698 2738543028 Bacteria 6917070
793 2739364385 2738543034 Bacteria 6084756
794 2744956533 2744054611 Bacteria 5611514
795 2747953854 2747842429 Bacteria 3914386
796 2758224436 2757320536 Bacteria 3629334
797 2765585314 2765235841 Bacteria 6137024
798 2774128165 2773857672 Bacteria 4993178
799 2774135036 2773857673 Bacteria 6513460
800 2774383646 2773857759 Bacteria 2963774
801 2774400259 2773857763 Bacteria 4180068
802 2784265107 2784132063 Bacteria 6262788
803 2785340189 2784746763 Bacteria 9783172
804 2799184680 2799112218 Bacteria 4315149
805 2807407322 2806310737 Bacteria 5751088
806 2807455651 2806310745 Bacteria 5742165
807 2808885027 2808606368 Bacteria 3174172
808 2819689479 2818991462 Bacteria 4320267
809 2819726979 2818991469 Bacteria 4644110
810 2842135314 2842134933 Bacteria 5847019
811 2842890422 2842888712 Bacteria 4279094
812 2852659453 2852657418 Bacteria 6472974
813 2852664706 2852663356 Bacteria 4090475
814 2857721035 2857720070 Bacteria 3189373
815 2857723320 2857723135 Bacteria 4217853
816 2862510994 2862507626 Bacteria 9425308
817 2862576603 2862574272 Bacteria 10567477
818 2863409639 2863404153 Bacteria 9672205
819 2870629724 2870628048 Bacteria 3696012
820 2880232856 2880230671 Bacteria 6140320
821 2884998129 2884994152 Bacteria 4492978
822 2889305172 2889300758 Bacteria 5690814
823 2902794263 2902792274 Bacteria 7270173
824 2902802703 2902799365 Bacteria 5419524
825 2902816003 2902810491 Bacteria 6794147
826 2902839606 2902837492 Bacteria 6697721
827 2904520405 2904518522 Bacteria 6068986
828 2904541140 2904535858 Bacteria 6308016
829 2904767048 2904765812 Bacteria 5369154
830 2904773798 2904770941 Bacteria 5580202
831 2917835483 2917832318 Bacteria 5346010
832 2919129176 2919125081 Bacteria 5385106
833 2919157404 2919155634 Bacteria 4860545
834 2919420506 2919420072 Bacteria 5390363
835 2919433736 2919432681 Bacteria 5390474
836 2922560787 2922554459 Bacteria 6683962
837 2928091188 2928090899 Bacteria 3158267
838 2928143476 2928142448 Bacteria 5288925
839 2929212959 2929212328 Bacteria 7708288
840 2932401407 2932398195 Bacteria 3847976
841 2939586060 2939582691 Bacteria 7088898
842 2939746968 2939743619 Bacteria 5762299
843 2946034266 2946033335 Bacteria 3835514
844 2946043650 2946041624 Bacteria 4191385
845 2946081427 2946080515 Bacteria 4310960
846 2954010051 2954002825 Bacteria 9173742
847 2956942295 2956939328 Bacteria 3474458
848 2974299679 2974298342 Bacteria 4840922
849 2984502039 2984499530 Bacteria 5020881
850 2984504467 2984504281 Bacteria 5262371
851 2984582061 2984580707 Bacteria 3351387
852 2984594476 2984592036 Bacteria 3670284
853 2990059947 2990059506 Bacteria 9321252
854 3001122044 3001119090 Bacteria 3449530
855 3003007140 3002998708 Bacteria 11715108
856 3007804346 3007803356 Bacteria 5931491
857 3007873238 3007872151 Bacteria 5268868
858 8004185987 8004182704 Bacteria 3391155
859 8016254717 8016254467 Bacteria 3797036
860 8016728295 8016728285 Bacteria 5263933
861 8047717887 8047710418 Bacteria 11023148
862 8048406951 8048406513 Bacteria 8936924
863 8052496066 8052494512 Bacteria 5765634
864 8056117789 8056115690 Bacteria 5527654
865 8056124536 8056120720 Bacteria 5758328
866 8056138975 8056137416 Bacteria 6147080
867 Ga0105239_10064200
868 JGI24750J21931_1002942
869 JGI24745J21846_1002152
870 JGI24744J21845_10001688
871 JGI24744J21845_10006437
872 rootH2_10176965
873 Ga0055540_1000271
874 Ga0055540_1005489
875 Ga0055540_1006025
876 Ga0070658_10162529
877 Ga0070683_100029145
878 Ga0070683_100039520
879 Ga0070683_100197830
880 Ga0070690_100007863
881 Ga0068869_100010933
882 Ga0068869_100026392
883 Ga0070666_10030385
884 Ga0070680_100015433
885 Ga0070680_100070122
886 Ga0070682_100003922
887 Ga0070682_100107570
888 Ga0068868_100002425
889 Ga0070660_100150099
890 Ga0070689_100115441
891 Ga0070691_10004443
892 Ga0070668_100000653
893 Ga0070668_100057522
894 Ga0070669_100000782
895 Ga0070669_100137190
896 Ga0070669_100191566
897 Ga0070674_100002534
898 Ga0070674_100132897
899 Ga0070667_100001332
900 Ga0070667_100099485
901 Ga0070709_10006400
902 Ga0070709_10021944
903 Ga0070709_10046416
904 Ga0070709_10048203
905 Ga0070714_100001366
906 Ga0070714_100049857
907 Ga0070714_100269394
908 Ga0070714_100324865
909 Ga0070713_100024404
910 Ga0070713_100026728
911 Ga0070713_100206552
912 Ga0070710_10001529
913 Ga0070710_10082216
914 Ga0070701_10002831
915 Ga0070701_10050290
916 Ga0070711_100000576
917 Ga0070711_100046340
918 Ga0070700_100001477
919 Ga0070694_100005845
920 Ga0070708_100075668
921 Ga0070708_100235326
922 Ga0070663_100024173
923 Ga0070678_100000354
924 Ga0070681_10008307
925 Ga0068867_100008429
926 Ga0070685_10022554
927 Ga0070706_100036582
928 Ga0070707_100028262
929 Ga0070698_100002154
930 Ga0070698_100017694
931 Ga0070698_100059157
932 Ga0070699_100004481
933 Ga0070679_100119767
934 Ga0070684_100209826
935 Ga0068853_100002909
936 Ga0068853_100099385
937 Ga0070672_100051562
938 Ga0070686_100100838
939 Ga0070695_100018145
940 Ga0070696_100109895
941 Ga0070693_100051609
942 Ga0070693_100108425
943 Ga0070665_100008709
944 Ga0070665_100024333
945 Ga0070665_100157422
946 Ga0070665_100189419
947 Ga0070665_100198348
948 Ga0070665_100326482
949 Ga0070704_100004662
950 Ga0070704_100030727
951 Ga0068855_100038585
952 Ga0068855_100252740
953 Ga0068857_100240387
954 Ga0068854_100000627
955 Ga0070702_100002118
956 Ga0068852_100054718
957 Ga0068852_100085107
958 Ga0068859_100002678
959 Ga0068859_100023429
960 Ga0068866_10000361
961 Ga0068861_100014034
962 Ga0068863_100000205
963 Ga0068863_100005283
964 Ga0068863_100060594
965 Ga0068863_100196516
966 Ga0068858_100000168
967 Ga0068858_100001350
968 Ga0068860_100000472
969 Ga0068860_100001653
970 Ga0068862_100000030
971 Ga0068862_100010156
972 Ga0068862_100042063
973 Ga0068862_100239001
974 Ga0081455_10062004
975 Ga0081538_10059503
976 Ga0081540_1057411
977 Ga0070717_10226522
978 Ga0070717_10262905
979 Ga0075365_10001952
980 Ga0075368_10001718
981 Ga0075363_100000097
982 Ga0075363_100002128
983 Ga0075363_100003750
984 Ga0075363_100009049
985 Ga0075363_100031121
986 Ga0075364_10005609
987 Ga0075364_10008833
988 Ga0075364_10009237
989 Ga0075364_10018692
990 Ga0075364_10028145
991 Ga0075364_10028863
992 Ga0075364_10051494
993 Ga0075364_10056541
994 Ga0075364_10061308
995 Ga0070715_10006097
996 Ga0070716_100002294
997 Ga0070716_100008929
998 Ga0070716_100016762
999 Ga0070712_100003061
1000 Ga0070712_100008920
1001 Ga0070712_100041980
1002 Ga0070712_100063012
1003 Ga0070712_100127692
1004 Ga0075362_10041452
1005 Ga0075367_10030433
1006 Ga0075369_10004831
1007 Ga0075369_10010068
1008 Ga0075369_10011795
1009 Ga0075369_10026485
1010 Ga0075369_10034287
1011 Ga0075369_10035818
1012 Ga0075369_10046558
1013 Ga0097621_100046747
1014 Ga0097621_100118399
1015 Ga0075370_10002845
1016 Ga0075370_10007007
1017 Ga0075370_10027989
1018 Ga0075370_10039654
1019 Ga0075370_10091975
1020 Ga0075428_100204394
1021 Ga0068865_100000387
1022 Ga0097620_100002678
1023 Ga0097620_100023429
1024 Ga0111539_10209605
1025 Ga0111539_10296047
1026 Ga0105245_10001038
1027 Ga0105245_10046305
1028 Ga0105247_10000008
1029 Ga0105247_10001693
1030 Ga0105247_10004448
1031 Ga0114129_10013780
1032 Ga0105243_10000843
1033 Ga0105243_10163954
1034 Ga0105241_10022905
1035 Ga0105242_10007482
1036 Ga0105242_10136418
1037 Ga0105248_10000257
1038 Ga0105248_10004442
1039 Ga0105248_10142575
1040 Ga0105237_10056403
1041 Ga0105237_10220790
1042 Ga0105238_10168007
1043 Ga0105238_10248398
1044 Ga0105249_10000036
1045 Ga0105249_10000784
1046 Ga0105249_10009674
1047 Ga0105249_10229457
1048 Ga0105239_10028827
1049 Ga0105239_10102901
1050 Ga0105246_10105196
1051 Ga0105246_10210107
1052 Ga0157369_10058289
1053 Ga0157374_10146594
1054 Ga0157378_10003550
1055 Ga0157378_10036189
1056 Ga0163162_10007488
1057 Ga0163162_10036768
1058 Ga0163162_10080667
1059 Ga0163162_10129749
1060 Ga0163162_10298367
1061 Ga0157372_10009543
1062 Ga0157372_10038914
1063 Ga0157372_10292929
1064 Ga0157375_10004444
1065 Ga0157380_10003150
1066 Ga0157379_10007963
1067 Ga0157379_10015502
1068 Ga0157379_10102499
1069 Ga0157376_10117326
1070 Ga0163161_10001144
1071 Ga0163161_10090569
1072 Ga0206351_10537428
1073 Ga0206353_11506564
1074 Ga0213876_10000895
1075 Ga0213876_10009314
1076 Ga0213876_10080788
1077 Ga0213875_10001935
1078 Ga0213875_10039122
1079 Ga0224712_10016804
1080 Ga0224712_10063952
1081 Ga0209646_1000134
1082 Ga0209673_1016674
1083 Ga0209051_1000158
1084 Ga0209051_1001340
1085 Ga0207692_10001432
1086 Ga0207642_10000456
1087 Ga0207710_10000006
1088 Ga0207710_10000162
1089 Ga0207688_10001605
1090 Ga0207688_10048375
1091 Ga0207680_10094702
1092 Ga0207647_10050412
1093 Ga0207685_10009981
1094 Ga0207685_10039710
1095 Ga0207699_10002855
1096 Ga0207699_10120604
1097 Ga0207705_10022390
1098 Ga0207654_10145446
1099 Ga0207693_10000616
1100 Ga0207693_10005615
1101 Ga0207693_10058724
1102 Ga0207693_10090264
1103 Ga0207693_10267280
1104 Ga0207663_10022988
1105 Ga0207663_10043074
1106 Ga0207663_10098629
1107 Ga0207660_10071363
1108 Ga0207660_10165967
1109 Ga0207657_10233690
1110 Ga0207681_10039408
1111 Ga0207650_10055953
1112 Ga0207687_10004616
1113 Ga0207700_10035470
1114 Ga0207664_10217391
1115 Ga0207664_10243242
1116 Ga0207644_10073608
1117 Ga0207690_10088732
1118 Ga0207706_10002810
1119 Ga0207686_10007012
1120 Ga0207686_10063618
1121 Ga0207709_10064371
1122 Ga0207709_10081966
1123 Ga0207669_10000994
1124 Ga0207669_10109324
1125 Ga0207704_10001171
1126 Ga0207665_10001800
1127 Ga0207665_10008271
1128 Ga0207691_10061590
1129 Ga0207711_10000269
1130 Ga0207711_10031304
1131 Ga0207711_10046314
1132 Ga0207689_10015810
1133 Ga0207689_10019613
1134 Ga0207661_10016004
1135 Ga0207661_10101516
1136 Ga0207712_10000036
1137 Ga0207712_10012569
1138 Ga0207712_10016214
1139 Ga0207668_10000958
1140 Ga0207668_10091903
1141 Ga0207640_10014005
1142 Ga0207658_10000060
1143 Ga0207658_10004558
1144 Ga0207677_10003591
1145 Ga0207703_10000202
1146 Ga0207703_10024689
1147 Ga0207639_10032926
1148 Ga0207639_10062822
1149 Ga0207678_10019583
1150 Ga0207678_10021554
1151 Ga0207678_10074928
1152 Ga0207708_10001249
1153 Ga0207702_10174248
1154 Ga0207641_10000302
1155 Ga0207641_10000909
1156 Ga0207641_10158590
1157 Ga0207648_10002184
1158 Ga0207648_10054924
1159 Ga0207674_10016832
1160 Ga0207674_10039502
1161 Ga0207675_100001298
1162 Ga0207675_100007416
1163 Ga0207675_100180735
1164 Ga0207683_10000649
1165 Ga0207683_10020887
1166 Ga0207698_10084806
1167 Ga0207698_10119916
1168 Ga0268266_10009911
1169 Ga0268266_10013586
1170 Ga0268266_10063831
1171 Ga0268266_10238625
1172 Ga0268265_10000038
1173 Ga0268265_10106042
1174 Ga0268264_10000056
1175 Ga0268264_10001858
1176 Ga0265337_1003050
1177 Ga0265319_1005297
1178 Ga0265334_10001860
1179 Ga0265338_10001121
1180 Ga0265338_10005595
1181 Ga0265324_10003191
1182 Ga0307511_10067675
1183 Ga0307512_10058625
1184 Ga0316181_1057629
1185 Ga0265332_10044040
1186 Ga0265320_10027167
1187 Ga0265340_10008890
1188 Ga0265327_10000001
1189 Ga0265327_10000125
1190 Ga0265327_10001089
1191 Ga0307408_100150425
1192 Ga0307408_100159348
1193 Ga0307508_10057904
1194 Ga0265314_10007411
1195 Ga0307516_10000105
1196 Ga0307516_10043992
1197 Ga0307516_10050127
1198 Ga0307405_10001336
1199 Ga0307405_10106903
1200 Ga0307405_10118518
1201 Ga0307405_10173554
1202 Ga0307413_10037680
1203 Ga0307410_10023048
1204 Ga0307410_10037551
1205 Ga0307410_10074132
1206 Ga0307410_10143174
1207 Ga0307406_10002614
1208 Ga0307406_10009182
1209 Ga0307406_10010564
1210 Ga0307406_10013181
1211 Ga0307406_10051575
1212 Ga0307406_10092236
1213 Ga0307407_10118270
1214 Ga0307412_10053015
1215 Ga0307409_100000054
1216 Ga0307409_100010983
1217 Ga0307416_100006421
1218 Ga0307416_100008186
1219 Ga0307416_100246754
1220 Ga0307414_10005690
1221 Ga0307414_10050736
1222 Ga0307414_10060171
1223 Ga0307415_100003755
1224 Ga0316593_10003464
1225 Ga0373934_0049186
1226 Ga0373945_0048405
1227 Ga0373953_0014900
1228 Ga0373954_0040389
1229 Ga0373956_0016072
1230 Ga0373955_0046907
1231 Ga0373961_0030592
1232 Ga0373935_0055689
1233 Ga0373927_0168886
1234 Ga0373947_0047249
1235 Ga0372808_003264
1236 Ga0316582_0091703
1237 Ga0316584_0050791
1238 Ga0316584_0247090
1239 Ga0373925_0030571
1240 Ga0395898_0232009
1241 Ga0395905_0208285
1242 Ga0436364_0686614
1243 Ga0436364_0791704
1244 Ga0436364_1306017
1245 Ga0436364_1419871
1246 Ga0436364_1492125
1247 Ga0395901_0073029
1248 Ga0436365_0943842
1249 Ga0436365_1177772
1250 Ga0436365_1925863
1251 Ga0436363_0515244
1252 Ga0439436_0000595
1253 Ga0439461_0001310
1254 Ga0439466_0003018
1255 Ga0439466_0028451
1256 Ga0439465_0023924
1257 Ga0451791_0196447
1258 Ga0451802_0491012
1259 Ga0451807_2180301
1260 Ga0451833_0747008
1261 Ga0451837_0975337
1262 Ga0451841_0559703
1263 Ga0451853_3245237
1264 Ga0439431_0019254
1265 Ga0439445_0007998
1266 Ga0439457_002432
1267 Ga0450894_000320
1268 Ga0450896_003367
1269 Ga0450898_006765
1270 Ga0450899_001526
1271 Ga0450903_010793
1272 Ga0450906_001346
1273 Ga0439434_0013862
1274 Ga0439434_0019746
1275 Ga0466969_0037648
1276 Ga0466969_0041226
1277 Ga0466969_0050859
1278 Ga0466972_0011927
1279 Ga0466972_0013593
1280 Ga0466972_0016326
1281 Ga0466965_0004778
1282 Ga0466965_0015623
1283 Ga0466966_0003202
1284 Ga0466966_0008774
1285 Ga0466966_0049490
1286 Ga0466966_0068639
1287 Ga0466961_0011812
1288 Ga0466961_0024117
1289 Ga0466963_0029095
1290 Ga0466963_0063684
1291 Ga0466963_0063994
1292 Ga0466963_0084632
1293 Ga0466963_0099793
1294 Ga0466968_0015123
1295 Ga0466968_0018384
1296 Ga0466968_0019675
1297 Ga0466970_0002553
1298 Ga0466970_0011890
1299 Ga0466970_0024364
1300 Ga0466957_0000745
1301 Ga0466957_0055160
1302 Ga0466957_0079178
1303 Ga0466960_0001619
1304 Ga0466960_0020262
1305 Ga0466960_0040455
1306 Ga0466960_0062669
1307 Ga0466959_0004991
1308 Ga0466959_0056275
1309 Ga0466967_0001105
1310 Ga0466967_0004929
1311 Ga0466967_0005712
1312 Ga0466967_0032807
1313 Ga0466967_0129493
1314 Ga0466967_0174045
1315 Ga0495627_004044
1316 Ga0495629_0021248
1317 Ga0495629_0027357
1318 Ga0495638_0012385
1319 Ga0495641_0016048
1320 Ga0495651_0006931
1321 Ga0495653_0098152
1322 Ga0495582_0034214
1323 Ga0495582_0040146
1324 Ga0495605_0012335
1325 Ga0495662_0014240
1326 Ga0495585_0028652
1327 Ga0495594_0013655
1328 Ga0495606_0008256
1329 Ga0495608_0044293
1330 Ga0495610_0031439
1331 Ga0495616_0015857
1332 Ga0495618_0031628
1333 Ga0495628_0199831
1334 Ga0495630_0097557
1335 Ga0495631_0008081
1336 Ga0495643_0001873
1337 Ga0495648_0007320
1338 Ga0495666_0123913
1339 Ga0495642_0041722
1340 Ga0495652_0018443
1341 Ga0495652_0067710
1342 Ga0495654_0019829
1343 Ga0495665_0050267
1344 Ga0495640_0008096
1345 Ga0495640_0020960
1346 Ga0495640_0043946
1347 Ga0495640_0053878
1348 Ga0495587_0002793
1349 Ga0495587_0037326
1350 Ga0495609_0014822
1351 Ga0495597_0010176
1352 Ga0495645_0128261
1353 Ga0495633_0017222
1354 Ga0495667_0003348
1355 Ga0495668_0000237
1356 Ga0495668_0069606
1357 Ga0495611_0040581
1358 Ga0495625_0033482
1359 Ga0495625_0063279
1360 Ga0495635_0041157
1361 Ga0495661_0009739
1362 Ga0495599_0009664
1363 Ga0495623_0078186
1364 Ga0495646_0090662
1365 Ga0495647_0011762
1366 Ga0495647_0028234
1367 Ga0495658_0050287
1368 Ga0495613_0103334
1369 Ga0495671_0110012
1370 Ga0495660_0024014
1371 Ga0495581_0049463
1372 Ga0495581_0179566
1373 Ga0495604_0029445
1374 Ga0495636_0010212
1375 Ga0495636_0013734
1376 Ga0495674_0006976
1377 Ga0495674_0026024
1378 Ga0495672_0050913
1379 Ga0495672_0093655
1380 Ga0495676_0052369
1381 Ga0495676_0113445
1382 Ga0495680_0044837
1383 Ga0495683_0000511
1384 Ga0495687_007829
1385 Ga0495675_0010322
1386 Ga0495685_004987
1387 Ga0495673_0000771
1388 Ga0495681_0058817
1389 Ga0495684_0029484
1390 Ga0495684_0070583
1391 Ga0495686_0003681
1392 Ga0495686_0096465
1393 Ga0496100_0000026
1394 Ga0496100_0000527
1395 Ga0496100_0000979
1396 Ga0496100_0013880
1397 Ga0496100_0027029
1398 Ga0496100_0032752
1399 Ga0496101_0000002
1400 Ga0496101_0000015
1401 Ga0496101_0001115
1402 Ga0496101_0001550
1403 Ga0496101_0010167
1404 Ga0496101_0118921
1405 Ga0496102_0000009
1406 Ga0496102_0000973
1407 Ga0496102_0001400
1408 Ga0496102_0014428
1409 Ga0496102_0028228
1410 Ga0496102_0041798
1411 Ga0496102_0076107
1412 Ga0496102_0185720
1413 Ga0496103_0000051
1414 Ga0496103_0000902
1415 Ga0496103_0004003
1416 Ga0496103_0004241
1417 Ga0496103_0006654
1418 Ga0496103_0018590
1419 Ga0496104_0003436
1420 Ga0496104_0037473
1421 Ga0496104_0084968
1422 Ga0496104_0102037
1423 Ga0496105_0003833
1424 Ga0496105_0064350
1425 Ga0496105_0104624
1426 Ga0496105_0125720
1427 Ga0496105_0145100
1428 Ga0496106_0001036
1429 Ga0496106_0002064
1430 Ga0496106_0003615
1431 Ga0496106_0010701
1432 Ga0496106_0083021
1433 Ga0496107_0000365
1434 Ga0496107_0000827
1435 Ga0496107_0006589
1436 Ga0496107_0013068
1437 Ga0496107_0030409
1438 Ga0496108_0004412
1439 Ga0496108_0006168
1440 Ga0496108_0022918
1441 Ga0496108_0067772
1442 Ga0496108_0078208
1443 Ga0496108_0103949
1444 Ga0496109_0000022
1445 Ga0496109_0000747
1446 Ga0496109_0041880
1447 Ga0496109_0089005
1448 Ga0496109_0089525
1449 Ga0496109_0110141
1450 Ga0496109_0433287
1451 Ga0496110_0003405
1452 Ga0496110_0033310
1453 Ga0496110_0035944
1454 Ga0496110_0140565
1455 Ga0496110_0232579
1456 Ga0496111_0008202
1457 Ga0496111_0062422
1458 Ga0496111_0095443
1459 Ga0496112_0001525
1460 Ga0496112_0007625
1461 Ga0496112_0009325
1462 Ga0496112_0022270
1463 Ga0496112_0094446
1464 Ga0496112_0094864
1465 Ga0496112_0155665
1466 Ga0496113_0138959
1467 Ga0496113_0155588
1468 Ga0496114_0000107
1469 Ga0496114_0000681
1470 Ga0496114_0001173
1471 Ga0496114_0131985
1472 Ga0496114_0204121
1473 Ga0496114_0317936
1474 Ga0496115_0001418
1475 Ga0496115_0003492
1476 Ga0496115_0008073
1477 Ga0496115_0050368
1478 Ga0496115_0074854
1479 Ga0496115_0186721
1480 Ga0496116_0000141
1481 Ga0496116_0004448
1482 Ga0496116_0016923
1483 Ga0496117_0000019
1484 Ga0496117_0000028
1485 Ga0496117_0002095
1486 Ga0496117_0131680
1487 Ga0496118_0000020
1488 Ga0496118_0000255
1489 Ga0496118_0002066
1490 Ga0496119_0002236
1491 Ga0496119_0002728
1492 Ga0496119_0004258
1493 Ga0496119_0016127
1494 Ga0496119_0032073
1495 Ga0496120_0001194
1496 Ga0496120_0021885
1497 Ga0496120_0083558
1498 Ga0496121_0000004
1499 Ga0496121_0000890
1500 Ga0496121_0007909
1501 Ga0496121_0024612
1502 Ga0496122_0000257
1503 Ga0496122_0002520
1504 Ga0496122_0007274
1505 Ga0496123_0009374
1506 Ga0496123_0013978
1507 Ga0496123_0017604
1508 Ga0496123_0052780
1509 Ga0496123_0108220
1510 Ga0496124_0000012
1511 Ga0496124_0006087
1512 Ga0496124_0011155
1513 Ga0496124_0110452
1514 Ga0496124_0185653
1515 Ga0496125_0000003
1516 Ga0496125_0000120
1517 Ga0496125_0005497
1518 Ga0496125_0006560
1519 Ga0496125_0017409
1520 Ga0496125_0021110
1521 Ga0496126_0000001
1522 Ga0496126_0000486
1523 Ga0496126_0003910
1524 Ga0496126_0006882
1525 Ga0496126_0025387
1526 Ga0496126_0059548
1527 Ga0496126_0109835
1528 Ga0495678_043112
1529 Ga0495682_0045044
1530 Ga0501032_0002761
1531 Ga0501032_0055641
1532 Ga0501032_0069896
1533 Ga0501033_0032631
1534 Ga0501033_0074846
1535 Ga0501034_0000713
1536 Ga0501034_0001497
1537 Ga0501034_0007765
1538 Ga0501034_0052682
1539 Ga0501036_0048932
1540 Ga0501037_0000565
1541 Ga0501037_0003587
1542 Ga0501037_0050568
1543 Ga0501037_0054717
1544 Ga0501038_0005864
1545 Ga0501039_0004733
1546 Ga0501042_0110920
1547 Ga0501043_0003605
1548 Ga0501043_0022565
1549 Ga0501043_0079332
1550 Ga0501046_0003054
1551 Ga0501046_0142412
1552 Ga0501047_0000016
1553 Ga0501047_0004113
1554 Ga0501047_0045167
1555 Ga0501047_0082586
1556 Ga0501048_0003080
1557 Ga0501048_0049640
1558 Ga0501048_0217635
1559 Ga0501070_0002790
1560 Ga0501070_0003367
1561 Ga0501070_0004269
1562 Ga0501070_0031104
1563 Ga0501070_0109788
1564 Ga0501073_0052234
1565 Ga0501077_0038253
1566 Ga0501080_0057680
1567 Ga0501035_0000121
1568 Ga0501035_0006303
1569 Ga0501035_0265801
1570 Ga0501044_0001588
1571 Ga0501044_0007597
1572 Ga0501044_0025190
1573 Ga0501044_0100869
1574 Ga0501044_0202760
1575 Ga0501045_0181351
1576 nmdc:mga03683_49174_c1
1577 nmdc:mga03n38_1060_c1
1578 nmdc:mga03n38_28205_c1
1579 nmdc:mga03n38_345_c1
1580 nmdc:mga03n38_49176_c1
1581 nmdc:mga03n38_84610_c1
1582 nmdc:mga03n38_91371_c1
1583 nmdc:mga00v17_10810_c1
1584 nmdc:mga00v17_15108_c1
1585 nmdc:mga00v17_163958_c1
1586 nmdc:mga00v17_18770_c1
1587 nmdc:mga00v17_3609_c1
1588 nmdc:mga00v17_57113_c1
1589 nmdc:mga00v17_58867_c1
1590 nmdc:mga00v17_71870_c1
1591 nmdc:mga00v17_79601_c1
1592 nmdc:mga00v17_86340_c1
1593 nmdc:mga0yw44_42070_c1
1594 nmdc:mga0yw44_51420_c1
1595 nmdc:mga0yw44_72686_c1
1596 nmdc:mga0yw44_89202_c1
1597 nmdc:mga06z11_2666_c1
1598 nmdc:mga06z11_28409_c1
1599 nmdc:mga06z11_78777_c1
1600 nmdc:mga04h51_12735_c1
1601 nmdc:mga07m45_168_c1
1602 nmdc:mga07m45_56790_c1
1603 nmdc:mga07m45_58696_c2
1604 nmdc:mga07m45_70835_c1
1605 nmdc:mga07m45_848_c1
1606 nmdc:mga07m45_90581_c1
1607 nmdc:mga05p37_23599_c1
1608 nmdc:mga06r32_12556_c1
1609 nmdc:mga08y16_229415_c1
1610 nmdc:mga0sz30_10464_c1
1611 nmdc:mga0sz30_12067_c1
1612 nmdc:mga0sz30_35686_c1
1613 nmdc:mga0sz30_7062_c1
1614 Ga0495601_0044342
1615 Ga0500635_0014531
1616 Ga0495595_0015522
1617 Ga0495619_0017630
1618 Ga0495619_0046536
1619 Ga0500643_003177
1620 Ga0500641_0000736
1621 Ga0500652_000274
1622 Ga0500600_0035040
1623 Ga0500616_0053717
1624 Ga0500616_0072254
1625 Ga0466962_0017938
1626 2510285070
1627 2510294093
1628 2510313127
1629 2548699553
1630 2552111395
1631 2554259099
1632 2555246416
1633 2566991632
1634 2585314853
1635 2616702027
1636 2643734181
1637 2643785284
1638 2643888519
1639 2644170767
1640 2644387531
1641 2644457451
1642 2644487513
1643 2644517868
1644 2644523697
1645 2644537283
1646 2644639105
1647 2644679622
1648 2645719327
1649 2645726244
1650 2730229132
1651 2731908365
1652 2738667888
1653 2738702442
1654 2738887985
1655 2739146958
1656 2739206464
1657 2739237478
1658 2739331698
1659 2739364385
1660 2744956533
1661 2747953854
1662 2758224436
1663 2765585314
1664 2774128165
1665 2774135036
1666 2774383646
1667 2774400259
1668 2784265107
1669 2785340189
1670 2799184680
1671 2807407322
1672 2807455651
1673 2808885027
1674 2819689479
1675 2819726979
1676 2842135314
1677 2842890422
1678 2852659453
1679 2852664706
1680 2857721035
1681 2857723320
1682 2862510994
1683 2862576603
1684 2863409639
1685 2870629724
1686 2880232856
1687 2884998129
1688 2889305172
1689 2902794263
1690 2902802703
1691 2902816003
1692 2902839606
1693 2904520405
1694 2904541140
1695 2904767048
1696 2904773798
1697 2917835483
1698 2919129176
1699 2919157404
1700 2919420506
1701 2919433736
1702 2922560787
1703 2928091188
1704 2928143476
1705 2929212959
1706 2932401407
1707 2939586060
1708 2939746968
1709 2946034266
1710 2946043650
1711 2946081427
1712 2954010051
1713 2956942295
1714 2974299679
1715 2984502039
1716 2984504467
1717 2984582061
1718 2984594476
1719 2990059947
1720 3001122044
1721 3003007140
1722 3007804346
1723 3007873238
1724 8004185987
1725 8016254717
1726 8016728295
1727 8047717887
1728 8048406951
1729 8052496066
1730 8056117789
1731 8056124536
1732 8056138975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

94

458

0.9

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

160

270

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cvq-assembly1.cif.gz_B crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution 0.9863 20 423
4cvq-assembly1.cif.gz_B crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution 0.9815 20 423
1xi9-assembly1.cif.gz_C alanine aminotransferase from pyrococcus furiosus pfu-1397077-001 0.961 23 421
1xi9-assembly1.cif.gz_C alanine aminotransferase from pyrococcus furiosus pfu-1397077-001 0.9586 23 421
3dyd-assembly1.cif.gz_A human tyrosine aminotransferase 0.9244 50 417
ID Description Score Start End Superfamily
af_P9WQ91_327_423_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 1.007 321 417 3.90.1150.10
af_P9WQ91_327_423_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9968 321 417 3.90.1150.10
af_P0A959_57_294_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9836 75 313 3.40.640.10
af_P0A959_57_294_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9795 75 313 3.40.640.10
4cvqB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9774 20 423 3.90.1150.10
ID Description Score Start End GO Terms
AF-X7ZAY3-F1-model_v4 deleted 0.9988 163 270
AF-A0A1I2W0A7-F1-model_v4 alanine transaminase (EC 2.6.1.2) 0.9898 20 423 GO:0008483
GO:0009058
GO:0030170
AF-A0A519FZB2-F1-model_v4 deleted 0.9888 20 421
AF-A0A0G3ESD3-F1-model_v4 alanine transaminase (EC 2.6.1.2) 0.9879 20 421 GO:0008483
GO:0009058
GO:0030170
AF-A0A2N4YPN9-F1-model_v4 alanine transaminase (EC 2.6.1.2) 0.9874 90 304 GO:0004021
GO:0009058
GO:0030170

Map