F484032

General Info

Members Datasets Scaffolds Average Seq Length
866 439 1732 208

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0021047|Ga0496121_0021047_1786_2460
Length 224
Sequence MYSWAQKLLRNHSEVMEVKVLDFNGKDTGRKVQLSDSVFAIEPNNHAVYLDVKQYLANQRQGTHKAKERAEVTGSTRKIKKQKGTGTARAGSVKNPLFKGGGTVFGPRPRSYSFKLNKNLKRLARKSAFSIKAKESNIIVLEDFNFETPNTKNFVNVLKALGLESKKSLFVLGESNKNVYLSSRNLKASNVVTSSELSTYAILNTNNLVLLEGSLELIEENLSK

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
148 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
156 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
157 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
158 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
159 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
160 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
181 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
198 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
203 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
204 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
205 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
206 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
207 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
210 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
211 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
212 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
213 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
259 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
278 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
279 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
305 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
306 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
307 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
308 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
309 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
310 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
318 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
319 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
320 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
321 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
322 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
323 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
324 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
325 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
326 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
327 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
328 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
329 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
330 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
331 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
332 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
364 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
365 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
366 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
367 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
368 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
369 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
370 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
371 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
372 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
373 2738541283 Pedobacter sp. OK701 Isolate Unclassified
374 2738541284 Pedobacter sp. YR016 Isolate Unclassified
375 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
376 2738541302 Pedobacter sp. CF074 Isolate Unclassified
377 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
378 2738543023 Pedobacter sp. OK628 Isolate Unclassified
379 2739367651 Pedobacter sp. OK291 Isolate Unclassified
380 2739367656 Pedobacter sp. CF523 Isolate Unclassified
381 2739367663 Pedobacter sp. YR510 Isolate Unclassified
382 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
383 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
384 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
385 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
386 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
387 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
388 2818991437 Pedobacter terrae 518 Isolate Unclassified
389 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
390 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
391 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
392 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
393 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
394 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
395 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
396 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
397 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
398 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
399 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
400 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
401 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
402 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
403 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
404 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
405 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
406 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
407 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
408 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
409 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
410 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
411 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
412 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
413 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
414 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
415 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
416 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
417 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
418 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
419 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
420 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
421 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
422 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
423 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
424 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
425 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
426 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
427 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
428 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
429 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
430 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
431 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
432 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
433 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
434 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
435 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
436 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
437 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
438 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
439 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.52
Metatranscriptomes 21.59
Isolates 8.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.93
Nodule 0.69
Rhizoplane 1.73
Rhizosphere 80.6
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0021047 3300048924 Bacteria 6413
2 SwRhRL2b_contig_843371 2162886007 Bacteria 4093
3 MBSR1b_contig_5999882 2162886012 Bacteria 1227
4 MBSR1b_contig_7444599 2162886012 Bacteria 1166
5 2214795200 2209111006 Bacteria 2169
6 JGI24736J21556_1003806 3300001904 Bacteria 2603
7 JGI24736J21556_1005830 3300001904 Bacteria 2081
8 JGI24740J21852_10029442 3300001979 Bacteria 1802
9 JGI24737J22298_10001354 3300001990 Bacteria 8678
10 JGI24737J22298_10027740 3300001990 Bacteria 1783
11 JGI24737J22298_10051996 3300001990 Bacteria 1243
12 JGI24735J21928_10000003 3300002067 Bacteria 385983
13 JGI24744J21845_10006419 3300002077 Bacteria 2439
14 JGI25162J39368_1000039 3300002737 Bacteria 175976
15 JGI25162J39368_1001033 3300002737 Bacteria 17196
16 JGI25157J39369_1004746 3300002741 Bacteria 2373
17 JGI25164J39214_1001908 3300002772 Bacteria 3854
18 JGI25150J39212_1000005 3300002774 Bacteria 311800
19 JGI25151J46595_10000004 3300003187 Bacteria 494006
20 JGI25165J46597_1000678 3300003214 Bacteria 27401
21 JGI25153J46596_10000004 3300003215 Bacteria 494006
22 rootL2_10134610 3300003322 Bacteria 2534
23 rootL2_10192172 3300003322 Bacteria 1251
24 Ga0006562J51391_1003423 3300003578 Bacteria 13910
25 Ga0055536_1000004 3300003781 Bacteria 411108
26 Ga0055530_10000817 3300003791 Bacteria 25836
27 Ga0058861_10035234 3300004800 Bacteria 8090
28 Ga0058861_10042758 3300004800 Bacteria 1644
29 Ga0058860_10114316 3300004801 Bacteria 13584
30 Ga0058862_10235727 3300004803 Bacteria 2709
31 Ga0065165_1000131 3300005262 Bacteria 128880
32 Ga0065716_1001930 3300005277 Bacteria 2728
33 Ga0065714_10011870 3300005288 Bacteria 3180
34 Ga0065714_10138350 3300005288 Bacteria 1189
35 Ga0065714_10142020 3300005288 Bacteria 1164
36 Ga0065714_10159857 3300005288 Bacteria 1057
37 Ga0065714_10175046 3300005288 Bacteria 987
38 Ga0065704_10002526 3300005289 Bacteria 5249
39 Ga0065704_10455585 3300005289 Bacteria 696
40 Ga0065715_10028707 3300005293 Bacteria 1145
41 Ga0065715_10171526 3300005293 Bacteria 1539
42 Ga0065715_10372960 3300005293 Bacteria 918
43 Ga0070658_10000153 3300005327 Bacteria 60625
44 Ga0070658_10059750 3300005327 Bacteria 3104
45 Ga0070658_10128365 3300005327 Bacteria 2112
46 Ga0070676_10000312 3300005328 Bacteria 21945
47 Ga0070680_100022246 3300005336 Bacteria 5046
48 Ga0070682_100020081 3300005337 Bacteria 3927
49 Ga0068868_100113365 3300005338 Bacteria 2204
50 Ga0070660_100007068 3300005339 Bacteria 7799
51 Ga0070660_100461031 3300005339 Bacteria 1055
52 Ga0070691_10260187 3300005341 Bacteria 934
53 Ga0070661_100224104 3300005344 Bacteria 1443
54 Ga0070673_100014202 3300005364 Bacteria 5536
55 Ga0070659_100000375 3300005366 Bacteria 33764
56 Ga0070659_100008718 3300005366 Bacteria 7421
57 Ga0070659_100139989 3300005366 Bacteria 1970
58 Ga0070678_100001208 3300005456 Bacteria 13700
59 Ga0070662_100078309 3300005457 Bacteria 2455
60 Ga0068867_100001333 3300005459 Bacteria 17102
61 Ga0074259_10342770 3300005507 Bacteria 911
62 Ga0070679_100018790 3300005530 Bacteria 6710
63 Ga0070679_100356217 3300005530 Bacteria 1411
64 Ga0068853_100081417 3300005539 Bacteria 2835
65 Ga0070665_100000372 3300005548 Bacteria 66748
66 Ga0068855_100000360 3300005563 Bacteria 56448
67 Ga0068855_100022110 3300005563 Bacteria 7621
68 Ga0068855_100044845 3300005563 Bacteria 5231
69 Ga0068855_100062080 3300005563 Bacteria 4364
70 Ga0068855_100076304 3300005563 Bacteria 3891
71 Ga0068855_100311184 3300005563 Bacteria 1742
72 Ga0068854_100068418 3300005578 Bacteria 2589
73 Ga0068854_100485699 3300005578 Bacteria 1038
74 Ga0068854_100514675 3300005578 Bacteria 1010
75 Ga0068856_100001358 3300005614 Bacteria 25722
76 Ga0068856_100003057 3300005614 Bacteria 17112
77 Ga0068856_100213973 3300005614 Bacteria 1943
78 Ga0068852_100102354 3300005616 Bacteria 2588
79 Ga0068851_10336054 3300005834 Bacteria 876
80 Ga0068858_100277706 3300005842 Bacteria 1595
81 Ga0075369_10150223 3300006186 Bacteria 1065
82 Ga0075366_10000284 3300006195 Bacteria 22680
83 Ga0075366_10061582 3300006195 Bacteria 2230
84 Ga0075366_10063577 3300006195 Bacteria 2194
85 Ga0075366_10109024 3300006195 Bacteria 1665
86 Ga0075366_10131929 3300006195 Bacteria 1508
87 Ga0097621_100001155 3300006237 Bacteria 18347
88 Ga0097621_100174543 3300006237 Bacteria 1854
89 Ga0075370_10077067 3300006353 Bacteria 1913
90 Ga0075370_10149573 3300006353 Bacteria 1368
91 Ga0068871_100000141 3300006358 Bacteria 46656
92 Ga0075428_100002939 3300006844 Bacteria 18582
93 Ga0075431_100013874 3300006847 Bacteria 8137
94 Ga0068865_100000847 3300006881 Bacteria 17301
95 Ga0099824_1001317 3300006942 Bacteria 34468
96 Ga0079104_1000280 3300006946 Bacteria 65859
97 Ga0099826_10000125 3300006948 Bacteria 34471
98 Ga0105251_10065349 3300009011 Bacteria 1702
99 Ga0105244_10013135 3300009036 Bacteria 4853
100 Ga0105244_10016324 3300009036 Bacteria 4232
101 Ga0105250_10022606 3300009092 Bacteria 2535
102 Ga0105240_10082195 3300009093 Bacteria 3956
103 Ga0105240_10088645 3300009093 Bacteria 3785
104 Ga0105240_10224920 3300009093 Bacteria 2184
105 Ga0105240_10248022 3300009093 Bacteria 2061
106 Ga0105240_10305476 3300009093 Bacteria 1819
107 Ga0105240_10477974 3300009093 Bacteria 1390
108 Ga0111539_10132623 3300009094 Bacteria 2917
109 Ga0105243_10000009 3300009148 Bacteria 354419
110 Ga0105241_10005560 3300009174 Bacteria 9308
111 Ga0105241_10071231 3300009174 Bacteria 2698
112 Ga0105241_10180449 3300009174 Bacteria 1751
113 Ga0105241_10313131 3300009174 Bacteria 1351
114 Ga0105242_10255950 3300009176 Bacteria 1579
115 Ga0105242_10270364 3300009176 Bacteria 1539
116 Ga0105237_10002553 3300009545 Bacteria 22488
117 Ga0105237_10006561 3300009545 Bacteria 12869
118 Ga0105237_10009296 3300009545 Bacteria 10532
119 Ga0105237_10022954 3300009545 Bacteria 6399
120 Ga0105237_10087034 3300009545 Bacteria 3114
121 Ga0105237_10136819 3300009545 Bacteria 2444
122 Ga0105237_10425982 3300009545 Bacteria 1333
123 Ga0105238_10426380 3300009551 Bacteria 1321
124 Ga0105238_10497127 3300009551 Bacteria 1220
125 Ga0105249_10936121 3300009553 Bacteria 934
126 Ga0105239_10000011 3300010375 Bacteria 337500
127 Ga0105239_10004149 3300010375 Bacteria 17397
128 Ga0105239_10167733 3300010375 Bacteria 2455
129 Ga0105239_10246419 3300010375 Bacteria 2006
130 Ga0105239_10263368 3300010375 Bacteria 1938
131 Ga0105239_10310528 3300010375 Bacteria 1777
132 Ga0157327_1000641 3300012512 Bacteria 1943
133 Ga0157373_10000129 3300013100 Bacteria 59252
134 Ga0157373_10001369 3300013100 Bacteria 18710
135 Ga0157373_10008448 3300013100 Bacteria 7646
136 Ga0157373_10014264 3300013100 Bacteria 5829
137 Ga0157373_10209759 3300013100 Bacteria 1374
138 Ga0157373_10381251 3300013100 Bacteria 1009
139 Ga0157371_10001664 3300013102 Bacteria 22687
140 Ga0157371_10001678 3300013102 Bacteria 22612
141 Ga0157371_10003367 3300013102 Bacteria 14536
142 Ga0157371_10005650 3300013102 Bacteria 10499
143 Ga0157371_10010104 3300013102 Bacteria 7378
144 Ga0157371_10027271 3300013102 Bacteria 4144
145 Ga0157371_10151899 3300013102 Bacteria 1652
146 Ga0157371_10243292 3300013102 Bacteria 1294
147 Ga0157371_10340733 3300013102 Bacteria 1090
148 Ga0157371_10703507 3300013102 Bacteria 757
149 Ga0157370_10000084 3300013104 Bacteria 104159
150 Ga0157370_10025354 3300013104 Bacteria 5869
151 Ga0157370_10047165 3300013104 Bacteria 4130
152 Ga0157370_10066433 3300013104 Bacteria 3411
153 Ga0157370_10128866 3300013104 Bacteria 2361
154 Ga0157370_10571440 3300013104 Bacteria 1036
155 Ga0157370_10702011 3300013104 Bacteria 923
156 Ga0157370_10881069 3300013104 Bacteria 813
157 Ga0157369_10000023 3300013105 Bacteria 226955
158 Ga0157369_10000613 3300013105 Bacteria 46357
159 Ga0157369_10004050 3300013105 Bacteria 17366
160 Ga0157369_10007412 3300013105 Bacteria 12631
161 Ga0157369_10011350 3300013105 Bacteria 10117
162 Ga0157369_10117957 3300013105 Bacteria 2817
163 Ga0157369_10304404 3300013105 Bacteria 1658
164 Ga0157374_10027177 3300013296 Bacteria 5158
165 Ga0157374_10075051 3300013296 Bacteria 3195
166 Ga0157374_10173144 3300013296 Bacteria 2106
167 Ga0157374_10306162 3300013296 Bacteria 1573
168 Ga0157378_10041061 3300013297 Bacteria 4104
169 Ga0157378_10217408 3300013297 Bacteria 1815
170 Ga0163162_10001202 3300013306 Bacteria 24155
171 Ga0163162_10002182 3300013306 Bacteria 18354
172 Ga0163162_10045451 3300013306 Bacteria 4399
173 Ga0163162_10049288 3300013306 Bacteria 4221
174 Ga0163162_10675970 3300013306 Bacteria 1155
175 Ga0157372_10000030 3300013307 Bacteria 179925
176 Ga0157372_10003430 3300013307 Bacteria 17111
177 Ga0157372_10028159 3300013307 Bacteria 6130
178 Ga0157372_10052694 3300013307 Bacteria 4532
179 Ga0157372_10529291 3300013307 Bacteria 1374
180 Ga0157372_10688494 3300013307 Bacteria 1190
181 Ga0157375_10092834 3300013308 Bacteria 3083
182 Ga0157375_10101632 3300013308 Bacteria 2958
183 Ga0157375_10128521 3300013308 Bacteria 2652
184 Ga0157375_10180919 3300013308 Bacteria 2259
185 Ga0157375_10272709 3300013308 Bacteria 1854
186 Ga0157375_10548517 3300013308 Bacteria 1318
187 Ga0182008_10000002 3300014497 Bacteria 480216
188 Ga0182008_10000600 3300014497 Bacteria 26471
189 Ga0182008_10005586 3300014497 Bacteria 7133
190 Ga0182008_10100876 3300014497 Bacteria 1427
191 Ga0182008_10181679 3300014497 Bacteria 1065
192 Ga0157376_10652013 3300014969 Bacteria 1053
193 Ga0157376_10674772 3300014969 Bacteria 1036
194 Ga0182006_1000806 3300015261 Bacteria 21001
195 Ga0182006_1024244 3300015261 Bacteria 2503
196 Ga0182006_1038054 3300015261 Bacteria 1904
197 Ga0182006_1046863 3300015261 Bacteria 1678
198 Ga0182006_1074207 3300015261 Bacteria 1254
199 Ga0182006_1083714 3300015261 Bacteria 1160
200 Ga0182007_10000002 3300015262 Bacteria 564661
201 Ga0183373_1004 3300015682 Bacteria 537398
202 Ga0163161_10000039 3300017792 Bacteria 148130
203 Ga0163161_10002163 3300017792 Bacteria 14176
204 Ga0163161_10026555 3300017792 Bacteria 4101
205 Ga0163161_10276877 3300017792 Bacteria 1315
206 Ga0163161_10861360 3300017792 Bacteria 765
207 Ga0197907_10169535 3300020069 Bacteria 2472
208 Ga0197907_10475699 3300020069 Bacteria 1783
209 Ga0197907_10569442 3300020069 Bacteria 882
210 Ga0197907_11336279 3300020069 Bacteria 1564
211 Ga0206349_1139351 3300020075 Bacteria 1786
212 Ga0206351_10170033 3300020077 Bacteria 10900
213 Ga0206351_10267476 3300020077 Bacteria 15418
214 Ga0206351_10512829 3300020077 Bacteria 15076
215 Ga0206352_10132532 3300020078 Bacteria 2711
216 Ga0206352_10703535 3300020078 Bacteria 2663
217 Ga0206352_10881571 3300020078 Bacteria 888
218 Ga0206352_11011592 3300020078 Bacteria 2706
219 Ga0206352_11227474 3300020078 Bacteria 1410
220 Ga0206350_10057460 3300020080 Bacteria 6432
221 Ga0206350_10209494 3300020080 Bacteria 5121
222 Ga0206350_10752456 3300020080 Bacteria 3060
223 Ga0206354_11040595 3300020081 Bacteria 2110
224 Ga0206354_11302053 3300020081 Bacteria 1547
225 Ga0206354_11338799 3300020081 Bacteria 1480
226 Ga0206353_10666179 3300020082 Bacteria 1592
227 Ga0206353_11248305 3300020082 Bacteria 1644
228 Ga0154015_1221621 3300020610 Bacteria 1743
229 Ga0154015_1252602 3300020610 Bacteria 1573
230 Ga0154015_1495562 3300020610 Bacteria 11881
231 Ga0213872_10013117 3300021361 Bacteria 3885
232 Ga0224712_10003182 3300022467 Bacteria 4212
233 Ga0224712_10003582 3300022467 Bacteria 4061
234 Ga0224712_10014571 3300022467 Bacteria 2536
235 Ga0224712_10054231 3300022467 Bacteria 1573
236 Ga0207427_100025 3300025231 Bacteria 433726
237 Ga0209437_100010 3300025233 Bacteria 838447
238 Ga0209437_100135 3300025233 Bacteria 176455
239 Ga0207425_1000008 3300025245 Bacteria 618024
240 Ga0209026_1000610 3300025250 Bacteria 22917
241 Ga0209026_1004981 3300025250 Bacteria 3723
242 Ga0209026_1013858 3300025250 Bacteria 1360
243 Ga0209129_1000040 3300025258 Bacteria 313043
244 Ga0209129_1004506 3300025258 Bacteria 5402
245 Ga0209233_1000017 3300025261 Bacteria 898076
246 Ga0209233_1001329 3300025261 Bacteria 9868
247 Ga0209233_1012915 3300025261 Bacteria 2404
248 Ga0209455_1001523 3300025272 Bacteria 10351
249 Ga0209455_1016348 3300025272 Bacteria 1596
250 Ga0209676_1000009 3300025292 Bacteria 981719
251 Ga0209676_1000332 3300025292 Bacteria 90798
252 Ga0209025_1000020 3300025294 Bacteria 618024
253 Ga0209758_1000022 3300025297 Bacteria 618024
254 Ga0209050_1000048 3300025298 Bacteria 371553
255 Ga0209051_1045041 3300025303 Bacteria 1531
256 Ga0207656_10000055 3300025321 Bacteria 44377
257 Ga0207655_1000038 3300025728 Bacteria 348340
258 Ga0207647_10000171 3300025904 Bacteria 51875
259 Ga0207647_10008184 3300025904 Bacteria 7513
260 Ga0207647_10051967 3300025904 Bacteria 2530
261 Ga0207645_10000035 3300025907 Bacteria 89345
262 Ga0207705_10000108 3300025909 Bacteria 93501
263 Ga0207705_10018682 3300025909 Bacteria 4959
264 Ga0207654_10134366 3300025911 Bacteria 1570
265 Ga0207654_10315243 3300025911 Bacteria 1067
266 Ga0207707_10031720 3300025912 Bacteria 4625
267 Ga0207695_10000053 3300025913 Bacteria 396740
268 Ga0207695_10034063 3300025913 Bacteria 5546
269 Ga0207695_10081967 3300025913 Bacteria 3263
270 Ga0207695_10257744 3300025913 Bacteria 1642
271 Ga0207695_10307059 3300025913 Bacteria 1477
272 Ga0207695_10358582 3300025913 Bacteria 1345
273 Ga0207671_10005707 3300025914 Bacteria 11360
274 Ga0207671_10010466 3300025914 Bacteria 7650
275 Ga0207671_10016438 3300025914 Bacteria 5749
276 Ga0207671_10033281 3300025914 Bacteria 3835
277 Ga0207671_10069197 3300025914 Bacteria 2631
278 Ga0207671_10201662 3300025914 Bacteria 1554
279 Ga0207671_10277341 3300025914 Bacteria 1322
280 Ga0207660_10078474 3300025917 Bacteria 2420
281 Ga0207657_10099275 3300025919 Bacteria 2418
282 Ga0207657_10226921 3300025919 Bacteria 1495
283 Ga0207657_10396066 3300025919 Bacteria 1086
284 Ga0207649_10101788 3300025920 Bacteria 1903
285 Ga0207652_10191483 3300025921 Bacteria 1840
286 Ga0207652_10476868 3300025921 Bacteria 1124
287 Ga0207694_10149527 3300025924 Bacteria 1881
288 Ga0207644_10023288 3300025931 Bacteria 4240
289 Ga0207690_10002170 3300025932 Bacteria 11970
290 Ga0207690_10012751 3300025932 Bacteria 5037
291 Ga0207690_10148683 3300025932 Bacteria 1735
292 Ga0207706_10001112 3300025933 Bacteria 27374
293 Ga0207709_10000026 3300025935 Bacteria 354467
294 Ga0207709_10618837 3300025935 Bacteria 859
295 Ga0207704_10000036 3300025938 Bacteria 94574
296 Ga0207665_10009076 3300025939 Bacteria 6528
297 Ga0207689_10103891 3300025942 Bacteria 2334
298 Ga0207667_10000430 3300025949 Bacteria 56466
299 Ga0207667_10059200 3300025949 Bacteria 4013
300 Ga0207667_10095966 3300025949 Bacteria 3060
301 Ga0207667_10106089 3300025949 Bacteria 2898
302 Ga0207651_10045387 3300025960 Bacteria 2947
303 Ga0207640_10025047 3300025981 Bacteria 3607
304 Ga0207640_10536418 3300025981 Bacteria 981
305 Ga0207640_10627028 3300025981 Bacteria 913
306 Ga0207677_10035766 3300026023 Bacteria 3229
307 Ga0207677_11228361 3300026023 Bacteria 687
308 Ga0207703_10039505 3300026035 Bacteria 3772
309 Ga0207639_11103371 3300026041 Bacteria 744
310 Ga0207678_10092160 3300026067 Bacteria 2590
311 Ga0207678_10969712 3300026067 Bacteria 752
312 Ga0207708_10180891 3300026075 Bacteria 1674
313 Ga0207702_10001407 3300026078 Bacteria 24021
314 Ga0207702_10145971 3300026078 Bacteria 2147
315 Ga0207702_10509260 3300026078 Bacteria 1174
316 Ga0207702_10711405 3300026078 Bacteria 990
317 Ga0207648_10000333 3300026089 Bacteria 51656
318 Ga0207674_10111233 3300026116 Bacteria 2713
319 Ga0207683_10000982 3300026121 Bacteria 26175
320 Ga0207683_10303287 3300026121 Bacteria 1461
321 Ga0209281_1000337 3300027111 Bacteria 79938
322 Ga0209489_108316 3300027361 Bacteria 14321
323 Ga0210002_1001494 3300027617 Bacteria 3313
324 Ga0209282_1121056 3300027666 Bacteria 1309
325 Ga0209974_10009384 3300027876 Bacteria 3320
326 Ga0268266_10000658 3300028379 Bacteria 46741
327 Ga0307517_10004407 3300028786 Bacteria 21615
328 Ga0307515_10003374 3300028794 Bacteria 33668
329 Ga0307515_10087594 3300028794 Bacteria 3949
330 Ga0307515_10095909 3300028794 Bacteria 3644
331 Ga0265324_10059460 3300029957 Bacteria 1307
332 Ga0316177_1079276 3300030731 Bacteria 6692
333 Ga0316177_1101446 3300030731 Bacteria 1033
334 Ga0316176_1220529 3300030732 Bacteria 11720
335 Ga0316179_1073340 3300030734 Bacteria 907
336 Ga0316183_1116825 3300030742 Bacteria 56435
337 Ga0316181_1163475 3300030744 Bacteria 9442
338 Ga0316181_1219863 3300030744 Bacteria 1108
339 Ga0316181_1278947 3300030744 Bacteria 3255
340 Ga0316182_1040405 3300030745 Bacteria 2152
341 Ga0265339_10023927 3300031249 Bacteria 3525
342 Ga0265327_10019440 3300031251 Bacteria 4175
343 Ga0265327_10058350 3300031251 Bacteria 1981
344 Ga0265327_10083179 3300031251 Bacteria 1576
345 Ga0265316_10118417 3300031344 Bacteria 2001
346 Ga0265316_10134258 3300031344 Bacteria 1862
347 Ga0265316_10301634 3300031344 Bacteria 1167
348 Ga0307509_10083314 3300031507 Bacteria 3297
349 Ga0307408_100001588 3300031548 Bacteria 16776
350 Ga0307408_100008863 3300031548 Bacteria 6645
351 Ga0307408_100013046 3300031548 Bacteria 5512
352 Ga0307408_100398258 3300031548 Bacteria 1181
353 Ga0307508_10475102 3300031616 Bacteria 844
354 Ga0265314_10152306 3300031711 Bacteria 1416
355 Ga0316576_10038611 3300031727 Bacteria 3425
356 Ga0316576_10080879 3300031727 Bacteria 2410
357 Ga0316576_10484112 3300031727 Bacteria 911
358 Ga0316578_10138424 3300031728 Unclassified 1466
359 Ga0316578_10178967 3300031728 Bacteria 1278
360 Ga0307405_10000005 3300031731 Bacteria 376536
361 Ga0307405_10000006 3300031731 Bacteria 361477
362 Ga0307405_10002019 3300031731 Bacteria 8799
363 Ga0307405_10004590 3300031731 Bacteria 6553
364 Ga0307413_10025892 3300031824 Bacteria 3224
365 Ga0307413_10098948 3300031824 Bacteria 1922
366 Ga0307413_10117547 3300031824 Bacteria 1793
367 Ga0307413_10142076 3300031824 Bacteria 1660
368 Ga0307410_10000034 3300031852 Bacteria 48449
369 Ga0307406_10000004 3300031901 Bacteria 179772
370 Ga0307406_10106047 3300031901 Bacteria 1924
371 Ga0307406_10124631 3300031901 Bacteria 1798
372 Ga0307407_10000003 3300031903 Bacteria 271723
373 Ga0307407_10000196 3300031903 Bacteria 18233
374 Ga0307412_10000085 3300031911 Bacteria 88692
375 Ga0307412_10002740 3300031911 Bacteria 9804
376 Ga0307412_10031955 3300031911 Bacteria 3329
377 Ga0307412_10168924 3300031911 Bacteria 1633
378 Ga0307412_10171970 3300031911 Bacteria 1621
379 Ga0307412_10509537 3300031911 Bacteria 1003
380 Ga0307409_100017984 3300031995 Bacteria 4732
381 Ga0307416_100000002 3300032002 Bacteria 509907
382 Ga0307416_100017337 3300032002 Bacteria 5035
383 Ga0307416_100456519 3300032002 Bacteria 1332
384 Ga0307414_10000011 3300032004 Bacteria 338253
385 Ga0307414_10002003 3300032004 Bacteria 10572
386 Ga0307414_10003085 3300032004 Bacteria 8845
387 Ga0307414_10005145 3300032004 Bacteria 7174
388 Ga0307414_10005613 3300032004 Bacteria 6919
389 Ga0307414_10023616 3300032004 Bacteria 3903
390 Ga0307414_10024602 3300032004 Bacteria 3843
391 Ga0307414_10042461 3300032004 Bacteria 3090
392 Ga0307414_10046410 3300032004 Bacteria 2982
393 Ga0307414_10191471 3300032004 Bacteria 1655
394 Ga0307414_10473817 3300032004 Bacteria 1103
395 Ga0307411_10020538 3300032005 Bacteria 3844
396 Ga0307411_10037313 3300032005 Bacteria 3055
397 Ga0307411_10953092 3300032005 Bacteria 765
398 Ga0307411_11045559 3300032005 Bacteria 733
399 Ga0316585_10087685 3300032137 Bacteria 1016
400 Ga0316593_10000712 3300032168 Bacteria 6519
401 Ga0316593_10000765 3300032168 Bacteria 6363
402 Ga0316593_10006916 3300032168 Bacteria 3088
403 Ga0316593_10044248 3300032168 Unclassified 1489
404 Ga0316593_10078340 3300032168 Bacteria 1150
405 Ga0307507_10000034 3300033179 Bacteria 188697
406 Ga0307510_10000366 3300033180 Bacteria 42784
407 Ga0307510_10016223 3300033180 Bacteria 8798
408 Ga0316592_1000131 3300033524 Bacteria 8112
409 Ga0316592_1000317 3300033524 Bacteria 6265
410 Ga0316592_1003234 3300033524 Bacteria 2911
411 Ga0316592_1018606 3300033524 Bacteria 1464
412 Ga0316586_1006863 3300033527 Bacteria 1646
413 Ga0316588_1000295 3300033528 Bacteria 6202
414 Ga0316588_1000569 3300033528 Bacteria 5197
415 Ga0316588_1021693 3300033528 Bacteria 1463
416 Ga0316596_1000106 3300033541 Bacteria 10634
417 Ga0316596_1001355 3300033541 Bacteria 4892
418 Ga0316596_1003296 3300033541 Bacteria 3521
419 Ga0316596_1003798 3300033541 Bacteria 3341
420 Ga0316596_1005405 3300033541 Bacteria 2916
421 Ga0316596_1006124 3300033541 Bacteria 2784
422 Ga0316596_1006577 3300033541 Bacteria 2709
423 Ga0316596_1012909 3300033541 Bacteria 2059
424 Ga0316596_1013528 3300033541 Unclassified 2016
425 Ga0316596_1015077 3300033541 Bacteria 1923
426 Ga0316596_1058977 3300033541 Bacteria 1022
427 Ga0316574_0036503 3300035398 Bacteria 3009
428 Ga0316574_0135095 3300035398 Bacteria 1588
429 Ga0316574_0139663 3300035398 Bacteria 1561
430 Ga0316574_0231337 3300035398 Bacteria 1183
431 Ga0316582_0014602 3300036647 Bacteria 4464
432 Ga0316584_0002885 3300036712 Bacteria 11029
433 Ga0316584_0012713 3300036712 Bacteria 5941
434 Ga0316584_0437324 3300036712 Bacteria 927
435 Ga0395899_0000034 3300037312 Bacteria 302623
436 Ga0395899_0001602 3300037312 Bacteria 18978
437 Ga0395899_0006152 3300037312 Bacteria 9303
438 Ga0395899_0245454 3300037312 Bacteria 1230
439 Ga0395900_0000346 3300037418 Bacteria 68020
440 Ga0395900_0001482 3300037418 Bacteria 28015
441 Ga0395900_0006693 3300037418 Bacteria 11974
442 Ga0395898_0034336 3300037466 Bacteria 5056
443 Ga0395905_0000528 3300037471 Bacteria 52404
444 Ga0395905_0204363 3300037471 Bacteria 1852
445 Ga0316581_0070678 3300037588 Bacteria 1072
446 Ga0395901_0000351 3300038443 Bacteria 56004
447 Ga0395901_0135999 3300038443 Bacteria 2583
448 Ga0395901_0252291 3300038443 Bacteria 1838
449 Ga0395901_0973011 3300038443 Bacteria 826
450 Ga0400483_035362 3300039062 Bacteria 41412
451 Ga0400483_066194 3300039062 Bacteria 1221
452 Ga0400483_219275 3300039062 Bacteria 32517
453 Ga0400489_13883 3300039093 Bacteria 1862
454 Ga0400489_16361 3300039093 Bacteria 1700
455 Ga0400489_47982 3300039093 Bacteria 6330
456 Ga0436361_0986181 3300039447 Bacteria 4054
457 Ga0439447_000447 3300041407 Bacteria 15369
458 Ga0439466_0000296 3300041411 Bacteria 19213
459 Ga0451787_595883 3300041441 Bacteria 2022
460 Ga0451790_27126 3300041444 Bacteria 781
461 Ga0451794_19467 3300041446 Bacteria 1641
462 Ga0451794_35864 3300041446 Bacteria 1384
463 Ga0451795_0585944 3300041456 Bacteria 1512
464 Ga0451795_0658726 3300041456 Bacteria 1241
465 Ga0451795_0714771 3300041456 Bacteria 1088
466 Ga0451795_0947176 3300041456 Bacteria 2993
467 Ga0451795_1413283 3300041456 Bacteria 1155
468 Ga0451805_101447 3300041461 Bacteria 765
469 Ga0451804_0523259 3300041463 Bacteria 909
470 Ga0451807_0581933 3300041486 Bacteria 1559
471 Ga0451837_0265238 3300041494 Bacteria 4284
472 Ga0451837_1117378 3300041494 Bacteria 1483
473 Ga0451837_1389540 3300041494 Bacteria 873
474 Ga0451837_1469134 3300041494 Bacteria 1012
475 Ga0451837_1714034 3300041494 Bacteria 863
476 Ga0451841_0263914 3300041498 Bacteria 1450
477 Ga0451855_0308427 3300041511 Bacteria 2484
478 Ga0452268_01081 3300041907 Bacteria 1368
479 Ga0439452_065776 3300042010 Bacteria 805
480 Ga0439446_0033029 3300042156 Bacteria 1503
481 Ga0451577_0000565 3300042876 Bacteria 60301
482 Ga0451577_0002272 3300042876 Bacteria 23243
483 Ga0451577_0014494 3300042876 Bacteria 7348
484 Ga0451577_0030583 3300042876 Bacteria 4865
485 Ga0451577_0048590 3300042876 Bacteria 3790
486 Ga0451577_0053903 3300042876 Bacteria 3590
487 Ga0451577_0097425 3300042876 Bacteria 2627
488 Ga0451577_0133538 3300042876 Bacteria 2228
489 Ga0451577_0140717 3300042876 Bacteria 2168
490 Ga0451577_0308820 3300042876 Bacteria 1433
491 Ga0451577_0542881 3300042876 Unclassified 1055
492 Ga0451577_0660445 3300042876 Bacteria 948
493 Ga0451577_0749887 3300042876 Bacteria 883
494 Ga0466969_0035704 3300044656 Bacteria 2514
495 Ga0453683_0000055 3300044673 Bacteria 192588
496 Ga0453683_0005759 3300044673 Bacteria 8592
497 Ga0453683_0012099 3300044673 Bacteria 5665
498 Ga0453683_0014332 3300044673 Bacteria 5150
499 Ga0453683_0064012 3300044673 Bacteria 2298
500 Ga0453683_0287748 3300044673 Bacteria 1050
501 Ga0466966_0001476 3300044684 Bacteria 15131
502 Ga0466961_0045113 3300044693 Bacteria 2821
503 Ga0453684_0000440 3300044712 Bacteria 169397
504 Ga0453684_0012213 3300044712 Bacteria 14230
505 Ga0453684_0013573 3300044712 Bacteria 13209
506 Ga0453684_0014334 3300044712 Bacteria 12695
507 Ga0453684_0018583 3300044712 Bacteria 10656
508 Ga0453684_0023556 3300044712 Bacteria 9055
509 Ga0453684_0033676 3300044712 Bacteria 7134
510 Ga0453684_0040849 3300044712 Bacteria 6288
511 Ga0453684_0058446 3300044712 Bacteria 4981
512 Ga0453684_0059704 3300044712 Bacteria 4914
513 Ga0453684_0063984 3300044712 Bacteria 4701
514 Ga0453684_0074277 3300044712 Bacteria 4282
515 Ga0453684_0108960 3300044712 Bacteria 3370
516 Ga0453684_0117351 3300044712 Bacteria 3221
517 Ga0453684_0133671 3300044712 Bacteria 2973
518 Ga0453684_0160195 3300044712 Bacteria 2662
519 Ga0453684_0174401 3300044712 Bacteria 2531
520 Ga0453684_0312190 3300044712 Bacteria 1783
521 Ga0453684_0658937 3300044712 Bacteria 1141
522 Ga0453684_0737740 3300044712 Bacteria 1067
523 Ga0453684_1106265 3300044712 Bacteria 837
524 Ga0466959_0127914 3300045049 Bacteria 1802
525 Ga0466959_0145372 3300045049 Bacteria 1673
526 Ga0451576_0011813 3300045051 Bacteria 9886
527 Ga0451576_0019276 3300045051 Bacteria 7448
528 Ga0451576_0021171 3300045051 Bacteria 7070
529 Ga0451576_0032102 3300045051 Bacteria 5596
530 Ga0451576_0170886 3300045051 Bacteria 2269
531 Ga0451576_0180565 3300045051 Bacteria 2203
532 Ga0451576_0196762 3300045051 Bacteria 2105
533 Ga0451576_0518029 3300045051 Bacteria 1253
534 Ga0451576_0805207 3300045051 Unclassified 986
535 Ga0451576_1543512 3300045051 Bacteria 689
536 Ga0466958_0043675 3300045836 Bacteria 2700
537 Ga0495627_009866 3300046453 Bacteria 3495
538 Ga0495627_017080 3300046453 Bacteria 2473
539 Ga0495592_0186938 3300046454 Bacteria 1407
540 Ga0495592_0191261 3300046454 Bacteria 1387
541 Ga0495592_0279132 3300046454 Bacteria 1093
542 Ga0495629_0070495 3300046459 Bacteria 2439
543 Ga0495651_0068871 3300046462 Bacteria 2697
544 Ga0495650_0000023 3300046471 Bacteria 527763
545 Ga0495650_0077715 3300046471 Bacteria 1287
546 Ga0495585_0000476 3300046492 Bacteria 38316
547 Ga0495585_0001907 3300046492 Bacteria 15677
548 Ga0495596_0046855 3300046500 Bacteria 1697
549 Ga0495607_0019534 3300046501 Bacteria 4302
550 Ga0495607_0080240 3300046501 Bacteria 1795
551 Ga0495606_0018000 3300046507 Bacteria 5315
552 Ga0495606_0021306 3300046507 Bacteria 4749
553 Ga0495606_0024036 3300046507 Bacteria 4403
554 Ga0495606_0036258 3300046507 Bacteria 3361
555 Ga0495606_0082698 3300046507 Bacteria 1992
556 Ga0495606_0139973 3300046507 Bacteria 1430
557 Ga0495606_0155892 3300046507 Bacteria 1336
558 Ga0495610_0001849 3300046512 Bacteria 18351
559 Ga0495610_0033662 3300046512 Bacteria 2646
560 Ga0495610_0069700 3300046512 Bacteria 1645
561 Ga0495616_0004967 3300046513 Bacteria 8301
562 Ga0495616_0018996 3300046513 Bacteria 3757
563 Ga0495616_0025587 3300046513 Bacteria 3151
564 Ga0495618_0102321 3300046514 Bacteria 1834
565 Ga0495628_0056278 3300046516 Bacteria 3097
566 Ga0495631_0004390 3300046518 Bacteria 7515
567 Ga0495631_0065627 3300046518 Bacteria 1571
568 Ga0495631_0140505 3300046518 Bacteria 1037
569 Ga0495632_0104249 3300046519 Bacteria 1335
570 Ga0495643_0000294 3300046522 Bacteria 70329
571 Ga0495644_0001340 3300046523 Bacteria 10069
572 Ga0495648_0021095 3300046524 Bacteria 4522
573 Ga0495652_0157685 3300046529 Bacteria 1765
574 Ga0495654_0120204 3300046530 Bacteria 1190
575 Ga0495609_0022533 3300046538 Bacteria 2900
576 Ga0495609_0027308 3300046538 Bacteria 2609
577 Ga0495633_0000072 3300046558 Bacteria 131197
578 Ga0495668_0000165 3300046616 Bacteria 98016
579 Ga0495625_0000308 3300046660 Bacteria 74661
580 Ga0495625_0001933 3300046660 Bacteria 23424
581 Ga0495625_0052742 3300046660 Bacteria 2911
582 Ga0495625_0068664 3300046660 Bacteria 2491
583 Ga0495661_0065084 3300046665 Bacteria 2148
584 Ga0495661_0068236 3300046665 Bacteria 2086
585 Ga0495658_0076828 3300046683 Bacteria 1952
586 Ga0495669_0053117 3300046684 Bacteria 1822
587 Ga0495670_0022047 3300046691 Bacteria 3145
588 Ga0495671_0014730 3300046692 Bacteria 4203
589 Ga0495649_0000105 3300046694 Bacteria 74750
590 Ga0495589_0058652 3300046794 Bacteria 1893
591 Ga0495600_0366326 3300046809 Bacteria 901
592 Ga0495660_0095929 3300046810 Bacteria 1533
593 Ga0495683_0073794 3300047323 Bacteria 1673
594 Ga0495687_000233 3300047443 Bacteria 77056
595 Ga0495687_002320 3300047443 Bacteria 15506
596 Ga0495679_021070 3300047446 Bacteria 2259
597 Ga0495686_0004780 3300047472 Bacteria 10946
598 Ga0495686_0042525 3300047472 Bacteria 2889
599 Ga0495686_0085031 3300047472 Bacteria 1927
600 Ga0495686_0141318 3300047472 Bacteria 1420
601 Ga0496115_0024423 3300048918 Bacteria 4697
602 Ga0496115_0132966 3300048918 Bacteria 2051
603 Ga0496116_0000024 3300048919 Bacteria 471420
604 Ga0496116_0019557 3300048919 Bacteria 5182
605 Ga0496117_0001863 3300048920 Bacteria 28457
606 Ga0496117_0069081 3300048920 Bacteria 2381
607 Ga0496118_0059955 3300048921 Bacteria 2829
608 Ga0496118_0247906 3300048921 Bacteria 1014
609 Ga0496121_0278258 3300048924 Bacteria 1146
610 Ga0496122_0000862 3300048925 Bacteria 57049
611 Ga0496122_0008592 3300048925 Bacteria 10970
612 Ga0496123_0014741 3300048926 Bacteria 6457
613 Ga0496123_0020092 3300048926 Bacteria 5239
614 Ga0496124_0030778 3300048927 Bacteria 4757
615 Ga0496124_0052574 3300048927 Bacteria 3460
616 Ga0496125_0000018 3300048928 Bacteria 482390
617 Ga0496125_0000031 3300048928 Bacteria 365156
618 Ga0496125_0075544 3300048928 Bacteria 2607
619 Ga0496126_0054321 3300048929 Bacteria 3629
620 Ga0496126_0257403 3300048929 Bacteria 1452
621 Ga0496126_0341725 3300048929 Bacteria 1226
622 Ga0501306_005267 3300049127 Bacteria 1477
623 Ga0501306_008333 3300049127 Bacteria 1262
624 Ga0501308_004010 3300049128 Bacteria 1396
625 Ga0501308_006747 3300049128 Bacteria 1186
626 Ga0501310_000150 3300049130 Bacteria 6818
627 Ga0501310_003033 3300049130 Bacteria 1627
628 Ga0501310_008170 3300049130 Bacteria 1132
629 Ga0501343_000877 3300049132 Bacteria 1916
630 Ga0501304_002216 3300049160 Bacteria 1331
631 Ga0501305_004136 3300049161 Bacteria 1689
632 Ga0501305_005541 3300049161 Bacteria 1535
633 Ga0501307_004533 3300049162 Bacteria 1424
634 Ga0501307_008120 3300049162 Bacteria 1171
635 Ga0501307_024321 3300049162 Bacteria 807
636 Ga0495678_035247 3300049459 Bacteria 2053
637 Ga0495682_0121567 3300049460 Bacteria 935
638 Ga0501311_004878 3300049527 Bacteria 1446
639 Ga0501311_010067 3300049527 Bacteria 1142
640 Ga0501312_004490 3300049528 Bacteria 1649
641 Ga0501312_009664 3300049528 Bacteria 1276
642 Ga0501312_011849 3300049528 Bacteria 1191
643 Ga0501313_006163 3300049529 Bacteria 1291
644 Ga0501314_000001 3300049530 Bacteria 13837
645 Ga0501315_000999 3300049531 Bacteria 2244
646 Ga0501315_001329 3300049531 Bacteria 2082
647 Ga0501315_005735 3300049531 Bacteria 1357
648 Ga0501315_010405 3300049531 Bacteria 1118
649 Ga0501315_029452 3300049531 Bacteria 784
650 Ga0501316_001182 3300049532 Bacteria 2139
651 Ga0501316_001550 3300049532 Bacteria 1974
652 Ga0501316_002961 3300049532 Bacteria 1616
653 Ga0501316_028760 3300049532 Bacteria 735
654 Ga0501317_003554 3300049533 Bacteria 1564
655 Ga0501319_000002 3300049535 Bacteria 13675
656 Ga0501319_000013 3300049535 Bacteria 7475
657 Ga0501319_000490 3300049535 Bacteria 1906
658 Ga0501320_000041 3300049536 Bacteria 6176
659 Ga0501320_002284 3300049536 Bacteria 1519
660 Ga0501320_002566 3300049536 Bacteria 1464
661 Ga0501320_002754 3300049536 Bacteria 1434
662 Ga0501320_031001 3300049536 Bacteria 665
663 Ga0501321_004999 3300049537 Bacteria 1293
664 Ga0501321_005813 3300049537 Bacteria 1233
665 Ga0501322_006477 3300049538 Bacteria 834
666 Ga0501323_000002 3300049539 Bacteria 14311
667 Ga0501323_004149 3300049539 Bacteria 1517
668 Ga0501324_000002 3300049540 Bacteria 14212
669 Ga0501325_000696 3300049541 Bacteria 1754
670 Ga0501326_00132 3300049542 Bacteria 2443
671 Ga0501327_02003 3300049543 Bacteria 1027
672 Ga0501329_00229 3300049545 Bacteria 1722
673 Ga0501331_06766 3300049547 Bacteria 673
674 Ga0501334_00539 3300049550 Bacteria 1771
675 Ga0501336_001246 3300049552 Bacteria 1483
676 Ga0501336_001399 3300049552 Bacteria 1429
677 Ga0501336_002805 3300049552 Bacteria 1143
678 Ga0501337_000596 3300049553 Bacteria 1838
679 Ga0501033_0354029 3300049570 Bacteria 1028
680 Ga0501034_0584223 3300049571 Bacteria 1024
681 Ga0501036_0333055 3300049572 Bacteria 1268
682 Ga0501040_0008839 3300049576 Bacteria 6546
683 Ga0501198_010448 3300049649 Bacteria 1373
684 Ga0501223_009571 3300049663 Bacteria 1960
685 Ga0501238_000015 3300049671 Bacteria 31964
686 Ga0501243_036706 3300049675 Bacteria 850
687 Ga0501241_002627 3300049758 Bacteria 3460
688 Ga0501241_016337 3300049758 Bacteria 1353
689 Ga0501266_000002 3300049763 Bacteria 459947
690 Ga0501280_000239 3300049776 Bacteria 13899
691 Ga0501035_0016384 3300049822 Bacteria 6837
692 nmdc:mga0k408_10405_c1 3300050493 Bacteria 5030
693 nmdc:mga0k408_106601_c1 3300050493 Bacteria 1655
694 nmdc:mga0k408_118905_c1 3300050493 Bacteria 1564
695 nmdc:mga0k408_29434_c2 3300050493 Bacteria 2523
696 nmdc:mga0k408_349_c1 3300050493 Bacteria 23383
697 nmdc:mga07m45_66618_c1 3300050496 Bacteria 2046
698 nmdc:mga0qj67_355077_c1 3300050509 Bacteria 1185
699 nmdc:mga06r32_134479_c1 3300050510 Bacteria 2447
700 nmdc:mga08y16_296671_c1 3300050511 Unclassified 1666
701 Ga0500635_0004581 3300053080 Bacteria 3570
702 Ga0500635_0054334 3300053080 Bacteria 1380
703 Ga0500646_0012285 3300053090 Bacteria 2209
704 Ga0500647_0080076 3300053091 Bacteria 1567
705 Ga0500651_0000078 3300053093 Bacteria 62741
706 Ga0500641_0005780 3300053096 Bacteria 4382
707 Ga0500641_0021869 3300053096 Bacteria 2444
708 Ga0500608_000343 3300053122 Bacteria 18061
709 Ga0500608_004284 3300053122 Bacteria 5495
710 Ga0500618_000005 3300053125 Bacteria 253092
711 Ga0500618_027484 3300053125 Bacteria 1353
712 Ga0500652_061828 3300053131 Bacteria 1543
713 Ga0500658_0000002 3300053134 Bacteria 548440
714 Ga0500564_051411 3300053138 Bacteria 1885
715 Ga0500573_0050747 3300053140 Bacteria 2386
716 Ga0500619_095165 3300053154 Bacteria 1008
717 Ga0500622_0000385 3300053156 Bacteria 42685
718 Ga0500624_000517 3300053157 Bacteria 11167
719 Ga0500584_007381 3300053726 Bacteria 4771
720 Ga0587093_002131 3300059478 Bacteria 1796
721 Ga0587093_014170 3300059478 Bacteria 991
722 Ga0587093_022240 3300059478 Bacteria 858
723 Ga0587066_001886 3300059490 Bacteria 2209
724 Ga0587066_005424 3300059490 Bacteria 1633
725 Ga0587066_007750 3300059490 Bacteria 1468
726 Ga0587066_009357 3300059490 Bacteria 1387
727 Ga0587070_001969 3300059491 Bacteria 2243
728 Ga0587070_004702 3300059491 Bacteria 1744
729 Ga0587070_017317 3300059491 Bacteria 1167
730 Ga0587070_022242 3300059491 Bacteria 1078
731 Ga0587070_034202 3300059491 Bacteria 939
732 Ga0587073_0034124 3300059492 Bacteria 1071
733 Ga0587077_002147 3300059493 Bacteria 2283
734 Ga0587077_004989 3300059493 Bacteria 1784
735 Ga0587077_008642 3300059493 Bacteria 1522
736 Ga0587080_006271 3300059503 Bacteria 1632
737 Ga0587080_029094 3300059503 Bacteria 952
738 Ga0587080_030244 3300059503 Bacteria 939
739 Ga0587082_036007 3300059504 Bacteria 886
740 Ga0587083_0002547 3300059505 Bacteria 2290
741 Ga0587083_0007225 3300059505 Bacteria 1691
742 Ga0587083_0055690 3300059505 Bacteria 876
743 Ga0587085_023962 3300059506 Bacteria 953
744 Ga0587088_008181 3300059508 Bacteria 1471
745 Ga0587088_009558 3300059508 Bacteria 1399
746 Ga0587089_007762 3300059509 Bacteria 1280
747 Ga0587089_014687 3300059509 Bacteria 1026
748 Ga0587090_000050 3300059510 Bacteria 6402
749 Ga0587090_000841 3300059510 Bacteria 2835
750 Ga0587090_019738 3300059510 Bacteria 1042
751 Ga0587091_010786 3300059511 Bacteria 1408
752 Ga0587091_028965 3300059511 Bacteria 1025
753 Ga0587094_001632 3300059513 Bacteria 2167
754 Ga0587094_004559 3300059513 Bacteria 1579
755 Ga0587094_007051 3300059513 Bacteria 1367
756 Ga0587095_002824 3300059514 Bacteria 1193
757 Ga0587106_002077 3300059605 Bacteria 1911
758 Ga0587106_015999 3300059605 Bacteria 1055
759 Ga0587099_005957 3300059622 Bacteria 1113
760 Ga0587101_009496 3300059623 Bacteria 1203
761 Ga0587101_011550 3300059623 Bacteria 1132
762 Ga0587101_035041 3300059623 Bacteria 803
763 Ga0587109_004088 3300059624 Bacteria 1997
764 Ga0587109_022728 3300059624 Bacteria 1132
765 Ga0587109_043512 3300059624 Bacteria 898
766 Ga0587117_007139 3300059627 Bacteria 1271
767 Ga0587117_033686 3300059627 Bacteria 785
768 Ga0587062_000275 3300059639 Bacteria 3263
769 Ga0587062_000422 3300059639 Bacteria 2934
770 Ga0587062_019563 3300059639 Bacteria 946
771 Ga0587062_023173 3300059639 Bacteria 897
772 Ga0587062_028743 3300059639 Bacteria 839
773 Ga0587067_009616 3300059640 Bacteria 1446
774 Ga0587068_008476 3300059641 Bacteria 1491
775 Ga0587068_028315 3300059641 Bacteria 958
776 Ga0587068_032647 3300059641 Bacteria 910
777 Ga0587068_054188 3300059641 Bacteria 758
778 Ga0587069_001223 3300059642 Bacteria 2286
779 Ga0587069_007871 3300059642 Bacteria 1331
780 Ga0587069_013809 3300059642 Bacteria 1116
781 Ga0587069_037550 3300059642 Bacteria 813
782 Ga0587076_004507 3300059645 Bacteria 1743
783 Ga0587076_046295 3300059645 Bacteria 832
784 Ga0587079_006697 3300059647 Bacteria 1691
785 Ga0587102_011361 3300059649 Bacteria 894
786 Ga0587108_000188 3300059653 Bacteria 2808
787 Ga0587061_00120 3300060244 Bacteria 2276
788 Ga0587071_033129 3300060344 Bacteria 1005
789 Ga0587111_0011296 3300060346 Bacteria 1553
790 2513232365 2513020052 Bacteria 5120511
791 2520879529 2519899754 Bacteria 5336938
792 2586210018 2585427687 Bacteria 5544917
793 2599479393 2599185184 Bacteria 6430550
794 2644009190 2643221600 Bacteria 5530138
795 2644373928 2643221667 Bacteria 5627472
796 2644643940 2643221716 Bacteria 4986332
797 2644681835 2643221725 Bacteria 5087956
798 2722726166 2721755487 Bacteria 6357185
799 2738733070 2738541279 Bacteria 6149495
800 2738755688 2738541283 Bacteria 7222293
801 2738762095 2738541284 Bacteria 5199923
802 2738765608 2738541285 Bacteria 6150075
803 2738854390 2738541302 Bacteria 5944758
804 2739214651 2738543007 Bacteria 6149845
805 2739301925 2738543023 Bacteria 6767879
806 2739587942 2739367651 Bacteria 6359826
807 2739614407 2739367656 Bacteria 5152243
808 2739646661 2739367663 Bacteria 5040914
809 2740002833 2739367857 Bacteria 5433684
810 2740007650 2739367858 Bacteria 5432813
811 2740031503 2739367866 Bacteria 4215900
812 2776615279 2775506987 Bacteria 5373360
813 2802655255 2802428842 Bacteria 4926114
814 2817413551 2816332280 Bacteria 5109718
815 2819545818 2818991437 Bacteria 5805520
816 2833640625 2833640130 Bacteria 4858325
817 2839990126 2839989709 Bacteria 3773432
818 2842724289 2842722452 Bacteria 6263924
819 2842908307 2842903701 Bacteria 6986368
820 2842913577 2842909656 Bacteria 6185908
821 2849282611 2849281842 Bacteria 6065644
822 2852625405 2852623160 Bacteria 4376875
823 2852629102 2852627209 Bacteria 5896285
824 2857617046 2857613821 Bacteria 4917088
825 2857619715 2857618242 Bacteria 5635925
826 2857631640 2857627736 Bacteria 5625397
827 2881247571 2881247448 Bacteria 3717788
828 2881364099 2881359912 Bacteria 4935907
829 2884934416 2884933994 Bacteria 4535041
830 2890740674 2890737413 Bacteria 4269751
831 2895504174 2895498888 Bacteria 5283788
832 2896320849 2896317667 Bacteria 4606601
833 2896346858 2896344016 Bacteria 3811746
834 2898716197 2898713307 Bacteria 4110805
835 2902051199 2902048731 Bacteria 4976191
836 2903898658 2903895155 Bacteria 5258610
837 2904422402 2904419702 Bacteria 5166287
838 2904449058 2904445276 Bacteria 5310396
839 2904558492 2904555929 Bacteria 5218588
840 2904782776 2904780799 Bacteria 5840761
841 2911143831 2911138879 Bacteria 5811561
842 2919180386 2919177583 Bacteria 5641607
843 2919189060 2919186247 Bacteria 6244071
844 2919194217 2919191525 Bacteria 5765973
845 2919438006 2919437846 Bacteria 6199444
846 2919511822 2919509842 Bacteria 4104664
847 2919684618 2919683626 Bacteria 5534354
848 2928082297 2928078545 Bacteria 6534839
849 2928149124 2928147474 Bacteria 6512076
850 2929150607 2929150217 Bacteria 5462483
851 2932085009 2932082852 Bacteria 6563563
852 2939666785 2939664404 Bacteria 6364494
853 2945998888 2945997725 Bacteria 6404843
854 2954021331 2954016120 Bacteria 6446024
855 2958462004 2958458903 Bacteria 5301041
856 2958514495 2958512119 Bacteria 4528530
857 2965321919 2965320100 Bacteria 3975600
858 2977235842 2977232053 Bacteria 5485925
859 2977272079 2977268062 Bacteria 5243061
860 3003236842 3003233435 Bacteria 4458031
861 8036739268 8036736890 Bacteria 2944828
862 8054311425 8054307821 Bacteria 5212224
863 8055423586 8055419101 Bacteria 5289643
864 8055591297 8055588893 Bacteria 3619545
865 8055595060 8055592153 Bacteria 5961247
866 8056443521 8056440228 Bacteria 4946504
867 Ga0496121_0021047
868 SwRhRL2b_contig_843371
869 MBSR1b_contig_5999882
870 MBSR1b_contig_7444599
871 2214795200
872 JGI24736J21556_1003806
873 JGI24736J21556_1005830
874 JGI24740J21852_10029442
875 JGI24737J22298_10001354
876 JGI24737J22298_10027740
877 JGI24737J22298_10051996
878 JGI24735J21928_10000003
879 JGI24744J21845_10006419
880 JGI25162J39368_1000039
881 JGI25162J39368_1001033
882 JGI25157J39369_1004746
883 JGI25164J39214_1001908
884 JGI25150J39212_1000005
885 JGI25151J46595_10000004
886 JGI25165J46597_1000678
887 JGI25153J46596_10000004
888 rootL2_10134610
889 rootL2_10192172
890 Ga0006562J51391_1003423
891 Ga0055536_1000004
892 Ga0055530_10000817
893 Ga0058861_10035234
894 Ga0058861_10042758
895 Ga0058860_10114316
896 Ga0058862_10235727
897 Ga0065165_1000131
898 Ga0065716_1001930
899 Ga0065714_10011870
900 Ga0065714_10138350
901 Ga0065714_10142020
902 Ga0065714_10159857
903 Ga0065714_10175046
904 Ga0065704_10002526
905 Ga0065704_10455585
906 Ga0065715_10028707
907 Ga0065715_10171526
908 Ga0065715_10372960
909 Ga0070658_10000153
910 Ga0070658_10059750
911 Ga0070658_10128365
912 Ga0070676_10000312
913 Ga0070680_100022246
914 Ga0070682_100020081
915 Ga0068868_100113365
916 Ga0070660_100007068
917 Ga0070660_100461031
918 Ga0070691_10260187
919 Ga0070661_100224104
920 Ga0070673_100014202
921 Ga0070659_100000375
922 Ga0070659_100008718
923 Ga0070659_100139989
924 Ga0070678_100001208
925 Ga0070662_100078309
926 Ga0068867_100001333
927 Ga0074259_10342770
928 Ga0070679_100018790
929 Ga0070679_100356217
930 Ga0068853_100081417
931 Ga0070665_100000372
932 Ga0068855_100000360
933 Ga0068855_100022110
934 Ga0068855_100044845
935 Ga0068855_100062080
936 Ga0068855_100076304
937 Ga0068855_100311184
938 Ga0068854_100068418
939 Ga0068854_100485699
940 Ga0068854_100514675
941 Ga0068856_100001358
942 Ga0068856_100003057
943 Ga0068856_100213973
944 Ga0068852_100102354
945 Ga0068851_10336054
946 Ga0068858_100277706
947 Ga0075369_10150223
948 Ga0075366_10000284
949 Ga0075366_10061582
950 Ga0075366_10063577
951 Ga0075366_10109024
952 Ga0075366_10131929
953 Ga0097621_100001155
954 Ga0097621_100174543
955 Ga0075370_10077067
956 Ga0075370_10149573
957 Ga0068871_100000141
958 Ga0075428_100002939
959 Ga0075431_100013874
960 Ga0068865_100000847
961 Ga0099824_1001317
962 Ga0079104_1000280
963 Ga0099826_10000125
964 Ga0105251_10065349
965 Ga0105244_10013135
966 Ga0105244_10016324
967 Ga0105250_10022606
968 Ga0105240_10082195
969 Ga0105240_10088645
970 Ga0105240_10224920
971 Ga0105240_10248022
972 Ga0105240_10305476
973 Ga0105240_10477974
974 Ga0111539_10132623
975 Ga0105243_10000009
976 Ga0105241_10005560
977 Ga0105241_10071231
978 Ga0105241_10180449
979 Ga0105241_10313131
980 Ga0105242_10255950
981 Ga0105242_10270364
982 Ga0105237_10002553
983 Ga0105237_10006561
984 Ga0105237_10009296
985 Ga0105237_10022954
986 Ga0105237_10087034
987 Ga0105237_10136819
988 Ga0105237_10425982
989 Ga0105238_10426380
990 Ga0105238_10497127
991 Ga0105249_10936121
992 Ga0105239_10000011
993 Ga0105239_10004149
994 Ga0105239_10167733
995 Ga0105239_10246419
996 Ga0105239_10263368
997 Ga0105239_10310528
998 Ga0157327_1000641
999 Ga0157373_10000129
1000 Ga0157373_10001369
1001 Ga0157373_10008448
1002 Ga0157373_10014264
1003 Ga0157373_10209759
1004 Ga0157373_10381251
1005 Ga0157371_10001664
1006 Ga0157371_10001678
1007 Ga0157371_10003367
1008 Ga0157371_10005650
1009 Ga0157371_10010104
1010 Ga0157371_10027271
1011 Ga0157371_10151899
1012 Ga0157371_10243292
1013 Ga0157371_10340733
1014 Ga0157371_10703507
1015 Ga0157370_10000084
1016 Ga0157370_10025354
1017 Ga0157370_10047165
1018 Ga0157370_10066433
1019 Ga0157370_10128866
1020 Ga0157370_10571440
1021 Ga0157370_10702011
1022 Ga0157370_10881069
1023 Ga0157369_10000023
1024 Ga0157369_10000613
1025 Ga0157369_10004050
1026 Ga0157369_10007412
1027 Ga0157369_10011350
1028 Ga0157369_10117957
1029 Ga0157369_10304404
1030 Ga0157374_10027177
1031 Ga0157374_10075051
1032 Ga0157374_10173144
1033 Ga0157374_10306162
1034 Ga0157378_10041061
1035 Ga0157378_10217408
1036 Ga0163162_10001202
1037 Ga0163162_10002182
1038 Ga0163162_10045451
1039 Ga0163162_10049288
1040 Ga0163162_10675970
1041 Ga0157372_10000030
1042 Ga0157372_10003430
1043 Ga0157372_10028159
1044 Ga0157372_10052694
1045 Ga0157372_10529291
1046 Ga0157372_10688494
1047 Ga0157375_10092834
1048 Ga0157375_10101632
1049 Ga0157375_10128521
1050 Ga0157375_10180919
1051 Ga0157375_10272709
1052 Ga0157375_10548517
1053 Ga0182008_10000002
1054 Ga0182008_10000600
1055 Ga0182008_10005586
1056 Ga0182008_10100876
1057 Ga0182008_10181679
1058 Ga0157376_10652013
1059 Ga0157376_10674772
1060 Ga0182006_1000806
1061 Ga0182006_1024244
1062 Ga0182006_1038054
1063 Ga0182006_1046863
1064 Ga0182006_1074207
1065 Ga0182006_1083714
1066 Ga0182007_10000002
1067 Ga0183373_1004
1068 Ga0163161_10000039
1069 Ga0163161_10002163
1070 Ga0163161_10026555
1071 Ga0163161_10276877
1072 Ga0163161_10861360
1073 Ga0197907_10169535
1074 Ga0197907_10475699
1075 Ga0197907_10569442
1076 Ga0197907_11336279
1077 Ga0206349_1139351
1078 Ga0206351_10170033
1079 Ga0206351_10267476
1080 Ga0206351_10512829
1081 Ga0206352_10132532
1082 Ga0206352_10703535
1083 Ga0206352_10881571
1084 Ga0206352_11011592
1085 Ga0206352_11227474
1086 Ga0206350_10057460
1087 Ga0206350_10209494
1088 Ga0206350_10752456
1089 Ga0206354_11040595
1090 Ga0206354_11302053
1091 Ga0206354_11338799
1092 Ga0206353_10666179
1093 Ga0206353_11248305
1094 Ga0154015_1221621
1095 Ga0154015_1252602
1096 Ga0154015_1495562
1097 Ga0213872_10013117
1098 Ga0224712_10003182
1099 Ga0224712_10003582
1100 Ga0224712_10014571
1101 Ga0224712_10054231
1102 Ga0207427_100025
1103 Ga0209437_100010
1104 Ga0209437_100135
1105 Ga0207425_1000008
1106 Ga0209026_1000610
1107 Ga0209026_1004981
1108 Ga0209026_1013858
1109 Ga0209129_1000040
1110 Ga0209129_1004506
1111 Ga0209233_1000017
1112 Ga0209233_1001329
1113 Ga0209233_1012915
1114 Ga0209455_1001523
1115 Ga0209455_1016348
1116 Ga0209676_1000009
1117 Ga0209676_1000332
1118 Ga0209025_1000020
1119 Ga0209758_1000022
1120 Ga0209050_1000048
1121 Ga0209051_1045041
1122 Ga0207656_10000055
1123 Ga0207655_1000038
1124 Ga0207647_10000171
1125 Ga0207647_10008184
1126 Ga0207647_10051967
1127 Ga0207645_10000035
1128 Ga0207705_10000108
1129 Ga0207705_10018682
1130 Ga0207654_10134366
1131 Ga0207654_10315243
1132 Ga0207707_10031720
1133 Ga0207695_10000053
1134 Ga0207695_10034063
1135 Ga0207695_10081967
1136 Ga0207695_10257744
1137 Ga0207695_10307059
1138 Ga0207695_10358582
1139 Ga0207671_10005707
1140 Ga0207671_10010466
1141 Ga0207671_10016438
1142 Ga0207671_10033281
1143 Ga0207671_10069197
1144 Ga0207671_10201662
1145 Ga0207671_10277341
1146 Ga0207660_10078474
1147 Ga0207657_10099275
1148 Ga0207657_10226921
1149 Ga0207657_10396066
1150 Ga0207649_10101788
1151 Ga0207652_10191483
1152 Ga0207652_10476868
1153 Ga0207694_10149527
1154 Ga0207644_10023288
1155 Ga0207690_10002170
1156 Ga0207690_10012751
1157 Ga0207690_10148683
1158 Ga0207706_10001112
1159 Ga0207709_10000026
1160 Ga0207709_10618837
1161 Ga0207704_10000036
1162 Ga0207665_10009076
1163 Ga0207689_10103891
1164 Ga0207667_10000430
1165 Ga0207667_10059200
1166 Ga0207667_10095966
1167 Ga0207667_10106089
1168 Ga0207651_10045387
1169 Ga0207640_10025047
1170 Ga0207640_10536418
1171 Ga0207640_10627028
1172 Ga0207677_10035766
1173 Ga0207677_11228361
1174 Ga0207703_10039505
1175 Ga0207639_11103371
1176 Ga0207678_10092160
1177 Ga0207678_10969712
1178 Ga0207708_10180891
1179 Ga0207702_10001407
1180 Ga0207702_10145971
1181 Ga0207702_10509260
1182 Ga0207702_10711405
1183 Ga0207648_10000333
1184 Ga0207674_10111233
1185 Ga0207683_10000982
1186 Ga0207683_10303287
1187 Ga0209281_1000337
1188 Ga0209489_108316
1189 Ga0210002_1001494
1190 Ga0209282_1121056
1191 Ga0209974_10009384
1192 Ga0268266_10000658
1193 Ga0307517_10004407
1194 Ga0307515_10003374
1195 Ga0307515_10087594
1196 Ga0307515_10095909
1197 Ga0265324_10059460
1198 Ga0316177_1079276
1199 Ga0316177_1101446
1200 Ga0316176_1220529
1201 Ga0316179_1073340
1202 Ga0316183_1116825
1203 Ga0316181_1163475
1204 Ga0316181_1219863
1205 Ga0316181_1278947
1206 Ga0316182_1040405
1207 Ga0265339_10023927
1208 Ga0265327_10019440
1209 Ga0265327_10058350
1210 Ga0265327_10083179
1211 Ga0265316_10118417
1212 Ga0265316_10134258
1213 Ga0265316_10301634
1214 Ga0307509_10083314
1215 Ga0307408_100001588
1216 Ga0307408_100008863
1217 Ga0307408_100013046
1218 Ga0307408_100398258
1219 Ga0307508_10475102
1220 Ga0265314_10152306
1221 Ga0316576_10038611
1222 Ga0316576_10080879
1223 Ga0316576_10484112
1224 Ga0316578_10138424
1225 Ga0316578_10178967
1226 Ga0307405_10000005
1227 Ga0307405_10000006
1228 Ga0307405_10002019
1229 Ga0307405_10004590
1230 Ga0307413_10025892
1231 Ga0307413_10098948
1232 Ga0307413_10117547
1233 Ga0307413_10142076
1234 Ga0307410_10000034
1235 Ga0307406_10000004
1236 Ga0307406_10106047
1237 Ga0307406_10124631
1238 Ga0307407_10000003
1239 Ga0307407_10000196
1240 Ga0307412_10000085
1241 Ga0307412_10002740
1242 Ga0307412_10031955
1243 Ga0307412_10168924
1244 Ga0307412_10171970
1245 Ga0307412_10509537
1246 Ga0307409_100017984
1247 Ga0307416_100000002
1248 Ga0307416_100017337
1249 Ga0307416_100456519
1250 Ga0307414_10000011
1251 Ga0307414_10002003
1252 Ga0307414_10003085
1253 Ga0307414_10005145
1254 Ga0307414_10005613
1255 Ga0307414_10023616
1256 Ga0307414_10024602
1257 Ga0307414_10042461
1258 Ga0307414_10046410
1259 Ga0307414_10191471
1260 Ga0307414_10473817
1261 Ga0307411_10020538
1262 Ga0307411_10037313
1263 Ga0307411_10953092
1264 Ga0307411_11045559
1265 Ga0316585_10087685
1266 Ga0316593_10000712
1267 Ga0316593_10000765
1268 Ga0316593_10006916
1269 Ga0316593_10044248
1270 Ga0316593_10078340
1271 Ga0307507_10000034
1272 Ga0307510_10000366
1273 Ga0307510_10016223
1274 Ga0316592_1000131
1275 Ga0316592_1000317
1276 Ga0316592_1003234
1277 Ga0316592_1018606
1278 Ga0316586_1006863
1279 Ga0316588_1000295
1280 Ga0316588_1000569
1281 Ga0316588_1021693
1282 Ga0316596_1000106
1283 Ga0316596_1001355
1284 Ga0316596_1003296
1285 Ga0316596_1003798
1286 Ga0316596_1005405
1287 Ga0316596_1006124
1288 Ga0316596_1006577
1289 Ga0316596_1012909
1290 Ga0316596_1013528
1291 Ga0316596_1015077
1292 Ga0316596_1058977
1293 Ga0316574_0036503
1294 Ga0316574_0135095
1295 Ga0316574_0139663
1296 Ga0316574_0231337
1297 Ga0316582_0014602
1298 Ga0316584_0002885
1299 Ga0316584_0012713
1300 Ga0316584_0437324
1301 Ga0395899_0000034
1302 Ga0395899_0001602
1303 Ga0395899_0006152
1304 Ga0395899_0245454
1305 Ga0395900_0000346
1306 Ga0395900_0001482
1307 Ga0395900_0006693
1308 Ga0395898_0034336
1309 Ga0395905_0000528
1310 Ga0395905_0204363
1311 Ga0316581_0070678
1312 Ga0395901_0000351
1313 Ga0395901_0135999
1314 Ga0395901_0252291
1315 Ga0395901_0973011
1316 Ga0400483_035362
1317 Ga0400483_066194
1318 Ga0400483_219275
1319 Ga0400489_13883
1320 Ga0400489_16361
1321 Ga0400489_47982
1322 Ga0436361_0986181
1323 Ga0439447_000447
1324 Ga0439466_0000296
1325 Ga0451787_595883
1326 Ga0451790_27126
1327 Ga0451794_19467
1328 Ga0451794_35864
1329 Ga0451795_0585944
1330 Ga0451795_0658726
1331 Ga0451795_0714771
1332 Ga0451795_0947176
1333 Ga0451795_1413283
1334 Ga0451805_101447
1335 Ga0451804_0523259
1336 Ga0451807_0581933
1337 Ga0451837_0265238
1338 Ga0451837_1117378
1339 Ga0451837_1389540
1340 Ga0451837_1469134
1341 Ga0451837_1714034
1342 Ga0451841_0263914
1343 Ga0451855_0308427
1344 Ga0452268_01081
1345 Ga0439452_065776
1346 Ga0439446_0033029
1347 Ga0451577_0000565
1348 Ga0451577_0002272
1349 Ga0451577_0014494
1350 Ga0451577_0030583
1351 Ga0451577_0048590
1352 Ga0451577_0053903
1353 Ga0451577_0097425
1354 Ga0451577_0133538
1355 Ga0451577_0140717
1356 Ga0451577_0308820
1357 Ga0451577_0542881
1358 Ga0451577_0660445
1359 Ga0451577_0749887
1360 Ga0466969_0035704
1361 Ga0453683_0000055
1362 Ga0453683_0005759
1363 Ga0453683_0012099
1364 Ga0453683_0014332
1365 Ga0453683_0064012
1366 Ga0453683_0287748
1367 Ga0466966_0001476
1368 Ga0466961_0045113
1369 Ga0453684_0000440
1370 Ga0453684_0012213
1371 Ga0453684_0013573
1372 Ga0453684_0014334
1373 Ga0453684_0018583
1374 Ga0453684_0023556
1375 Ga0453684_0033676
1376 Ga0453684_0040849
1377 Ga0453684_0058446
1378 Ga0453684_0059704
1379 Ga0453684_0063984
1380 Ga0453684_0074277
1381 Ga0453684_0108960
1382 Ga0453684_0117351
1383 Ga0453684_0133671
1384 Ga0453684_0160195
1385 Ga0453684_0174401
1386 Ga0453684_0312190
1387 Ga0453684_0658937
1388 Ga0453684_0737740
1389 Ga0453684_1106265
1390 Ga0466959_0127914
1391 Ga0466959_0145372
1392 Ga0451576_0011813
1393 Ga0451576_0019276
1394 Ga0451576_0021171
1395 Ga0451576_0032102
1396 Ga0451576_0170886
1397 Ga0451576_0180565
1398 Ga0451576_0196762
1399 Ga0451576_0518029
1400 Ga0451576_0805207
1401 Ga0451576_1543512
1402 Ga0466958_0043675
1403 Ga0495627_009866
1404 Ga0495627_017080
1405 Ga0495592_0186938
1406 Ga0495592_0191261
1407 Ga0495592_0279132
1408 Ga0495629_0070495
1409 Ga0495651_0068871
1410 Ga0495650_0000023
1411 Ga0495650_0077715
1412 Ga0495585_0000476
1413 Ga0495585_0001907
1414 Ga0495596_0046855
1415 Ga0495607_0019534
1416 Ga0495607_0080240
1417 Ga0495606_0018000
1418 Ga0495606_0021306
1419 Ga0495606_0024036
1420 Ga0495606_0036258
1421 Ga0495606_0082698
1422 Ga0495606_0139973
1423 Ga0495606_0155892
1424 Ga0495610_0001849
1425 Ga0495610_0033662
1426 Ga0495610_0069700
1427 Ga0495616_0004967
1428 Ga0495616_0018996
1429 Ga0495616_0025587
1430 Ga0495618_0102321
1431 Ga0495628_0056278
1432 Ga0495631_0004390
1433 Ga0495631_0065627
1434 Ga0495631_0140505
1435 Ga0495632_0104249
1436 Ga0495643_0000294
1437 Ga0495644_0001340
1438 Ga0495648_0021095
1439 Ga0495652_0157685
1440 Ga0495654_0120204
1441 Ga0495609_0022533
1442 Ga0495609_0027308
1443 Ga0495633_0000072
1444 Ga0495668_0000165
1445 Ga0495625_0000308
1446 Ga0495625_0001933
1447 Ga0495625_0052742
1448 Ga0495625_0068664
1449 Ga0495661_0065084
1450 Ga0495661_0068236
1451 Ga0495658_0076828
1452 Ga0495669_0053117
1453 Ga0495670_0022047
1454 Ga0495671_0014730
1455 Ga0495649_0000105
1456 Ga0495589_0058652
1457 Ga0495600_0366326
1458 Ga0495660_0095929
1459 Ga0495683_0073794
1460 Ga0495687_000233
1461 Ga0495687_002320
1462 Ga0495679_021070
1463 Ga0495686_0004780
1464 Ga0495686_0042525
1465 Ga0495686_0085031
1466 Ga0495686_0141318
1467 Ga0496115_0024423
1468 Ga0496115_0132966
1469 Ga0496116_0000024
1470 Ga0496116_0019557
1471 Ga0496117_0001863
1472 Ga0496117_0069081
1473 Ga0496118_0059955
1474 Ga0496118_0247906
1475 Ga0496121_0278258
1476 Ga0496122_0000862
1477 Ga0496122_0008592
1478 Ga0496123_0014741
1479 Ga0496123_0020092
1480 Ga0496124_0030778
1481 Ga0496124_0052574
1482 Ga0496125_0000018
1483 Ga0496125_0000031
1484 Ga0496125_0075544
1485 Ga0496126_0054321
1486 Ga0496126_0257403
1487 Ga0496126_0341725
1488 Ga0501306_005267
1489 Ga0501306_008333
1490 Ga0501308_004010
1491 Ga0501308_006747
1492 Ga0501310_000150
1493 Ga0501310_003033
1494 Ga0501310_008170
1495 Ga0501343_000877
1496 Ga0501304_002216
1497 Ga0501305_004136
1498 Ga0501305_005541
1499 Ga0501307_004533
1500 Ga0501307_008120
1501 Ga0501307_024321
1502 Ga0495678_035247
1503 Ga0495682_0121567
1504 Ga0501311_004878
1505 Ga0501311_010067
1506 Ga0501312_004490
1507 Ga0501312_009664
1508 Ga0501312_011849
1509 Ga0501313_006163
1510 Ga0501314_000001
1511 Ga0501315_000999
1512 Ga0501315_001329
1513 Ga0501315_005735
1514 Ga0501315_010405
1515 Ga0501315_029452
1516 Ga0501316_001182
1517 Ga0501316_001550
1518 Ga0501316_002961
1519 Ga0501316_028760
1520 Ga0501317_003554
1521 Ga0501319_000002
1522 Ga0501319_000013
1523 Ga0501319_000490
1524 Ga0501320_000041
1525 Ga0501320_002284
1526 Ga0501320_002566
1527 Ga0501320_002754
1528 Ga0501320_031001
1529 Ga0501321_004999
1530 Ga0501321_005813
1531 Ga0501322_006477
1532 Ga0501323_000002
1533 Ga0501323_004149
1534 Ga0501324_000002
1535 Ga0501325_000696
1536 Ga0501326_00132
1537 Ga0501327_02003
1538 Ga0501329_00229
1539 Ga0501331_06766
1540 Ga0501334_00539
1541 Ga0501336_001246
1542 Ga0501336_001399
1543 Ga0501336_002805
1544 Ga0501337_000596
1545 Ga0501033_0354029
1546 Ga0501034_0584223
1547 Ga0501036_0333055
1548 Ga0501040_0008839
1549 Ga0501198_010448
1550 Ga0501223_009571
1551 Ga0501238_000015
1552 Ga0501243_036706
1553 Ga0501241_002627
1554 Ga0501241_016337
1555 Ga0501266_000002
1556 Ga0501280_000239
1557 Ga0501035_0016384
1558 nmdc:mga0k408_10405_c1
1559 nmdc:mga0k408_106601_c1
1560 nmdc:mga0k408_118905_c1
1561 nmdc:mga0k408_29434_c2
1562 nmdc:mga0k408_349_c1
1563 nmdc:mga07m45_66618_c1
1564 nmdc:mga0qj67_355077_c1
1565 nmdc:mga06r32_134479_c1
1566 nmdc:mga08y16_296671_c1
1567 Ga0500635_0004581
1568 Ga0500635_0054334
1569 Ga0500646_0012285
1570 Ga0500647_0080076
1571 Ga0500651_0000078
1572 Ga0500641_0005780
1573 Ga0500641_0021869
1574 Ga0500608_000343
1575 Ga0500608_004284
1576 Ga0500618_000005
1577 Ga0500618_027484
1578 Ga0500652_061828
1579 Ga0500658_0000002
1580 Ga0500564_051411
1581 Ga0500573_0050747
1582 Ga0500619_095165
1583 Ga0500622_0000385
1584 Ga0500624_000517
1585 Ga0500584_007381
1586 Ga0587093_002131
1587 Ga0587093_014170
1588 Ga0587093_022240
1589 Ga0587066_001886
1590 Ga0587066_005424
1591 Ga0587066_007750
1592 Ga0587066_009357
1593 Ga0587070_001969
1594 Ga0587070_004702
1595 Ga0587070_017317
1596 Ga0587070_022242
1597 Ga0587070_034202
1598 Ga0587073_0034124
1599 Ga0587077_002147
1600 Ga0587077_004989
1601 Ga0587077_008642
1602 Ga0587080_006271
1603 Ga0587080_029094
1604 Ga0587080_030244
1605 Ga0587082_036007
1606 Ga0587083_0002547
1607 Ga0587083_0007225
1608 Ga0587083_0055690
1609 Ga0587085_023962
1610 Ga0587088_008181
1611 Ga0587088_009558
1612 Ga0587089_007762
1613 Ga0587089_014687
1614 Ga0587090_000050
1615 Ga0587090_000841
1616 Ga0587090_019738
1617 Ga0587091_010786
1618 Ga0587091_028965
1619 Ga0587094_001632
1620 Ga0587094_004559
1621 Ga0587094_007051
1622 Ga0587095_002824
1623 Ga0587106_002077
1624 Ga0587106_015999
1625 Ga0587099_005957
1626 Ga0587101_009496
1627 Ga0587101_011550
1628 Ga0587101_035041
1629 Ga0587109_004088
1630 Ga0587109_022728
1631 Ga0587109_043512
1632 Ga0587117_007139
1633 Ga0587117_033686
1634 Ga0587062_000275
1635 Ga0587062_000422
1636 Ga0587062_019563
1637 Ga0587062_023173
1638 Ga0587062_028743
1639 Ga0587067_009616
1640 Ga0587068_008476
1641 Ga0587068_028315
1642 Ga0587068_032647
1643 Ga0587068_054188
1644 Ga0587069_001223
1645 Ga0587069_007871
1646 Ga0587069_013809
1647 Ga0587069_037550
1648 Ga0587076_004507
1649 Ga0587076_046295
1650 Ga0587079_006697
1651 Ga0587102_011361
1652 Ga0587108_000188
1653 Ga0587061_00120
1654 Ga0587071_033129
1655 Ga0587111_0011296
1656 2513232365
1657 2520879529
1658 2586210018
1659 2599479393
1660 2644009190
1661 2644373928
1662 2644643940
1663 2644681835
1664 2722726166
1665 2738733070
1666 2738755688
1667 2738762095
1668 2738765608
1669 2738854390
1670 2739214651
1671 2739301925
1672 2739587942
1673 2739614407
1674 2739646661
1675 2740002833
1676 2740007650
1677 2740031503
1678 2776615279
1679 2802655255
1680 2817413551
1681 2819545818
1682 2833640625
1683 2839990126
1684 2842724289
1685 2842908307
1686 2842913577
1687 2849282611
1688 2852625405
1689 2852629102
1690 2857617046
1691 2857619715
1692 2857631640
1693 2881247571
1694 2881364099
1695 2884934416
1696 2890740674
1697 2895504174
1698 2896320849
1699 2896346858
1700 2898716197
1701 2902051199
1702 2903898658
1703 2904422402
1704 2904449058
1705 2904558492
1706 2904782776
1707 2911143831
1708 2919180386
1709 2919189060
1710 2919194217
1711 2919438006
1712 2919511822
1713 2919684618
1714 2928082297
1715 2928149124
1716 2929150607
1717 2932085009
1718 2939666785
1719 2945998888
1720 2954021331
1721 2958462004
1722 2958514495
1723 2965321919
1724 2977235842
1725 2977272079
1726 3003236842
1727 8036739268
1728 8054311425
1729 8055423586
1730 8055591297
1731 8055595060
1732 8056443521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

32

221

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9217 13 207
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9168 1 207
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9052 1 207
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8994 3 207
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.888 3 207
ID Description Score Start End Superfamily
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.8376 1 205 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.8267 1 207 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.8261 1 205 3.40.1370.10
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.8219 1 207 3.40.1370.10
af_K7MAT5_102_317_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.8203 1 209 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A1Z5HFM1-F1-model_v4 deleted 0.9835 101 209
AF-A0A7V6DYA5-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9791 112 209 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A432FPV9-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9779 106 209 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1Z5HFM1-F1-model_v4 deleted 0.9746 101 209
AF-A0A3D2HGN9-F1-model_v4 deleted 0.974 94 209

Map