F484033
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 866 | 547 | 1732 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0400493|Ga0501032_0400493_115_648 |
| Length | 177 |
| Sequence | MTIPASVHASAVKVGSRAVLIRGPSGSGKSRLAFDLILCGRSGQLPPAVLVGDDRVRLDTGAGQFAGQLLVRPVAELAGLIEIRGLGIRRTDFVAEAGVGLVVDLAAADAERLPPRQALQISIFGVEIPRIPVAADFSPLPLVVAALTTADGLPSLNPAQDCFKGIGNHITGTLAPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 103 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 104 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 105 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 106 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 107 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 169 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 172 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 187 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 188 | 3300033546 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 | Metagenome | Unclassified |
| 189 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 221 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 222 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 228 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 229 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 332 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 333 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 334 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 335 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 374 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 375 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 377 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 378 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 379 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 380 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 381 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 382 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 383 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 385 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 386 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 387 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 390 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 391 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 393 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 394 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 395 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 396 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 397 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 398 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 400 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 402 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 404 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 405 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 408 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 409 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 411 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 412 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 413 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 414 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 415 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 416 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 417 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 418 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 419 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 420 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 421 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 422 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 423 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 424 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 425 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 426 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 427 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 428 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 429 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 430 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 431 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 432 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 433 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 434 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 435 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 436 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 437 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 438 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 439 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 440 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 441 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 442 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 443 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 444 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 445 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 446 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 447 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 448 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 449 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 450 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 451 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 452 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 453 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 454 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 455 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 456 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 457 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 458 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 459 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 460 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 461 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 462 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 463 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 464 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 465 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 466 | 2922368715 | |||
| 467 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 468 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 469 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 470 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 471 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 472 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 473 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 474 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 475 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 476 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 477 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 478 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 479 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 480 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 481 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 482 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 483 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 484 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 485 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 486 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 487 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 488 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 489 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 490 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 491 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 492 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 493 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 494 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 495 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 496 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 497 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 498 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 499 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 500 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 501 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 502 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 503 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 504 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 505 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 506 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 507 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 508 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 509 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 510 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 511 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 512 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 513 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 514 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 515 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 516 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 517 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 518 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 519 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 520 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 521 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 522 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 523 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 524 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 525 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 526 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 527 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 528 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 529 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 530 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 531 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 532 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 533 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 534 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 535 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 536 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 537 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 538 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 539 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 540 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 541 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 542 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 543 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 544 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 545 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 546 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 547 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.28 |
| Metatranscriptomes | 0.23 |
| Isolates | 15.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.24 |
| Nodule | 13.63 |
| Rhizoplane | 5.2 |
| Rhizosphere | 59.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501032_0400493 | 3300049569 | Bacteria | 882 |
| 2 | JGI25153J46596_10033514 | 3300003215 | Bacteria | 1694 |
| 3 | JGI25153J46596_10037071 | 3300003215 | Bacteria | 1555 |
| 4 | JGI25160J50197_1013318 | 3300003354 | Bacteria | 2809 |
| 5 | Ga0055539_1009637 | 3300003752 | Bacteria | 1197 |
| 6 | Ga0055531_10015632 | 3300003794 | Bacteria | 3329 |
| 7 | Ga0065165_1012522 | 3300005262 | Bacteria | 3448 |
| 8 | Ga0065165_1077129 | 3300005262 | Bacteria | 872 |
| 9 | Ga0070658_10262669 | 3300005327 | Bacteria | 1466 |
| 10 | Ga0070683_100067645 | 3300005329 | Bacteria | 3327 |
| 11 | Ga0070683_100070645 | 3300005329 | Bacteria | 3257 |
| 12 | Ga0070670_101051257 | 3300005331 | Bacteria | 741 |
| 13 | Ga0070666_10407866 | 3300005335 | Bacteria | 977 |
| 14 | Ga0070680_100038360 | 3300005336 | Bacteria | 3875 |
| 15 | Ga0070682_100030995 | 3300005337 | Bacteria | 3231 |
| 16 | Ga0068868_100824741 | 3300005338 | Bacteria | 838 |
| 17 | Ga0070660_100016551 | 3300005339 | Bacteria | 5353 |
| 18 | Ga0070689_100762774 | 3300005340 | Bacteria | 848 |
| 19 | Ga0070691_10047567 | 3300005341 | Bacteria | 2040 |
| 20 | Ga0070661_100666481 | 3300005344 | Bacteria | 845 |
| 21 | Ga0070661_100922997 | 3300005344 | Bacteria | 721 |
| 22 | Ga0070692_10635626 | 3300005345 | Bacteria | 711 |
| 23 | Ga0070668_100291738 | 3300005347 | Bacteria | 1365 |
| 24 | Ga0070668_100368644 | 3300005347 | Bacteria | 1219 |
| 25 | Ga0070668_100742232 | 3300005347 | Bacteria | 868 |
| 26 | Ga0070668_101065366 | 3300005347 | Bacteria | 728 |
| 27 | Ga0070669_100096348 | 3300005353 | Bacteria | 2226 |
| 28 | Ga0070671_100953668 | 3300005355 | Bacteria | 750 |
| 29 | Ga0070659_100246541 | 3300005366 | Bacteria | 1480 |
| 30 | Ga0070667_100472482 | 3300005367 | Bacteria | 1147 |
| 31 | Ga0070709_10165845 | 3300005434 | Bacteria | 1539 |
| 32 | Ga0070709_10182234 | 3300005434 | Bacteria | 1475 |
| 33 | Ga0070714_100050500 | 3300005435 | Bacteria | 3543 |
| 34 | Ga0070714_100111422 | 3300005435 | Bacteria | 2423 |
| 35 | Ga0070713_100014007 | 3300005436 | Bacteria | 5937 |
| 36 | Ga0070713_100450610 | 3300005436 | Bacteria | 1208 |
| 37 | Ga0070710_10293085 | 3300005437 | Bacteria | 1059 |
| 38 | Ga0070711_100024318 | 3300005439 | Bacteria | 3950 |
| 39 | Ga0070663_100108980 | 3300005455 | Bacteria | 2078 |
| 40 | Ga0070663_100348478 | 3300005455 | Bacteria | 1198 |
| 41 | Ga0070678_100060242 | 3300005456 | Bacteria | 2793 |
| 42 | Ga0070678_100275500 | 3300005456 | Bacteria | 1421 |
| 43 | Ga0070678_100847761 | 3300005456 | Bacteria | 832 |
| 44 | Ga0070662_100301729 | 3300005457 | Bacteria | 1301 |
| 45 | Ga0070681_10080143 | 3300005458 | Bacteria | 3221 |
| 46 | Ga0070681_10140566 | 3300005458 | Bacteria | 2344 |
| 47 | Ga0070681_10262104 | 3300005458 | Bacteria | 1640 |
| 48 | Ga0070681_10572299 | 3300005458 | Bacteria | 1043 |
| 49 | Ga0070685_10183029 | 3300005466 | Bacteria | 1350 |
| 50 | Ga0070707_100216548 | 3300005468 | Bacteria | 1866 |
| 51 | Ga0070679_100304289 | 3300005530 | Bacteria | 1545 |
| 52 | Ga0070679_100557305 | 3300005530 | Bacteria | 1090 |
| 53 | Ga0070684_100005197 | 3300005535 | Bacteria | 9952 |
| 54 | Ga0070684_100073578 | 3300005535 | Bacteria | 3011 |
| 55 | Ga0070697_100508499 | 3300005536 | Bacteria | 1054 |
| 56 | Ga0068853_100156985 | 3300005539 | Bacteria | 2050 |
| 57 | Ga0068853_100329145 | 3300005539 | Bacteria | 1417 |
| 58 | Ga0068853_100457636 | 3300005539 | Bacteria | 1201 |
| 59 | Ga0070693_100722044 | 3300005547 | Bacteria | 731 |
| 60 | Ga0070665_100120177 | 3300005548 | Bacteria | 2629 |
| 61 | Ga0070665_100454604 | 3300005548 | Bacteria | 1290 |
| 62 | Ga0070665_100945123 | 3300005548 | Bacteria | 874 |
| 63 | Ga0068855_100324958 | 3300005563 | Bacteria | 1699 |
| 64 | Ga0068855_100350463 | 3300005563 | Bacteria | 1626 |
| 65 | Ga0070664_100149720 | 3300005564 | Bacteria | 2060 |
| 66 | Ga0070664_100300874 | 3300005564 | Bacteria | 1449 |
| 67 | Ga0070664_101111841 | 3300005564 | Bacteria | 744 |
| 68 | Ga0068857_100639548 | 3300005577 | Bacteria | 1007 |
| 69 | Ga0068857_100930309 | 3300005577 | Bacteria | 835 |
| 70 | Ga0068854_100108189 | 3300005578 | Bacteria | 2093 |
| 71 | Ga0068854_100225483 | 3300005578 | Bacteria | 1485 |
| 72 | Ga0068856_100333155 | 3300005614 | Bacteria | 1535 |
| 73 | Ga0068852_100133685 | 3300005616 | Bacteria | 2287 |
| 74 | Ga0068852_100195359 | 3300005616 | Bacteria | 1912 |
| 75 | Ga0068852_100432784 | 3300005616 | Bacteria | 1299 |
| 76 | Ga0068852_101619923 | 3300005616 | Bacteria | 670 |
| 77 | Ga0068859_100606613 | 3300005617 | Bacteria | 1187 |
| 78 | Ga0068864_100282186 | 3300005618 | Bacteria | 1550 |
| 79 | Ga0068851_10099579 | 3300005834 | Bacteria | 1540 |
| 80 | Ga0068863_100346762 | 3300005841 | Bacteria | 1445 |
| 81 | Ga0068863_100358896 | 3300005841 | Bacteria | 1420 |
| 82 | Ga0068863_100536403 | 3300005841 | Bacteria | 1154 |
| 83 | Ga0068863_101075487 | 3300005841 | Bacteria | 808 |
| 84 | Ga0068858_100186244 | 3300005842 | Bacteria | 1961 |
| 85 | Ga0068858_100406503 | 3300005842 | Bacteria | 1308 |
| 86 | Ga0068858_100515121 | 3300005842 | Bacteria | 1156 |
| 87 | Ga0068860_100533251 | 3300005843 | Bacteria | 1174 |
| 88 | Ga0068860_101077660 | 3300005843 | Bacteria | 822 |
| 89 | Ga0068862_100378117 | 3300005844 | Bacteria | 1320 |
| 90 | Ga0081540_1047384 | 3300005983 | Bacteria | 2162 |
| 91 | Ga0081540_1070925 | 3300005983 | Bacteria | 1612 |
| 92 | Ga0081539_10088217 | 3300005985 | Bacteria | 1610 |
| 93 | Ga0070717_10002055 | 3300006028 | Bacteria | 14098 |
| 94 | Ga0070717_10025850 | 3300006028 | Bacteria | 4678 |
| 95 | Ga0075365_10206647 | 3300006038 | Bacteria | 1376 |
| 96 | Ga0075365_10232508 | 3300006038 | Bacteria | 1294 |
| 97 | Ga0075365_10234257 | 3300006038 | Bacteria | 1289 |
| 98 | Ga0075365_10364252 | 3300006038 | Bacteria | 1019 |
| 99 | Ga0075365_10622319 | 3300006038 | Bacteria | 763 |
| 100 | Ga0075368_10009616 | 3300006042 | Bacteria | 3480 |
| 101 | Ga0075363_100247745 | 3300006048 | Bacteria | 1025 |
| 102 | Ga0075363_100264538 | 3300006048 | Bacteria | 993 |
| 103 | Ga0075363_100379374 | 3300006048 | Bacteria | 829 |
| 104 | Ga0075364_10152558 | 3300006051 | Bacteria | 1557 |
| 105 | Ga0075364_10262342 | 3300006051 | Bacteria | 1174 |
| 106 | Ga0075364_10277744 | 3300006051 | Bacteria | 1140 |
| 107 | Ga0070716_100256662 | 3300006173 | Bacteria | 1194 |
| 108 | Ga0070716_100719448 | 3300006173 | Bacteria | 765 |
| 109 | Ga0070712_100036410 | 3300006175 | Bacteria | 3349 |
| 110 | Ga0075362_10059419 | 3300006177 | Bacteria | 1726 |
| 111 | Ga0075367_10218165 | 3300006178 | Bacteria | 1193 |
| 112 | Ga0075367_10324487 | 3300006178 | Bacteria | 970 |
| 113 | Ga0075367_10364528 | 3300006178 | Bacteria | 912 |
| 114 | Ga0075367_10596566 | 3300006178 | Bacteria | 702 |
| 115 | Ga0075369_10181476 | 3300006186 | Bacteria | 968 |
| 116 | Ga0075369_10211103 | 3300006186 | Bacteria | 897 |
| 117 | Ga0075369_10286017 | 3300006186 | Bacteria | 768 |
| 118 | Ga0075366_10018305 | 3300006195 | Bacteria | 4042 |
| 119 | Ga0075366_10143689 | 3300006195 | Bacteria | 1443 |
| 120 | Ga0075366_10479434 | 3300006195 | Bacteria | 768 |
| 121 | Ga0097621_100672367 | 3300006237 | Bacteria | 951 |
| 122 | Ga0075370_10234397 | 3300006353 | Bacteria | 1086 |
| 123 | Ga0075370_10248780 | 3300006353 | Bacteria | 1053 |
| 124 | Ga0068871_100454545 | 3300006358 | Bacteria | 1148 |
| 125 | Ga0075428_100338329 | 3300006844 | Bacteria | 1616 |
| 126 | Ga0097620_100606605 | 3300006931 | Bacteria | 1187 |
| 127 | Ga0099823_1085769 | 3300006944 | Bacteria | 1141 |
| 128 | Ga0075435_100142716 | 3300007076 | Bacteria | 2010 |
| 129 | Ga0105240_10001522 | 3300009093 | Bacteria | 39421 |
| 130 | Ga0105240_10039101 | 3300009093 | Bacteria | 6078 |
| 131 | Ga0105240_10118623 | 3300009093 | Bacteria | 3188 |
| 132 | Ga0105240_10377122 | 3300009093 | Bacteria | 1602 |
| 133 | Ga0105245_10185096 | 3300009098 | Bacteria | 1992 |
| 134 | Ga0105245_10968557 | 3300009098 | Bacteria | 894 |
| 135 | Ga0105247_10181651 | 3300009101 | Bacteria | 1404 |
| 136 | Ga0105247_10190188 | 3300009101 | Bacteria | 1374 |
| 137 | Ga0105247_10209937 | 3300009101 | Bacteria | 1313 |
| 138 | Ga0114129_10186448 | 3300009147 | Bacteria | 2819 |
| 139 | Ga0105243_10907816 | 3300009148 | Bacteria | 877 |
| 140 | Ga0105241_10213333 | 3300009174 | Bacteria | 1618 |
| 141 | Ga0105242_10201271 | 3300009176 | Bacteria | 1769 |
| 142 | Ga0105248_10127908 | 3300009177 | Bacteria | 2866 |
| 143 | Ga0105248_10451617 | 3300009177 | Bacteria | 1448 |
| 144 | Ga0105248_10937152 | 3300009177 | Bacteria | 978 |
| 145 | Ga0105237_10043065 | 3300009545 | Bacteria | 4550 |
| 146 | Ga0105237_10081784 | 3300009545 | Bacteria | 3221 |
| 147 | Ga0105237_10173918 | 3300009545 | Bacteria | 2153 |
| 148 | Ga0105237_10207163 | 3300009545 | Bacteria | 1961 |
| 149 | Ga0105237_10543982 | 3300009545 | Bacteria | 1168 |
| 150 | Ga0105237_10786368 | 3300009545 | Bacteria | 958 |
| 151 | Ga0105237_10836987 | 3300009545 | Bacteria | 927 |
| 152 | Ga0105238_10545277 | 3300009551 | Bacteria | 1164 |
| 153 | Ga0105238_11112038 | 3300009551 | Bacteria | 813 |
| 154 | Ga0105238_11404517 | 3300009551 | Bacteria | 725 |
| 155 | Ga0105249_10546486 | 3300009553 | Bacteria | 1208 |
| 156 | Ga0099796_10022000 | 3300010159 | Bacteria | 1972 |
| 157 | Ga0105239_10175070 | 3300010375 | Bacteria | 2400 |
| 158 | Ga0105239_10664518 | 3300010375 | Bacteria | 1190 |
| 159 | Ga0105239_11087032 | 3300010375 | Bacteria | 920 |
| 160 | Ga0105239_11165830 | 3300010375 | Bacteria | 888 |
| 161 | Ga0105239_11373142 | 3300010375 | Bacteria | 815 |
| 162 | Ga0105239_11609889 | 3300010375 | Bacteria | 751 |
| 163 | Ga0105239_11614904 | 3300010375 | Bacteria | 750 |
| 164 | Ga0105246_10048250 | 3300011119 | Bacteria | 2910 |
| 165 | Ga0105246_10859604 | 3300011119 | Bacteria | 810 |
| 166 | Ga0157314_1003836 | 3300012500 | Bacteria | 1082 |
| 167 | Ga0157371_10136557 | 3300013102 | Bacteria | 1746 |
| 168 | Ga0157370_10077383 | 3300013104 | Bacteria | 3134 |
| 169 | Ga0157370_10519605 | 3300013104 | Bacteria | 1093 |
| 170 | Ga0157370_10655669 | 3300013104 | Bacteria | 959 |
| 171 | Ga0157369_10010577 | 3300013105 | Bacteria | 10503 |
| 172 | Ga0157369_10111832 | 3300013105 | Bacteria | 2903 |
| 173 | Ga0157369_10194618 | 3300013105 | Bacteria | 2130 |
| 174 | Ga0157374_10229486 | 3300013296 | Bacteria | 1823 |
| 175 | Ga0157374_11277486 | 3300013296 | Bacteria | 756 |
| 176 | Ga0157378_11164949 | 3300013297 | Bacteria | 809 |
| 177 | Ga0157378_11362339 | 3300013297 | Bacteria | 752 |
| 178 | Ga0163162_10473514 | 3300013306 | Bacteria | 1384 |
| 179 | Ga0163162_11186576 | 3300013306 | Bacteria | 866 |
| 180 | Ga0163162_11315793 | 3300013306 | Bacteria | 821 |
| 181 | Ga0163162_11664201 | 3300013306 | Bacteria | 728 |
| 182 | Ga0157372_10231909 | 3300013307 | Bacteria | 2140 |
| 183 | Ga0157372_10507255 | 3300013307 | Bacteria | 1406 |
| 184 | Ga0157372_11521526 | 3300013307 | Bacteria | 771 |
| 185 | Ga0157372_12070924 | 3300013307 | Bacteria | 654 |
| 186 | Ga0157375_10457366 | 3300013308 | Bacteria | 1442 |
| 187 | Ga0157375_10535403 | 3300013308 | Bacteria | 1334 |
| 188 | Ga0163163_10096851 | 3300014325 | Bacteria | 2971 |
| 189 | Ga0163163_10167718 | 3300014325 | Bacteria | 2242 |
| 190 | Ga0157380_10759698 | 3300014326 | Bacteria | 982 |
| 191 | Ga0157380_11412267 | 3300014326 | Bacteria | 747 |
| 192 | Ga0157379_10065931 | 3300014968 | Bacteria | 3237 |
| 193 | Ga0157376_10160668 | 3300014969 | Bacteria | 2036 |
| 194 | Ga0157376_10601087 | 3300014969 | Bacteria | 1095 |
| 195 | Ga0157376_10632910 | 3300014969 | Bacteria | 1068 |
| 196 | Ga0163161_10277455 | 3300017792 | Bacteria | 1314 |
| 197 | Ga0163161_10517824 | 3300017792 | Bacteria | 974 |
| 198 | Ga0163161_10790537 | 3300017792 | Bacteria | 797 |
| 199 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 200 | Ga0214542_1000216 | 3300021321 | Bacteria | 92614 |
| 201 | Ga0214542_1042175 | 3300021321 | Bacteria | 1106 |
| 202 | Ga0214545_1000118 | 3300021324 | Bacteria | 92737 |
| 203 | Ga0214545_1043334 | 3300021324 | Bacteria | 1106 |
| 204 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 205 | Ga0213872_10166416 | 3300021361 | Bacteria | 957 |
| 206 | Ga0213874_10030678 | 3300021377 | Bacteria | 1551 |
| 207 | Ga0213876_10022972 | 3300021384 | Bacteria | 3295 |
| 208 | Ga0224712_10136980 | 3300022467 | Bacteria | 1074 |
| 209 | Ga0209563_103176 | 3300025230 | Bacteria | 3463 |
| 210 | Ga0209677_100296 | 3300025253 | Bacteria | 32613 |
| 211 | Ga0209677_106519 | 3300025253 | Bacteria | 2741 |
| 212 | Ga0209148_1001484 | 3300025254 | Bacteria | 11741 |
| 213 | Ga0209233_1006650 | 3300025261 | Bacteria | 3707 |
| 214 | Ga0209564_1021748 | 3300025295 | Bacteria | 2294 |
| 215 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 216 | Ga0209758_1000429 | 3300025297 | Bacteria | 71157 |
| 217 | Ga0209758_1006708 | 3300025297 | Bacteria | 8117 |
| 218 | Ga0209758_1033130 | 3300025297 | Bacteria | 2082 |
| 219 | Ga0209758_1034727 | 3300025297 | Bacteria | 2000 |
| 220 | Ga0209256_1002159 | 3300025299 | Bacteria | 16970 |
| 221 | Ga0207426_1001158 | 3300025302 | Bacteria | 23695 |
| 222 | Ga0207426_1008203 | 3300025302 | Bacteria | 4252 |
| 223 | Ga0207426_1078254 | 3300025302 | Bacteria | 903 |
| 224 | Ga0209257_1005466 | 3300025304 | Bacteria | 8912 |
| 225 | Ga0209257_1026629 | 3300025304 | Bacteria | 1943 |
| 226 | Ga0207710_10108429 | 3300025900 | Bacteria | 1317 |
| 227 | Ga0207710_10244828 | 3300025900 | Bacteria | 895 |
| 228 | Ga0207688_10049994 | 3300025901 | Bacteria | 2339 |
| 229 | Ga0207680_10476417 | 3300025903 | Bacteria | 887 |
| 230 | Ga0207647_10017521 | 3300025904 | Bacteria | 4868 |
| 231 | Ga0207647_10191221 | 3300025904 | Bacteria | 1186 |
| 232 | Ga0207699_10241754 | 3300025906 | Bacteria | 1240 |
| 233 | Ga0207645_10385829 | 3300025907 | Bacteria | 941 |
| 234 | Ga0207705_10048892 | 3300025909 | Bacteria | 3043 |
| 235 | Ga0207705_10168126 | 3300025909 | Bacteria | 1650 |
| 236 | Ga0207684_10073655 | 3300025910 | Bacteria | 2901 |
| 237 | Ga0207654_10253672 | 3300025911 | Bacteria | 1180 |
| 238 | Ga0207707_10016071 | 3300025912 | Bacteria | 6527 |
| 239 | Ga0207707_10082019 | 3300025912 | Bacteria | 2815 |
| 240 | Ga0207707_10185538 | 3300025912 | Bacteria | 1815 |
| 241 | Ga0207707_10269126 | 3300025912 | Bacteria | 1477 |
| 242 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 243 | Ga0207671_10498170 | 3300025914 | Bacteria | 971 |
| 244 | Ga0207671_10498693 | 3300025914 | Bacteria | 971 |
| 245 | Ga0207671_10558395 | 3300025914 | Bacteria | 913 |
| 246 | Ga0207671_10585255 | 3300025914 | Bacteria | 890 |
| 247 | Ga0207671_10692660 | 3300025914 | Bacteria | 811 |
| 248 | Ga0207693_10037984 | 3300025915 | Bacteria | 3793 |
| 249 | Ga0207663_10018567 | 3300025916 | Bacteria | 3900 |
| 250 | Ga0207657_10003442 | 3300025919 | Bacteria | 16882 |
| 251 | Ga0207657_10208275 | 3300025919 | Bacteria | 1570 |
| 252 | Ga0207652_10015649 | 3300025921 | Bacteria | 6174 |
| 253 | Ga0207652_10270126 | 3300025921 | Bacteria | 1534 |
| 254 | Ga0207681_10475865 | 3300025923 | Bacteria | 1019 |
| 255 | Ga0207694_10243918 | 3300025924 | Bacteria | 1469 |
| 256 | Ga0207694_10362224 | 3300025924 | Bacteria | 1202 |
| 257 | Ga0207694_11148492 | 3300025924 | Bacteria | 657 |
| 258 | Ga0207650_10694664 | 3300025925 | Bacteria | 859 |
| 259 | Ga0207700_10004386 | 3300025928 | Bacteria | 8309 |
| 260 | Ga0207700_10036905 | 3300025928 | Bacteria | 3534 |
| 261 | Ga0207700_10359390 | 3300025928 | Bacteria | 1269 |
| 262 | Ga0207664_10112953 | 3300025929 | Bacteria | 2262 |
| 263 | Ga0207664_10175510 | 3300025929 | Bacteria | 1837 |
| 264 | Ga0207644_10122338 | 3300025931 | Bacteria | 1982 |
| 265 | Ga0207690_10029081 | 3300025932 | Bacteria | 3510 |
| 266 | Ga0207690_10673141 | 3300025932 | Bacteria | 849 |
| 267 | Ga0207690_10702476 | 3300025932 | Bacteria | 831 |
| 268 | Ga0207706_10163428 | 3300025933 | Bacteria | 1957 |
| 269 | Ga0207669_10865854 | 3300025937 | Bacteria | 753 |
| 270 | Ga0207665_10220392 | 3300025939 | Bacteria | 1390 |
| 271 | Ga0207665_10429433 | 3300025939 | Bacteria | 1011 |
| 272 | Ga0207665_10611723 | 3300025939 | Bacteria | 851 |
| 273 | Ga0207691_10580733 | 3300025940 | Bacteria | 949 |
| 274 | Ga0207711_10323460 | 3300025941 | Bacteria | 1425 |
| 275 | Ga0207689_10939625 | 3300025942 | Bacteria | 730 |
| 276 | Ga0207661_10000379 | 3300025944 | Bacteria | 28634 |
| 277 | Ga0207661_10042228 | 3300025944 | Bacteria | 3594 |
| 278 | Ga0207679_10144070 | 3300025945 | Bacteria | 1930 |
| 279 | Ga0207679_10520126 | 3300025945 | Bacteria | 1064 |
| 280 | Ga0207679_10886879 | 3300025945 | Bacteria | 815 |
| 281 | Ga0207679_11449195 | 3300025945 | Bacteria | 630 |
| 282 | Ga0207667_10226493 | 3300025949 | Bacteria | 1915 |
| 283 | Ga0207651_10749486 | 3300025960 | Bacteria | 863 |
| 284 | Ga0207712_11183865 | 3300025961 | Bacteria | 681 |
| 285 | Ga0207668_10055426 | 3300025972 | Bacteria | 2755 |
| 286 | Ga0207668_10292695 | 3300025972 | Bacteria | 1340 |
| 287 | Ga0207668_10909319 | 3300025972 | Bacteria | 783 |
| 288 | Ga0207640_11174499 | 3300025981 | Bacteria | 681 |
| 289 | Ga0207658_10909768 | 3300025986 | Bacteria | 801 |
| 290 | Ga0207677_10038493 | 3300026023 | Bacteria | 3136 |
| 291 | Ga0207677_10767693 | 3300026023 | Bacteria | 860 |
| 292 | Ga0207703_10181174 | 3300026035 | Bacteria | 1859 |
| 293 | Ga0207639_10086651 | 3300026041 | Bacteria | 2494 |
| 294 | Ga0207639_10184081 | 3300026041 | Bacteria | 1779 |
| 295 | Ga0207639_10313636 | 3300026041 | Bacteria | 1390 |
| 296 | Ga0207639_11012424 | 3300026041 | Bacteria | 778 |
| 297 | Ga0207639_11217732 | 3300026041 | Bacteria | 707 |
| 298 | Ga0207678_10077612 | 3300026067 | Bacteria | 2845 |
| 299 | Ga0207678_10174915 | 3300026067 | Bacteria | 1833 |
| 300 | Ga0207678_10975831 | 3300026067 | Bacteria | 750 |
| 301 | Ga0207702_10229166 | 3300026078 | Bacteria | 1735 |
| 302 | Ga0207702_10285899 | 3300026078 | Bacteria | 1561 |
| 303 | Ga0207702_10337813 | 3300026078 | Bacteria | 1438 |
| 304 | Ga0207702_10480126 | 3300026078 | Bacteria | 1209 |
| 305 | Ga0207641_10513023 | 3300026088 | Bacteria | 1165 |
| 306 | Ga0207648_10593045 | 3300026089 | Bacteria | 1021 |
| 307 | Ga0207648_10821384 | 3300026089 | Bacteria | 866 |
| 308 | Ga0207676_10405994 | 3300026095 | Bacteria | 1274 |
| 309 | Ga0207676_11325365 | 3300026095 | Bacteria | 715 |
| 310 | Ga0207674_10663277 | 3300026116 | Bacteria | 1007 |
| 311 | Ga0207674_11046140 | 3300026116 | Bacteria | 785 |
| 312 | Ga0207675_100157667 | 3300026118 | Bacteria | 2163 |
| 313 | Ga0207675_100953586 | 3300026118 | Bacteria | 875 |
| 314 | Ga0207683_10089043 | 3300026121 | Bacteria | 2747 |
| 315 | Ga0207683_10147116 | 3300026121 | Bacteria | 2125 |
| 316 | Ga0207683_10488983 | 3300026121 | Bacteria | 1136 |
| 317 | Ga0207683_11075637 | 3300026121 | Bacteria | 746 |
| 318 | Ga0207698_10143546 | 3300026142 | Bacteria | 2061 |
| 319 | Ga0207698_10158800 | 3300026142 | Bacteria | 1974 |
| 320 | Ga0209389_1000015 | 3300027296 | Bacteria | 188311 |
| 321 | Ga0209389_1000035 | 3300027296 | Bacteria | 127089 |
| 322 | Ga0209589_1000039 | 3300027357 | Bacteria | 127084 |
| 323 | Ga0209489_100072 | 3300027361 | Bacteria | 138111 |
| 324 | Ga0209489_100084 | 3300027361 | Bacteria | 127094 |
| 325 | Ga0209700_100034 | 3300027363 | Bacteria | 197276 |
| 326 | Ga0209813_10020652 | 3300027866 | Bacteria | 1845 |
| 327 | Ga0268266_10033807 | 3300028379 | Bacteria | 4345 |
| 328 | Ga0268266_10039481 | 3300028379 | Bacteria | 4021 |
| 329 | Ga0268266_10392170 | 3300028379 | Bacteria | 1311 |
| 330 | Ga0268266_11075393 | 3300028379 | Bacteria | 778 |
| 331 | Ga0268264_10776862 | 3300028381 | Bacteria | 956 |
| 332 | Ga0268264_10908123 | 3300028381 | Bacteria | 884 |
| 333 | Ga0307517_10000066 | 3300028786 | Bacteria | 141370 |
| 334 | Ga0265340_10078084 | 3300031247 | Bacteria | 1561 |
| 335 | Ga0265339_10002540 | 3300031249 | Bacteria | 13011 |
| 336 | Ga0307508_10023991 | 3300031616 | Bacteria | 5535 |
| 337 | Ga0307516_10334304 | 3300031730 | Bacteria | 1183 |
| 338 | Ga0307405_10580691 | 3300031731 | Bacteria | 912 |
| 339 | Ga0307405_10781400 | 3300031731 | Bacteria | 798 |
| 340 | Ga0307407_10330785 | 3300031903 | Bacteria | 1072 |
| 341 | Ga0307412_10218952 | 3300031911 | Bacteria | 1458 |
| 342 | Ga0307416_100321671 | 3300032002 | Bacteria | 1549 |
| 343 | Ga0307416_101615683 | 3300032002 | Bacteria | 753 |
| 344 | Ga0307411_11077849 | 3300032005 | Bacteria | 723 |
| 345 | Ga0307415_100265892 | 3300032126 | Bacteria | 1402 |
| 346 | Ga0307510_10009663 | 3300033180 | Bacteria | 11491 |
| 347 | Ga0316215_1007381 | 3300033544 | Bacteria | 1071 |
| 348 | Ga0316213_1003479 | 3300033546 | Bacteria | 1043 |
| 349 | Ga0373958_0126472 | 3300034819 | Bacteria | 622 |
| 350 | Ga0373928_0032860 | 3300035084 | Bacteria | 1158 |
| 351 | Ga0373934_0060865 | 3300035086 | Bacteria | 1504 |
| 352 | Ga0373944_0094694 | 3300035089 | Bacteria | 1002 |
| 353 | Ga0373944_0235089 | 3300035089 | Bacteria | 673 |
| 354 | Ga0373923_0004740 | 3300035111 | Bacteria | 4544 |
| 355 | Ga0373939_0080834 | 3300035114 | Bacteria | 1079 |
| 356 | Ga0373945_0198753 | 3300035116 | Bacteria | 831 |
| 357 | Ga0373954_0179668 | 3300035118 | Bacteria | 1037 |
| 358 | Ga0373956_0086675 | 3300035119 | Bacteria | 1441 |
| 359 | Ga0373957_0199298 | 3300035120 | Bacteria | 834 |
| 360 | Ga0373943_0008271 | 3300035170 | Bacteria | 4668 |
| 361 | Ga0373943_0142886 | 3300035170 | Bacteria | 1291 |
| 362 | Ga0373946_0022042 | 3300035171 | Bacteria | 2476 |
| 363 | Ga0373955_0012972 | 3300035172 | Bacteria | 4018 |
| 364 | Ga0373935_0008474 | 3300035692 | Bacteria | 6153 |
| 365 | Ga0373935_0498589 | 3300035692 | Bacteria | 884 |
| 366 | Ga0373927_0026977 | 3300035695 | Bacteria | 3753 |
| 367 | Ga0373927_0057019 | 3300035695 | Bacteria | 2526 |
| 368 | Ga0373927_0361617 | 3300035695 | Bacteria | 957 |
| 369 | Ga0373933_0115072 | 3300035724 | Bacteria | 1680 |
| 370 | Ga0373947_0005615 | 3300035725 | Bacteria | 7313 |
| 371 | Ga0373947_0052888 | 3300035725 | Bacteria | 2447 |
| 372 | Ga0373947_0451247 | 3300035725 | Bacteria | 871 |
| 373 | Ga0372808_009171 | 3300036459 | Bacteria | 1380 |
| 374 | Ga0373925_0686444 | 3300037068 | Bacteria | 844 |
| 375 | Ga0373925_0934269 | 3300037068 | Bacteria | 715 |
| 376 | Ga0395899_0047216 | 3300037312 | Bacteria | 3206 |
| 377 | Ga0395900_0041199 | 3300037418 | Bacteria | 4762 |
| 378 | Ga0395900_0133440 | 3300037418 | Bacteria | 2544 |
| 379 | Ga0395898_0020298 | 3300037466 | Bacteria | 6749 |
| 380 | Ga0395898_0074171 | 3300037466 | Bacteria | 3287 |
| 381 | Ga0395898_0195700 | 3300037466 | Bacteria | 1931 |
| 382 | Ga0395905_0004327 | 3300037471 | Bacteria | 14794 |
| 383 | Ga0395905_0764011 | 3300037471 | Bacteria | 869 |
| 384 | Ga0395905_0801988 | 3300037471 | Bacteria | 844 |
| 385 | Ga0436364_0136702 | 3300037853 | Bacteria | 1269 |
| 386 | Ga0436364_1443852 | 3300037853 | Bacteria | 758 |
| 387 | Ga0395901_0129731 | 3300038443 | Bacteria | 2649 |
| 388 | Ga0395901_0181707 | 3300038443 | Bacteria | 2206 |
| 389 | Ga0395901_1091263 | 3300038443 | Bacteria | 769 |
| 390 | Ga0436365_0661667 | 3300039437 | Bacteria | 1876 |
| 391 | Ga0436365_1810308 | 3300039437 | Bacteria | 3241 |
| 392 | Ga0436365_1812884 | 3300039437 | Bacteria | 1134 |
| 393 | Ga0436361_0536082 | 3300039447 | Bacteria | 3581 |
| 394 | Ga0436363_1392658 | 3300039450 | Bacteria | 7115 |
| 395 | Ga0451791_0030660 | 3300041451 | Bacteria | 2006 |
| 396 | Ga0451791_1119922 | 3300041451 | Bacteria | 719 |
| 397 | Ga0451791_1553070 | 3300041451 | Bacteria | 900 |
| 398 | Ga0451795_0110462 | 3300041456 | Bacteria | 934 |
| 399 | Ga0451795_0382645 | 3300041456 | Bacteria | 650 |
| 400 | Ga0451802_0059232 | 3300041460 | Bacteria | 1596 |
| 401 | Ga0451839_1326352 | 3300041496 | Bacteria | 1033 |
| 402 | Ga0451841_0245673 | 3300041498 | Bacteria | 1742 |
| 403 | Ga0451843_1639070 | 3300041509 | Bacteria | 677 |
| 404 | Ga0451853_2076652 | 3300041512 | Bacteria | 2420 |
| 405 | Ga0466972_0133985 | 3300044658 | Bacteria | 1166 |
| 406 | Ga0466966_0002003 | 3300044684 | Bacteria | 13212 |
| 407 | Ga0466961_0000018 | 3300044693 | Bacteria | 109837 |
| 408 | Ga0466964_0039193 | 3300044706 | Bacteria | 1908 |
| 409 | Ga0466964_0078685 | 3300044706 | Bacteria | 1410 |
| 410 | Ga0466968_0009927 | 3300044735 | Bacteria | 3676 |
| 411 | Ga0466970_0053360 | 3300044765 | Bacteria | 2159 |
| 412 | Ga0466970_0138054 | 3300044765 | Bacteria | 1342 |
| 413 | Ga0466957_0163488 | 3300044842 | Bacteria | 1447 |
| 414 | Ga0466957_0230093 | 3300044842 | Bacteria | 1227 |
| 415 | Ga0466960_0133576 | 3300044901 | Bacteria | 1312 |
| 416 | Ga0466959_0002636 | 3300045049 | Bacteria | 11514 |
| 417 | Ga0466959_0034315 | 3300045049 | Bacteria | 3752 |
| 418 | Ga0466959_0040827 | 3300045049 | Bacteria | 3427 |
| 419 | Ga0466967_0050248 | 3300045976 | Bacteria | 3650 |
| 420 | Ga0466967_0337734 | 3300045976 | Bacteria | 1456 |
| 421 | Ga0495592_0077819 | 3300046454 | Bacteria | 2403 |
| 422 | Ga0495603_0099252 | 3300046455 | Bacteria | 1700 |
| 423 | Ga0495603_0136144 | 3300046455 | Bacteria | 1429 |
| 424 | Ga0495603_0164673 | 3300046455 | Bacteria | 1285 |
| 425 | Ga0495590_0137261 | 3300046457 | Bacteria | 882 |
| 426 | Ga0495629_0005545 | 3300046459 | Bacteria | 9419 |
| 427 | Ga0495629_0169381 | 3300046459 | Bacteria | 1516 |
| 428 | Ga0495629_0224091 | 3300046459 | Bacteria | 1297 |
| 429 | Ga0495638_0008455 | 3300046460 | Bacteria | 7296 |
| 430 | Ga0495651_0025977 | 3300046462 | Bacteria | 4559 |
| 431 | Ga0495651_0070775 | 3300046462 | Bacteria | 2653 |
| 432 | Ga0495653_0038982 | 3300046463 | Bacteria | 3725 |
| 433 | Ga0495653_0108209 | 3300046463 | Bacteria | 2002 |
| 434 | Ga0495653_0553673 | 3300046463 | Bacteria | 711 |
| 435 | Ga0495580_0014347 | 3300046472 | Bacteria | 6010 |
| 436 | Ga0495582_0038446 | 3300046473 | Bacteria | 2633 |
| 437 | Ga0495605_0080857 | 3300046474 | Bacteria | 1520 |
| 438 | Ga0495605_0109262 | 3300046474 | Bacteria | 1263 |
| 439 | Ga0495639_0003783 | 3300046475 | Bacteria | 6502 |
| 440 | Ga0495639_0039176 | 3300046475 | Bacteria | 2130 |
| 441 | Ga0495639_0424034 | 3300046475 | Bacteria | 674 |
| 442 | Ga0495662_0078274 | 3300046476 | Bacteria | 1606 |
| 443 | Ga0495662_0093420 | 3300046476 | Bacteria | 1468 |
| 444 | Ga0495664_0226851 | 3300046477 | Bacteria | 1130 |
| 445 | Ga0495664_0297060 | 3300046477 | Bacteria | 975 |
| 446 | Ga0495664_0422029 | 3300046477 | Bacteria | 800 |
| 447 | Ga0495584_0264556 | 3300046491 | Bacteria | 874 |
| 448 | Ga0495584_0375279 | 3300046491 | Bacteria | 722 |
| 449 | Ga0495585_0211912 | 3300046492 | Bacteria | 981 |
| 450 | Ga0495585_0236509 | 3300046492 | Bacteria | 916 |
| 451 | Ga0495606_0050032 | 3300046507 | Bacteria | 2736 |
| 452 | Ga0495606_0221853 | 3300046507 | Bacteria | 1064 |
| 453 | Ga0495606_0315685 | 3300046507 | Bacteria | 841 |
| 454 | Ga0495608_0016024 | 3300046511 | Bacteria | 5189 |
| 455 | Ga0495608_0211113 | 3300046511 | Bacteria | 1220 |
| 456 | Ga0495610_0053526 | 3300046512 | Bacteria | 1954 |
| 457 | Ga0495610_0072907 | 3300046512 | Bacteria | 1597 |
| 458 | Ga0495618_0035125 | 3300046514 | Bacteria | 3146 |
| 459 | Ga0495618_0049203 | 3300046514 | Bacteria | 2662 |
| 460 | Ga0495620_0158049 | 3300046515 | Bacteria | 881 |
| 461 | Ga0495628_0074122 | 3300046516 | Bacteria | 2652 |
| 462 | Ga0495628_0276804 | 3300046516 | Bacteria | 1247 |
| 463 | Ga0495628_0876483 | 3300046516 | Bacteria | 624 |
| 464 | Ga0495630_0020544 | 3300046517 | Bacteria | 4869 |
| 465 | Ga0495631_0064808 | 3300046518 | Bacteria | 1581 |
| 466 | Ga0495632_0247967 | 3300046519 | Bacteria | 799 |
| 467 | Ga0495632_0325487 | 3300046519 | Bacteria | 678 |
| 468 | Ga0495643_0036835 | 3300046522 | Bacteria | 2685 |
| 469 | Ga0495644_0189540 | 3300046523 | Bacteria | 791 |
| 470 | Ga0495648_0056155 | 3300046524 | Bacteria | 2370 |
| 471 | Ga0495648_0193408 | 3300046524 | Bacteria | 1024 |
| 472 | Ga0495648_0268938 | 3300046524 | Bacteria | 814 |
| 473 | Ga0495652_0047256 | 3300046529 | Bacteria | 3691 |
| 474 | Ga0495652_0692549 | 3300046529 | Bacteria | 686 |
| 475 | Ga0495654_0182459 | 3300046530 | Bacteria | 908 |
| 476 | Ga0495640_0016318 | 3300046533 | Bacteria | 5559 |
| 477 | Ga0495640_0045368 | 3300046533 | Bacteria | 3050 |
| 478 | Ga0495640_0338854 | 3300046533 | Bacteria | 929 |
| 479 | Ga0495640_0773403 | 3300046533 | Bacteria | 573 |
| 480 | Ga0495586_0082041 | 3300046535 | Bacteria | 1773 |
| 481 | Ga0495587_0020507 | 3300046536 | Bacteria | 4080 |
| 482 | Ga0495587_0381424 | 3300046536 | Bacteria | 784 |
| 483 | Ga0495598_0046390 | 3300046537 | Bacteria | 1291 |
| 484 | Ga0495609_0154446 | 3300046538 | Bacteria | 975 |
| 485 | Ga0495597_0055721 | 3300046542 | Bacteria | 1733 |
| 486 | Ga0495597_0196583 | 3300046542 | Bacteria | 809 |
| 487 | Ga0495645_0044979 | 3300046543 | Bacteria | 3220 |
| 488 | Ga0495645_0107774 | 3300046543 | Bacteria | 1974 |
| 489 | Ga0495622_0016420 | 3300046557 | Bacteria | 3447 |
| 490 | Ga0495633_0211282 | 3300046558 | Bacteria | 889 |
| 491 | Ga0495667_0035941 | 3300046559 | Bacteria | 3309 |
| 492 | Ga0495667_0052128 | 3300046559 | Bacteria | 2697 |
| 493 | Ga0495667_0168329 | 3300046559 | Bacteria | 1408 |
| 494 | Ga0495668_0421866 | 3300046616 | Bacteria | 733 |
| 495 | Ga0495634_0046734 | 3300046642 | Bacteria | 2920 |
| 496 | Ga0495634_0194143 | 3300046642 | Bacteria | 1264 |
| 497 | Ga0495611_0374785 | 3300046648 | Bacteria | 652 |
| 498 | Ga0495625_0013351 | 3300046660 | Bacteria | 6602 |
| 499 | Ga0495625_0119428 | 3300046660 | Bacteria | 1795 |
| 500 | Ga0495635_0040207 | 3300046663 | Bacteria | 3231 |
| 501 | Ga0495635_0118868 | 3300046663 | Bacteria | 1803 |
| 502 | Ga0495659_0025848 | 3300046664 | Bacteria | 2012 |
| 503 | Ga0495661_0058502 | 3300046665 | Bacteria | 2297 |
| 504 | Ga0495588_0020269 | 3300046674 | Bacteria | 3265 |
| 505 | Ga0495588_0188651 | 3300046674 | Bacteria | 1089 |
| 506 | Ga0495588_0332121 | 3300046674 | Bacteria | 799 |
| 507 | Ga0495588_0381867 | 3300046674 | Bacteria | 740 |
| 508 | Ga0495657_0003331 | 3300046675 | Bacteria | 13160 |
| 509 | Ga0495599_0022898 | 3300046678 | Bacteria | 3902 |
| 510 | Ga0495599_0486596 | 3300046678 | Bacteria | 727 |
| 511 | Ga0495623_0024029 | 3300046679 | Bacteria | 3931 |
| 512 | Ga0495623_0124733 | 3300046679 | Bacteria | 1547 |
| 513 | Ga0495646_0100261 | 3300046680 | Bacteria | 1661 |
| 514 | Ga0495647_0005990 | 3300046681 | Bacteria | 4006 |
| 515 | Ga0495647_0041458 | 3300046681 | Bacteria | 1753 |
| 516 | Ga0495658_0008260 | 3300046683 | Bacteria | 5156 |
| 517 | Ga0495613_0022819 | 3300046689 | Bacteria | 4663 |
| 518 | Ga0495613_0046915 | 3300046689 | Bacteria | 3193 |
| 519 | Ga0495624_0127579 | 3300046690 | Bacteria | 1560 |
| 520 | Ga0495624_0232827 | 3300046690 | Bacteria | 1115 |
| 521 | Ga0495670_0447845 | 3300046691 | Bacteria | 699 |
| 522 | Ga0495671_0207267 | 3300046692 | Bacteria | 950 |
| 523 | Ga0495671_0226628 | 3300046692 | Bacteria | 904 |
| 524 | Ga0495671_0278232 | 3300046692 | Bacteria | 806 |
| 525 | Ga0495649_0048054 | 3300046694 | Bacteria | 2319 |
| 526 | Ga0495649_0097376 | 3300046694 | Bacteria | 1565 |
| 527 | Ga0495649_0238660 | 3300046694 | Bacteria | 936 |
| 528 | Ga0495649_0428427 | 3300046694 | Bacteria | 662 |
| 529 | Ga0495589_0069690 | 3300046794 | Bacteria | 1720 |
| 530 | Ga0495589_0110926 | 3300046794 | Bacteria | 1324 |
| 531 | Ga0495589_0333053 | 3300046794 | Bacteria | 700 |
| 532 | Ga0495600_0156994 | 3300046809 | Bacteria | 1471 |
| 533 | Ga0495600_0231258 | 3300046809 | Bacteria | 1180 |
| 534 | Ga0495660_0055114 | 3300046810 | Bacteria | 2153 |
| 535 | Ga0495581_0064567 | 3300047315 | Bacteria | 2115 |
| 536 | Ga0495581_0327593 | 3300047315 | Bacteria | 894 |
| 537 | Ga0495604_0007178 | 3300047317 | Bacteria | 8823 |
| 538 | Ga0495604_0011216 | 3300047317 | Bacteria | 7113 |
| 539 | Ga0495604_0220001 | 3300047317 | Bacteria | 1307 |
| 540 | Ga0495636_0054292 | 3300047318 | Bacteria | 1683 |
| 541 | Ga0495674_0013462 | 3300047319 | Bacteria | 7692 |
| 542 | Ga0495674_0072115 | 3300047319 | Bacteria | 2979 |
| 543 | Ga0495674_0733476 | 3300047319 | Bacteria | 773 |
| 544 | Ga0495672_0043340 | 3300047320 | Bacteria | 2706 |
| 545 | Ga0495676_0020621 | 3300047321 | Bacteria | 5777 |
| 546 | Ga0495676_0113996 | 3300047321 | Bacteria | 1978 |
| 547 | Ga0495676_0321838 | 3300047321 | Bacteria | 1039 |
| 548 | Ga0495680_0002619 | 3300047322 | Bacteria | 18287 |
| 549 | Ga0495683_0334152 | 3300047323 | Bacteria | 643 |
| 550 | Ga0495683_0348650 | 3300047323 | Bacteria | 625 |
| 551 | Ga0495687_081653 | 3300047443 | Bacteria | 1264 |
| 552 | Ga0495675_0007823 | 3300047444 | Bacteria | 6599 |
| 553 | Ga0495679_038314 | 3300047446 | Bacteria | 1502 |
| 554 | Ga0495685_180499 | 3300047447 | Bacteria | 680 |
| 555 | Ga0495673_0064702 | 3300047469 | Bacteria | 1554 |
| 556 | Ga0495673_0099566 | 3300047469 | Bacteria | 1177 |
| 557 | Ga0495681_0197805 | 3300047470 | Bacteria | 817 |
| 558 | Ga0495684_0120392 | 3300047471 | Bacteria | 1977 |
| 559 | Ga0495684_0427188 | 3300047471 | Bacteria | 925 |
| 560 | Ga0495686_0315776 | 3300047472 | Bacteria | 858 |
| 561 | Ga0495593_0003341 | 3300047673 | Bacteria | 9611 |
| 562 | Ga0495593_0030634 | 3300047673 | Bacteria | 2943 |
| 563 | Ga0495593_0157334 | 3300047673 | Bacteria | 1148 |
| 564 | Ga0495602_0048059 | 3300048088 | Bacteria | 3839 |
| 565 | Ga0495602_0246879 | 3300048088 | Bacteria | 1332 |
| 566 | Ga0495615_0083588 | 3300048090 | Bacteria | 879 |
| 567 | Ga0495626_0056962 | 3300048091 | Bacteria | 1788 |
| 568 | Ga0495626_0196950 | 3300048091 | Bacteria | 828 |
| 569 | Ga0496100_0277751 | 3300048903 | Bacteria | 1248 |
| 570 | Ga0496101_0168879 | 3300048904 | Bacteria | 1680 |
| 571 | Ga0496101_0434334 | 3300048904 | Bacteria | 1035 |
| 572 | Ga0496102_0029630 | 3300048905 | Bacteria | 4898 |
| 573 | Ga0496102_0135069 | 3300048905 | Bacteria | 2311 |
| 574 | Ga0496102_0636288 | 3300048905 | Bacteria | 990 |
| 575 | Ga0496102_0976846 | 3300048905 | Bacteria | 768 |
| 576 | Ga0496103_0016458 | 3300048906 | Bacteria | 4413 |
| 577 | Ga0496104_0002055 | 3300048907 | Bacteria | 17481 |
| 578 | Ga0496104_0047669 | 3300048907 | Bacteria | 4038 |
| 579 | Ga0496104_0093803 | 3300048907 | Bacteria | 2871 |
| 580 | Ga0496104_0208826 | 3300048907 | Bacteria | 1864 |
| 581 | Ga0496105_0000745 | 3300048908 | Bacteria | 22090 |
| 582 | Ga0496105_0027123 | 3300048908 | Bacteria | 4676 |
| 583 | Ga0496105_0095923 | 3300048908 | Bacteria | 2449 |
| 584 | Ga0496105_0525320 | 3300048908 | Bacteria | 926 |
| 585 | Ga0496106_0128417 | 3300048909 | Bacteria | 1986 |
| 586 | Ga0496107_0042886 | 3300048910 | Bacteria | 3250 |
| 587 | Ga0496107_0095035 | 3300048910 | Bacteria | 2180 |
| 588 | Ga0496108_0127781 | 3300048911 | Bacteria | 2183 |
| 589 | Ga0496108_0163040 | 3300048911 | Bacteria | 1927 |
| 590 | Ga0496108_1150531 | 3300048911 | Bacteria | 658 |
| 591 | Ga0496109_0042780 | 3300048912 | Bacteria | 4105 |
| 592 | Ga0496109_0171892 | 3300048912 | Bacteria | 2033 |
| 593 | Ga0496109_0202106 | 3300048912 | Bacteria | 1868 |
| 594 | Ga0496110_0058446 | 3300048913 | Bacteria | 3396 |
| 595 | Ga0496110_0116321 | 3300048913 | Bacteria | 2407 |
| 596 | Ga0496110_0459296 | 3300048913 | Bacteria | 1160 |
| 597 | Ga0496111_0085755 | 3300048914 | Bacteria | 2303 |
| 598 | Ga0496111_0096784 | 3300048914 | Bacteria | 2166 |
| 599 | Ga0496112_0087025 | 3300048915 | Bacteria | 3091 |
| 600 | Ga0496112_0107518 | 3300048915 | Bacteria | 2759 |
| 601 | Ga0496112_0210571 | 3300048915 | Bacteria | 1901 |
| 602 | Ga0496112_0390376 | 3300048915 | Bacteria | 1332 |
| 603 | Ga0496113_0281726 | 3300048916 | Bacteria | 1329 |
| 604 | Ga0496114_0035582 | 3300048917 | Bacteria | 4112 |
| 605 | Ga0496115_0021454 | 3300048918 | Bacteria | 4991 |
| 606 | Ga0496115_0037752 | 3300048918 | Bacteria | 3829 |
| 607 | Ga0496115_0043348 | 3300048918 | Bacteria | 3588 |
| 608 | Ga0496116_0037200 | 3300048919 | Bacteria | 3397 |
| 609 | Ga0496117_0084392 | 3300048920 | Bacteria | 2072 |
| 610 | Ga0496117_0177875 | 3300048920 | Bacteria | 1227 |
| 611 | Ga0496117_0178316 | 3300048920 | Bacteria | 1224 |
| 612 | Ga0496117_0263319 | 3300048920 | Bacteria | 933 |
| 613 | Ga0496118_0024046 | 3300048921 | Bacteria | 5271 |
| 614 | Ga0496118_0176871 | 3300048921 | Bacteria | 1295 |
| 615 | Ga0496119_0009075 | 3300048922 | Bacteria | 8617 |
| 616 | Ga0496119_0025547 | 3300048922 | Bacteria | 4121 |
| 617 | Ga0496119_0389365 | 3300048922 | Bacteria | 667 |
| 618 | Ga0496120_0032183 | 3300048923 | Bacteria | 3165 |
| 619 | Ga0496121_0021718 | 3300048924 | Bacteria | 6272 |
| 620 | Ga0496121_0026391 | 3300048924 | Bacteria | 5476 |
| 621 | Ga0496121_0201185 | 3300048924 | Bacteria | 1419 |
| 622 | Ga0496121_0212495 | 3300048924 | Bacteria | 1369 |
| 623 | Ga0496121_0235287 | 3300048924 | Bacteria | 1280 |
| 624 | Ga0496121_0343443 | 3300048924 | Bacteria | 997 |
| 625 | Ga0496122_0056773 | 3300048925 | Bacteria | 2915 |
| 626 | Ga0496124_0501360 | 3300048927 | Bacteria | 814 |
| 627 | Ga0496125_0036077 | 3300048928 | Bacteria | 4324 |
| 628 | Ga0496125_0130278 | 3300048928 | Bacteria | 1772 |
| 629 | Ga0496125_0192633 | 3300048928 | Bacteria | 1344 |
| 630 | Ga0496125_0237682 | 3300048928 | Bacteria | 1159 |
| 631 | Ga0496126_0021458 | 3300048929 | Bacteria | 6306 |
| 632 | Ga0496126_0073568 | 3300048929 | Bacteria | 3037 |
| 633 | Ga0496126_0180249 | 3300048929 | Bacteria | 1795 |
| 634 | Ga0496126_0236647 | 3300048929 | Bacteria | 1527 |
| 635 | Ga0496126_0255698 | 3300048929 | Bacteria | 1458 |
| 636 | Ga0496126_0291159 | 3300048929 | Bacteria | 1350 |
| 637 | Ga0496126_0307291 | 3300048929 | Bacteria | 1306 |
| 638 | Ga0495682_0059826 | 3300049460 | Bacteria | 1376 |
| 639 | Ga0501031_0067076 | 3300049568 | Bacteria | 2338 |
| 640 | Ga0501032_0127464 | 3300049569 | Bacteria | 1680 |
| 641 | Ga0501033_0042269 | 3300049570 | Bacteria | 3398 |
| 642 | Ga0501034_0130715 | 3300049571 | Bacteria | 2494 |
| 643 | Ga0501036_0078810 | 3300049572 | Bacteria | 2786 |
| 644 | Ga0501036_0342315 | 3300049572 | Bacteria | 1249 |
| 645 | Ga0501038_0169176 | 3300049574 | Bacteria | 1770 |
| 646 | Ga0501039_0042185 | 3300049575 | Bacteria | 3525 |
| 647 | Ga0501046_0085782 | 3300049580 | Bacteria | 2427 |
| 648 | Ga0501046_0159344 | 3300049580 | Bacteria | 1698 |
| 649 | Ga0501047_0128083 | 3300049581 | Bacteria | 2418 |
| 650 | Ga0501048_0075701 | 3300049582 | Bacteria | 2375 |
| 651 | Ga0501067_0606110 | 3300049583 | Bacteria | 614 |
| 652 | Ga0501070_0052265 | 3300049586 | Bacteria | 3391 |
| 653 | Ga0501070_0075254 | 3300049586 | Bacteria | 2795 |
| 654 | Ga0501071_0132872 | 3300049587 | Bacteria | 1850 |
| 655 | Ga0501074_0032975 | 3300049590 | Bacteria | 3753 |
| 656 | Ga0501074_0092394 | 3300049590 | Bacteria | 2167 |
| 657 | Ga0501079_0286475 | 3300049741 | Bacteria | 1288 |
| 658 | Ga0501080_0004892 | 3300049742 | Bacteria | 11942 |
| 659 | Ga0501080_0167470 | 3300049742 | Bacteria | 2027 |
| 660 | Ga0501044_0086872 | 3300049823 | Bacteria | 3159 |
| 661 | Ga0501044_1382913 | 3300049823 | Bacteria | 569 |
| 662 | nmdc:mga00v17_162327_c1 | 3300050491 | Bacteria | 1439 |
| 663 | nmdc:mga00v17_70575_c1 | 3300050491 | Bacteria | 2164 |
| 664 | nmdc:mga0yw44_190730_c1 | 3300050492 | Bacteria | 1352 |
| 665 | nmdc:mga0k408_209435_c1 | 3300050493 | Bacteria | 1164 |
| 666 | nmdc:mga0k408_869509_c1 | 3300050493 | Bacteria | 524 |
| 667 | nmdc:mga07m45_368410_c1 | 3300050496 | Bacteria | 835 |
| 668 | nmdc:mga05p37_213133_c1 | 3300050507 | Bacteria | 2334 |
| 669 | nmdc:mga0qj67_309975_c1 | 3300050509 | Bacteria | 1278 |
| 670 | nmdc:mga08y16_1404567_c1 | 3300050511 | Bacteria | 661 |
| 671 | nmdc:mga0rr50_128322_c1 | 3300050513 | Bacteria | 2027 |
| 672 | nmdc:mga08x19_156422_c1 | 3300050514 | Bacteria | 1546 |
| 673 | nmdc:mga0sz30_142571_c1 | 3300050516 | Bacteria | 1058 |
| 674 | nmdc:mga0sz30_156936_c1 | 3300050516 | Bacteria | 1008 |
| 675 | nmdc:mga0sz30_86682_c2 | 3300050516 | Bacteria | 785 |
| 676 | nmdc:mga0sz30_93636_c1 | 3300050516 | Bacteria | 1309 |
| 677 | Ga0495601_0218484 | 3300053077 | Bacteria | 1245 |
| 678 | Ga0495601_0261416 | 3300053077 | Bacteria | 1130 |
| 679 | Ga0495612_0065275 | 3300053078 | Bacteria | 1512 |
| 680 | Ga0500635_0055646 | 3300053080 | Bacteria | 1367 |
| 681 | Ga0495595_0048111 | 3300053084 | Bacteria | 1969 |
| 682 | Ga0495619_0296705 | 3300053085 | Bacteria | 1120 |
| 683 | Ga0500578_0073568 | 3300053086 | Bacteria | 2177 |
| 684 | Ga0500578_0151304 | 3300053086 | Bacteria | 1445 |
| 685 | Ga0500578_0298316 | 3300053086 | Bacteria | 956 |
| 686 | Ga0500643_000231 | 3300053087 | Bacteria | 51641 |
| 687 | Ga0500644_0216071 | 3300053088 | Bacteria | 798 |
| 688 | Ga0500647_0022727 | 3300053091 | Bacteria | 2937 |
| 689 | Ga0500583_0038068 | 3300053092 | Bacteria | 2163 |
| 690 | Ga0500651_0025302 | 3300053093 | Bacteria | 3724 |
| 691 | Ga0500566_0000931 | 3300053094 | Bacteria | 16746 |
| 692 | Ga0500641_0164704 | 3300053096 | Bacteria | 955 |
| 693 | Ga0500650_0291985 | 3300053098 | Bacteria | 723 |
| 694 | Ga0500555_002267 | 3300053103 | Bacteria | 5601 |
| 695 | Ga0500555_097694 | 3300053103 | Bacteria | 749 |
| 696 | Ga0500556_0264943 | 3300053104 | Bacteria | 675 |
| 697 | Ga0500557_000179 | 3300053105 | Bacteria | 12626 |
| 698 | Ga0500562_011871 | 3300053108 | Bacteria | 2213 |
| 699 | Ga0500569_010567 | 3300053109 | Bacteria | 2180 |
| 700 | Ga0500572_000668 | 3300053111 | Bacteria | 11350 |
| 701 | Ga0500572_007171 | 3300053111 | Bacteria | 2575 |
| 702 | Ga0500608_122841 | 3300053122 | Bacteria | 1175 |
| 703 | Ga0500642_0000087 | 3300053130 | Bacteria | 48287 |
| 704 | Ga0500652_335308 | 3300053131 | Bacteria | 576 |
| 705 | Ga0500658_0073809 | 3300053134 | Bacteria | 1445 |
| 706 | Ga0500559_0017216 | 3300053136 | Bacteria | 3051 |
| 707 | Ga0500568_0045168 | 3300053139 | Bacteria | 1754 |
| 708 | Ga0500577_0213391 | 3300053142 | Bacteria | 834 |
| 709 | Ga0500604_0137025 | 3300053151 | Bacteria | 825 |
| 710 | Ga0500616_0097472 | 3300053153 | Bacteria | 1443 |
| 711 | Ga0500622_0004589 | 3300053156 | Bacteria | 8601 |
| 712 | Ga0500627_0008055 | 3300053158 | Bacteria | 3718 |
| 713 | Ga0500634_0065140 | 3300053161 | Bacteria | 1924 |
| 714 | Ga0500638_095670 | 3300053162 | Bacteria | 1392 |
| 715 | Ga0500639_002805 | 3300053163 | Bacteria | 8756 |
| 716 | Ga0500636_0033935 | 3300053177 | Bacteria | 3019 |
| 717 | Ga0500636_0523645 | 3300053177 | Bacteria | 519 |
| 718 | Ga0500570_144234 | 3300053724 | Bacteria | 866 |
| 719 | Ga0500611_052493 | 3300053727 | Bacteria | 939 |
| 720 | Ga0500645_007988 | 3300053730 | Bacteria | 3645 |
| 721 | Ga0500645_155811 | 3300053730 | Bacteria | 627 |
| 722 | Ga0500609_033795 | 3300053731 | Bacteria | 704 |
| 723 | Ga0500596_001693 | 3300053735 | Bacteria | 4468 |
| 724 | Ga0500596_013426 | 3300053735 | Bacteria | 1237 |
| 725 | Ga0500596_020443 | 3300053735 | Bacteria | 996 |
| 726 | Ga0500599_001236 | 3300053736 | Bacteria | 2916 |
| 727 | Ga0501084_0199140 | 3300054114 | Bacteria | 1690 |
| 728 | Ga0501084_0499665 | 3300054114 | Bacteria | 1028 |
| 729 | Ga0500661_016839 | 3300055283 | Bacteria | 1306 |
| 730 | Ga0466962_0077533 | 3300061719 | Bacteria | 1589 |
| 731 | Ga0530510_0480126 | 3300061734 | Bacteria | 941 |
| 732 | 2507504688 | 2507262055 | Bacteria | 8048963 |
| 733 | 2508539895 | 2508501009 | Bacteria | 7784016 |
| 734 | 2508694970 | 2508501042 | Bacteria | 8719808 |
| 735 | 2509149921 | 2508501128 | Bacteria | 8613869 |
| 736 | 2513625618 | 2513237092 | Bacteria | 8341956 |
| 737 | 2513652996 | 2513237095 | Bacteria | 8976980 |
| 738 | 2513701748 | 2513237102 | Bacteria | 7703324 |
| 739 | 2513874029 | 2513237139 | Bacteria | 8737671 |
| 740 | 2513889659 | 2513237141 | Bacteria | 8496279 |
| 741 | 2515627774 | 2515154112 | Bacteria | 8294334 |
| 742 | 2528850591 | 2528768022 | Bacteria | 10457665 |
| 743 | 2617377148 | 2617270741 | Bacteria | 8201522 |
| 744 | 2805920387 | 2802429603 | Bacteria | 8777136 |
| 745 | 2818243503 | 2816332527 | Bacteria | 8933356 |
| 746 | 2824605825 | 2824600985 | Bacteria | 8488197 |
| 747 | 2824611961 | 2824609381 | Bacteria | 8672835 |
| 748 | 2824622837 | 2824617872 | Bacteria | 8814715 |
| 749 | 2824631926 | 2824626560 | Bacteria | 8813858 |
| 750 | 2824639127 | 2824635225 | Bacteria | 8785348 |
| 751 | 2824650741 | 2824644064 | Bacteria | 8743947 |
| 752 | 2824658792 | 2824653114 | Bacteria | 8493680 |
| 753 | 2824664310 | 2824661429 | Bacteria | 9877870 |
| 754 | 2824676900 | 2824671348 | Bacteria | 8369588 |
| 755 | 2824693277 | 2824687955 | Bacteria | 8360029 |
| 756 | 2824701521 | 2824696289 | Bacteria | 8335049 |
| 757 | 2824719443 | 2824714736 | Bacteria | 8717648 |
| 758 | 2824732612 | 2824723954 | Bacteria | 8758240 |
| 759 | 2824734125 | 2824732956 | Bacteria | 7810675 |
| 760 | 2824749187 | 2824746037 | Bacteria | 7911610 |
| 761 | 2824780108 | 2824773399 | Bacteria | 8360218 |
| 762 | 2841942719 | 2841941048 | Bacteria | 8688029 |
| 763 | 2841952929 | 2841949485 | Bacteria | 8680857 |
| 764 | 2841971042 | 2841966195 | Bacteria | 8673214 |
| 765 | 2842049583 | 2842045827 | Bacteria | 8006841 |
| 766 | 2847943065 | 2847939898 | Bacteria | 8606328 |
| 767 | 2857515773 | 2857509624 | Bacteria | 7472071 |
| 768 | 2874593713 | 2874590934 | Bacteria | 8299676 |
| 769 | 2874647976 | 2874645413 | Bacteria | 8214782 |
| 770 | 2876772804 | 2876771140 | Bacteria | 8287509 |
| 771 | 2876826467 | 2876818435 | Bacteria | 8274608 |
| 772 | 2879077500 | 2879074833 | Bacteria | 8279565 |
| 773 | 2879089968 | 2879083081 | Bacteria | 8587928 |
| 774 | 2879105506 | 2879099564 | Bacteria | 10442239 |
| 775 | 2879134396 | 2879127579 | Bacteria | 8294491 |
| 776 | 2879147355 | 2879142872 | Bacteria | 8267021 |
| 777 | 2881666090 | 2881665667 | Bacteria | 8175609 |
| 778 | 2885369066 | 2885366525 | Bacteria | 8326213 |
| 779 | 2888378859 | 2888378607 | Bacteria | 9652610 |
| 780 | 2888427286 | 2888419890 | Bacteria | 7857137 |
| 781 | 2889036116 | 2889033259 | Bacteria | 9099371 |
| 782 | 2904669393 | 2904666416 | Bacteria | 8226587 |
| 783 | 2906645611 | 2906643746 | Bacteria | 8722424 |
| 784 | 2908783062 | 2908775508 | Bacteria | 8092255 |
| 785 | 2922377718 | |||
| 786 | 2922389183 | 2922386360 | Bacteria | 7017218 |
| 787 | 2929623313 | 2929615660 | Bacteria | 9193770 |
| 788 | 2929632596 | 2929624759 | Bacteria | 9339455 |
| 789 | 2932789207 | 2932784394 | Bacteria | 9704911 |
| 790 | 2932818133 | 2932809354 | Bacteria | 9135765 |
| 791 | 2932820283 | 2932818245 | Bacteria | 9955613 |
| 792 | 2932834457 | 2932828146 | Bacteria | 9745859 |
| 793 | 2933585216 | 2933577622 | Bacteria | 9116884 |
| 794 | 2935615117 | 2935608549 | Bacteria | 8203142 |
| 795 | 2935620140 | 2935616580 | Bacteria | 9032984 |
| 796 | 2935640458 | 2935638405 | Bacteria | 10015038 |
| 797 | 2935651526 | 2935648319 | Bacteria | 8801166 |
| 798 | 2935659706 | 2935656913 | Bacteria | 8965014 |
| 799 | 2935668652 | 2935665750 | Bacteria | 9571747 |
| 800 | 2935681954 | 2935675223 | Bacteria | 9928132 |
| 801 | 2935686960 | 2935684952 | Bacteria | 9590419 |
| 802 | 2935697070 | 2935694250 | Bacteria | 9291695 |
| 803 | 2935709838 | 2935703347 | Bacteria | 10242284 |
| 804 | 2935716648 | 2935713505 | Bacteria | 9608509 |
| 805 | 2935723227 | 2935722832 | Bacteria | 9608746 |
| 806 | 2935734784 | 2935732158 | Bacteria | 9706831 |
| 807 | 2935744425 | 2935741537 | Bacteria | 9707219 |
| 808 | 2935752926 | 2935750917 | Bacteria | 9590372 |
| 809 | 2935766824 | 2935760218 | Bacteria | 9817913 |
| 810 | 2935779697 | 2935777560 | Bacteria | 8077691 |
| 811 | 2935789685 | 2935785616 | Bacteria | 7962367 |
| 812 | 2935797947 | 2935793552 | Bacteria | 8012592 |
| 813 | 2935804572 | 2935801545 | Bacteria | 9301974 |
| 814 | 2935818212 | 2935810662 | Bacteria | 9401221 |
| 815 | 2935825845 | 2935819856 | Bacteria | 8261050 |
| 816 | 2935831964 | 2935827899 | Bacteria | 10038562 |
| 817 | 2935841204 | 2935837841 | Bacteria | 9454360 |
| 818 | 2935851464 | 2935847175 | Bacteria | 8228321 |
| 819 | 2935859026 | 2935855204 | Bacteria | 9035059 |
| 820 | 2935864207 | 2935864058 | Bacteria | 9784707 |
| 821 | 2935875441 | 2935873716 | Bacteria | 9632195 |
| 822 | 2935910510 | 2935908558 | Bacteria | 8568796 |
| 823 | 2935918086 | 2935916978 | Bacteria | 9113783 |
| 824 | 2935927579 | 2935926038 | Bacteria | 8601059 |
| 825 | 2935936549 | 2935934488 | Bacteria | 8602579 |
| 826 | 2935943898 | 2935942939 | Bacteria | 8599779 |
| 827 | 2935952335 | 2935951376 | Bacteria | 8602333 |
| 828 | 2935964003 | 2935959822 | Bacteria | 7869783 |
| 829 | 2935969175 | 2935967501 | Bacteria | 8603075 |
| 830 | 2935978439 | 2935975950 | Bacteria | 8347125 |
| 831 | 2935984628 | 2935984226 | Bacteria | 8302647 |
| 832 | 2935995580 | 2935992306 | Bacteria | 9802711 |
| 833 | 2936008000 | 2936002035 | Bacteria | 9362176 |
| 834 | 2936014122 | 2936011229 | Bacteria | 8801034 |
| 835 | 2936022969 | 2936019824 | Bacteria | 8804134 |
| 836 | 2936031105 | 2936028420 | Bacteria | 8965941 |
| 837 | 2936044822 | 2936037263 | Bacteria | 9446081 |
| 838 | 2936049227 | 2936046547 | Bacteria | 8903709 |
| 839 | 2936055673 | 2936055302 | Bacteria | 8785755 |
| 840 | 2940558839 | 2940556831 | Bacteria | 9590747 |
| 841 | 2941543430 | 2941538514 | Bacteria | 9402094 |
| 842 | 3005506429 | 3005506211 | Bacteria | 6943378 |
| 843 | 3005588923 | 3005587118 | Bacteria | 7794411 |
| 844 | 3005595588 | 3005594810 | Bacteria | 8716512 |
| 845 | 3005718838 | 3005718088 | Bacteria | 8283608 |
| 846 | 8016517585 | 8016511872 | Bacteria | 9921665 |
| 847 | 8016549740 | 8016548790 | Bacteria | 8155074 |
| 848 | 8016558158 | 8016557553 | Bacteria | 8154380 |
| 849 | 8016581597 | 8016575299 | Bacteria | 8154085 |
| 850 | 8016596163 | 8016595262 | Bacteria | 8149947 |
| 851 | 8016607063 | 8016603502 | Bacteria | 8731218 |
| 852 | 8016636468 | 8016630954 | Bacteria | 9217207 |
| 853 | 8017059036 | 8017057580 | Bacteria | 10023680 |
| 854 | 8019541049 | 8019538911 | Bacteria | 7872763 |
| 855 | 8019576603 | 8019576017 | Bacteria | 10049540 |
| 856 | 8019594478 | 8019586578 | Bacteria | 10212056 |
| 857 | 8019607084 | 8019597564 | Bacteria | 10041141 |
| 858 | 8019611424 | 8019608314 | Bacteria | 10042931 |
| 859 | 8019622204 | 8019619141 | Bacteria | 9218857 |
| 860 | 8019631112 | 8019629233 | Bacteria | 8687553 |
| 861 | 8019639512 | 8019638758 | Bacteria | 9062356 |
| 862 | 8019677333 | 8019668869 | Bacteria | 8791617 |
| 863 | 8019696865 | 8019687851 | Bacteria | 8712826 |
| 864 | 8055743255 | 8055742211 | Bacteria | 9226248 |
| 865 | 8056678435 | 8056673599 | Bacteria | 7871253 |
| 866 | 8056970696 | 8056967851 | Bacteria | 9038162 |
| 867 | Ga0501032_0400493 | |||
| 868 | JGI25153J46596_10033514 | |||
| 869 | JGI25153J46596_10037071 | |||
| 870 | JGI25160J50197_1013318 | |||
| 871 | Ga0055539_1009637 | |||
| 872 | Ga0055531_10015632 | |||
| 873 | Ga0065165_1012522 | |||
| 874 | Ga0065165_1077129 | |||
| 875 | Ga0070658_10262669 | |||
| 876 | Ga0070683_100067645 | |||
| 877 | Ga0070683_100070645 | |||
| 878 | Ga0070670_101051257 | |||
| 879 | Ga0070666_10407866 | |||
| 880 | Ga0070680_100038360 | |||
| 881 | Ga0070682_100030995 | |||
| 882 | Ga0068868_100824741 | |||
| 883 | Ga0070660_100016551 | |||
| 884 | Ga0070689_100762774 | |||
| 885 | Ga0070691_10047567 | |||
| 886 | Ga0070661_100666481 | |||
| 887 | Ga0070661_100922997 | |||
| 888 | Ga0070692_10635626 | |||
| 889 | Ga0070668_100291738 | |||
| 890 | Ga0070668_100368644 | |||
| 891 | Ga0070668_100742232 | |||
| 892 | Ga0070668_101065366 | |||
| 893 | Ga0070669_100096348 | |||
| 894 | Ga0070671_100953668 | |||
| 895 | Ga0070659_100246541 | |||
| 896 | Ga0070667_100472482 | |||
| 897 | Ga0070709_10165845 | |||
| 898 | Ga0070709_10182234 | |||
| 899 | Ga0070714_100050500 | |||
| 900 | Ga0070714_100111422 | |||
| 901 | Ga0070713_100014007 | |||
| 902 | Ga0070713_100450610 | |||
| 903 | Ga0070710_10293085 | |||
| 904 | Ga0070711_100024318 | |||
| 905 | Ga0070663_100108980 | |||
| 906 | Ga0070663_100348478 | |||
| 907 | Ga0070678_100060242 | |||
| 908 | Ga0070678_100275500 | |||
| 909 | Ga0070678_100847761 | |||
| 910 | Ga0070662_100301729 | |||
| 911 | Ga0070681_10080143 | |||
| 912 | Ga0070681_10140566 | |||
| 913 | Ga0070681_10262104 | |||
| 914 | Ga0070681_10572299 | |||
| 915 | Ga0070685_10183029 | |||
| 916 | Ga0070707_100216548 | |||
| 917 | Ga0070679_100304289 | |||
| 918 | Ga0070679_100557305 | |||
| 919 | Ga0070684_100005197 | |||
| 920 | Ga0070684_100073578 | |||
| 921 | Ga0070697_100508499 | |||
| 922 | Ga0068853_100156985 | |||
| 923 | Ga0068853_100329145 | |||
| 924 | Ga0068853_100457636 | |||
| 925 | Ga0070693_100722044 | |||
| 926 | Ga0070665_100120177 | |||
| 927 | Ga0070665_100454604 | |||
| 928 | Ga0070665_100945123 | |||
| 929 | Ga0068855_100324958 | |||
| 930 | Ga0068855_100350463 | |||
| 931 | Ga0070664_100149720 | |||
| 932 | Ga0070664_100300874 | |||
| 933 | Ga0070664_101111841 | |||
| 934 | Ga0068857_100639548 | |||
| 935 | Ga0068857_100930309 | |||
| 936 | Ga0068854_100108189 | |||
| 937 | Ga0068854_100225483 | |||
| 938 | Ga0068856_100333155 | |||
| 939 | Ga0068852_100133685 | |||
| 940 | Ga0068852_100195359 | |||
| 941 | Ga0068852_100432784 | |||
| 942 | Ga0068852_101619923 | |||
| 943 | Ga0068859_100606613 | |||
| 944 | Ga0068864_100282186 | |||
| 945 | Ga0068851_10099579 | |||
| 946 | Ga0068863_100346762 | |||
| 947 | Ga0068863_100358896 | |||
| 948 | Ga0068863_100536403 | |||
| 949 | Ga0068863_101075487 | |||
| 950 | Ga0068858_100186244 | |||
| 951 | Ga0068858_100406503 | |||
| 952 | Ga0068858_100515121 | |||
| 953 | Ga0068860_100533251 | |||
| 954 | Ga0068860_101077660 | |||
| 955 | Ga0068862_100378117 | |||
| 956 | Ga0081540_1047384 | |||
| 957 | Ga0081540_1070925 | |||
| 958 | Ga0081539_10088217 | |||
| 959 | Ga0070717_10002055 | |||
| 960 | Ga0070717_10025850 | |||
| 961 | Ga0075365_10206647 | |||
| 962 | Ga0075365_10232508 | |||
| 963 | Ga0075365_10234257 | |||
| 964 | Ga0075365_10364252 | |||
| 965 | Ga0075365_10622319 | |||
| 966 | Ga0075368_10009616 | |||
| 967 | Ga0075363_100247745 | |||
| 968 | Ga0075363_100264538 | |||
| 969 | Ga0075363_100379374 | |||
| 970 | Ga0075364_10152558 | |||
| 971 | Ga0075364_10262342 | |||
| 972 | Ga0075364_10277744 | |||
| 973 | Ga0070716_100256662 | |||
| 974 | Ga0070716_100719448 | |||
| 975 | Ga0070712_100036410 | |||
| 976 | Ga0075362_10059419 | |||
| 977 | Ga0075367_10218165 | |||
| 978 | Ga0075367_10324487 | |||
| 979 | Ga0075367_10364528 | |||
| 980 | Ga0075367_10596566 | |||
| 981 | Ga0075369_10181476 | |||
| 982 | Ga0075369_10211103 | |||
| 983 | Ga0075369_10286017 | |||
| 984 | Ga0075366_10018305 | |||
| 985 | Ga0075366_10143689 | |||
| 986 | Ga0075366_10479434 | |||
| 987 | Ga0097621_100672367 | |||
| 988 | Ga0075370_10234397 | |||
| 989 | Ga0075370_10248780 | |||
| 990 | Ga0068871_100454545 | |||
| 991 | Ga0075428_100338329 | |||
| 992 | Ga0097620_100606605 | |||
| 993 | Ga0099823_1085769 | |||
| 994 | Ga0075435_100142716 | |||
| 995 | Ga0105240_10001522 | |||
| 996 | Ga0105240_10039101 | |||
| 997 | Ga0105240_10118623 | |||
| 998 | Ga0105240_10377122 | |||
| 999 | Ga0105245_10185096 | |||
| 1000 | Ga0105245_10968557 | |||
| 1001 | Ga0105247_10181651 | |||
| 1002 | Ga0105247_10190188 | |||
| 1003 | Ga0105247_10209937 | |||
| 1004 | Ga0114129_10186448 | |||
| 1005 | Ga0105243_10907816 | |||
| 1006 | Ga0105241_10213333 | |||
| 1007 | Ga0105242_10201271 | |||
| 1008 | Ga0105248_10127908 | |||
| 1009 | Ga0105248_10451617 | |||
| 1010 | Ga0105248_10937152 | |||
| 1011 | Ga0105237_10043065 | |||
| 1012 | Ga0105237_10081784 | |||
| 1013 | Ga0105237_10173918 | |||
| 1014 | Ga0105237_10207163 | |||
| 1015 | Ga0105237_10543982 | |||
| 1016 | Ga0105237_10786368 | |||
| 1017 | Ga0105237_10836987 | |||
| 1018 | Ga0105238_10545277 | |||
| 1019 | Ga0105238_11112038 | |||
| 1020 | Ga0105238_11404517 | |||
| 1021 | Ga0105249_10546486 | |||
| 1022 | Ga0099796_10022000 | |||
| 1023 | Ga0105239_10175070 | |||
| 1024 | Ga0105239_10664518 | |||
| 1025 | Ga0105239_11087032 | |||
| 1026 | Ga0105239_11165830 | |||
| 1027 | Ga0105239_11373142 | |||
| 1028 | Ga0105239_11609889 | |||
| 1029 | Ga0105239_11614904 | |||
| 1030 | Ga0105246_10048250 | |||
| 1031 | Ga0105246_10859604 | |||
| 1032 | Ga0157314_1003836 | |||
| 1033 | Ga0157371_10136557 | |||
| 1034 | Ga0157370_10077383 | |||
| 1035 | Ga0157370_10519605 | |||
| 1036 | Ga0157370_10655669 | |||
| 1037 | Ga0157369_10010577 | |||
| 1038 | Ga0157369_10111832 | |||
| 1039 | Ga0157369_10194618 | |||
| 1040 | Ga0157374_10229486 | |||
| 1041 | Ga0157374_11277486 | |||
| 1042 | Ga0157378_11164949 | |||
| 1043 | Ga0157378_11362339 | |||
| 1044 | Ga0163162_10473514 | |||
| 1045 | Ga0163162_11186576 | |||
| 1046 | Ga0163162_11315793 | |||
| 1047 | Ga0163162_11664201 | |||
| 1048 | Ga0157372_10231909 | |||
| 1049 | Ga0157372_10507255 | |||
| 1050 | Ga0157372_11521526 | |||
| 1051 | Ga0157372_12070924 | |||
| 1052 | Ga0157375_10457366 | |||
| 1053 | Ga0157375_10535403 | |||
| 1054 | Ga0163163_10096851 | |||
| 1055 | Ga0163163_10167718 | |||
| 1056 | Ga0157380_10759698 | |||
| 1057 | Ga0157380_11412267 | |||
| 1058 | Ga0157379_10065931 | |||
| 1059 | Ga0157376_10160668 | |||
| 1060 | Ga0157376_10601087 | |||
| 1061 | Ga0157376_10632910 | |||
| 1062 | Ga0163161_10277455 | |||
| 1063 | Ga0163161_10517824 | |||
| 1064 | Ga0163161_10790537 | |||
| 1065 | Ga0214544_1000007 | |||
| 1066 | Ga0214542_1000216 | |||
| 1067 | Ga0214542_1042175 | |||
| 1068 | Ga0214545_1000118 | |||
| 1069 | Ga0214545_1043334 | |||
| 1070 | Ga0214543_1000009 | |||
| 1071 | Ga0213872_10166416 | |||
| 1072 | Ga0213874_10030678 | |||
| 1073 | Ga0213876_10022972 | |||
| 1074 | Ga0224712_10136980 | |||
| 1075 | Ga0209563_103176 | |||
| 1076 | Ga0209677_100296 | |||
| 1077 | Ga0209677_106519 | |||
| 1078 | Ga0209148_1001484 | |||
| 1079 | Ga0209233_1006650 | |||
| 1080 | Ga0209564_1021748 | |||
| 1081 | Ga0209758_1000030 | |||
| 1082 | Ga0209758_1000429 | |||
| 1083 | Ga0209758_1006708 | |||
| 1084 | Ga0209758_1033130 | |||
| 1085 | Ga0209758_1034727 | |||
| 1086 | Ga0209256_1002159 | |||
| 1087 | Ga0207426_1001158 | |||
| 1088 | Ga0207426_1008203 | |||
| 1089 | Ga0207426_1078254 | |||
| 1090 | Ga0209257_1005466 | |||
| 1091 | Ga0209257_1026629 | |||
| 1092 | Ga0207710_10108429 | |||
| 1093 | Ga0207710_10244828 | |||
| 1094 | Ga0207688_10049994 | |||
| 1095 | Ga0207680_10476417 | |||
| 1096 | Ga0207647_10017521 | |||
| 1097 | Ga0207647_10191221 | |||
| 1098 | Ga0207699_10241754 | |||
| 1099 | Ga0207645_10385829 | |||
| 1100 | Ga0207705_10048892 | |||
| 1101 | Ga0207705_10168126 | |||
| 1102 | Ga0207684_10073655 | |||
| 1103 | Ga0207654_10253672 | |||
| 1104 | Ga0207707_10016071 | |||
| 1105 | Ga0207707_10082019 | |||
| 1106 | Ga0207707_10185538 | |||
| 1107 | Ga0207707_10269126 | |||
| 1108 | Ga0207695_10000006 | |||
| 1109 | Ga0207671_10498170 | |||
| 1110 | Ga0207671_10498693 | |||
| 1111 | Ga0207671_10558395 | |||
| 1112 | Ga0207671_10585255 | |||
| 1113 | Ga0207671_10692660 | |||
| 1114 | Ga0207693_10037984 | |||
| 1115 | Ga0207663_10018567 | |||
| 1116 | Ga0207657_10003442 | |||
| 1117 | Ga0207657_10208275 | |||
| 1118 | Ga0207652_10015649 | |||
| 1119 | Ga0207652_10270126 | |||
| 1120 | Ga0207681_10475865 | |||
| 1121 | Ga0207694_10243918 | |||
| 1122 | Ga0207694_10362224 | |||
| 1123 | Ga0207694_11148492 | |||
| 1124 | Ga0207650_10694664 | |||
| 1125 | Ga0207700_10004386 | |||
| 1126 | Ga0207700_10036905 | |||
| 1127 | Ga0207700_10359390 | |||
| 1128 | Ga0207664_10112953 | |||
| 1129 | Ga0207664_10175510 | |||
| 1130 | Ga0207644_10122338 | |||
| 1131 | Ga0207690_10029081 | |||
| 1132 | Ga0207690_10673141 | |||
| 1133 | Ga0207690_10702476 | |||
| 1134 | Ga0207706_10163428 | |||
| 1135 | Ga0207669_10865854 | |||
| 1136 | Ga0207665_10220392 | |||
| 1137 | Ga0207665_10429433 | |||
| 1138 | Ga0207665_10611723 | |||
| 1139 | Ga0207691_10580733 | |||
| 1140 | Ga0207711_10323460 | |||
| 1141 | Ga0207689_10939625 | |||
| 1142 | Ga0207661_10000379 | |||
| 1143 | Ga0207661_10042228 | |||
| 1144 | Ga0207679_10144070 | |||
| 1145 | Ga0207679_10520126 | |||
| 1146 | Ga0207679_10886879 | |||
| 1147 | Ga0207679_11449195 | |||
| 1148 | Ga0207667_10226493 | |||
| 1149 | Ga0207651_10749486 | |||
| 1150 | Ga0207712_11183865 | |||
| 1151 | Ga0207668_10055426 | |||
| 1152 | Ga0207668_10292695 | |||
| 1153 | Ga0207668_10909319 | |||
| 1154 | Ga0207640_11174499 | |||
| 1155 | Ga0207658_10909768 | |||
| 1156 | Ga0207677_10038493 | |||
| 1157 | Ga0207677_10767693 | |||
| 1158 | Ga0207703_10181174 | |||
| 1159 | Ga0207639_10086651 | |||
| 1160 | Ga0207639_10184081 | |||
| 1161 | Ga0207639_10313636 | |||
| 1162 | Ga0207639_11012424 | |||
| 1163 | Ga0207639_11217732 | |||
| 1164 | Ga0207678_10077612 | |||
| 1165 | Ga0207678_10174915 | |||
| 1166 | Ga0207678_10975831 | |||
| 1167 | Ga0207702_10229166 | |||
| 1168 | Ga0207702_10285899 | |||
| 1169 | Ga0207702_10337813 | |||
| 1170 | Ga0207702_10480126 | |||
| 1171 | Ga0207641_10513023 | |||
| 1172 | Ga0207648_10593045 | |||
| 1173 | Ga0207648_10821384 | |||
| 1174 | Ga0207676_10405994 | |||
| 1175 | Ga0207676_11325365 | |||
| 1176 | Ga0207674_10663277 | |||
| 1177 | Ga0207674_11046140 | |||
| 1178 | Ga0207675_100157667 | |||
| 1179 | Ga0207675_100953586 | |||
| 1180 | Ga0207683_10089043 | |||
| 1181 | Ga0207683_10147116 | |||
| 1182 | Ga0207683_10488983 | |||
| 1183 | Ga0207683_11075637 | |||
| 1184 | Ga0207698_10143546 | |||
| 1185 | Ga0207698_10158800 | |||
| 1186 | Ga0209389_1000015 | |||
| 1187 | Ga0209389_1000035 | |||
| 1188 | Ga0209589_1000039 | |||
| 1189 | Ga0209489_100072 | |||
| 1190 | Ga0209489_100084 | |||
| 1191 | Ga0209700_100034 | |||
| 1192 | Ga0209813_10020652 | |||
| 1193 | Ga0268266_10033807 | |||
| 1194 | Ga0268266_10039481 | |||
| 1195 | Ga0268266_10392170 | |||
| 1196 | Ga0268266_11075393 | |||
| 1197 | Ga0268264_10776862 | |||
| 1198 | Ga0268264_10908123 | |||
| 1199 | Ga0307517_10000066 | |||
| 1200 | Ga0265340_10078084 | |||
| 1201 | Ga0265339_10002540 | |||
| 1202 | Ga0307508_10023991 | |||
| 1203 | Ga0307516_10334304 | |||
| 1204 | Ga0307405_10580691 | |||
| 1205 | Ga0307405_10781400 | |||
| 1206 | Ga0307407_10330785 | |||
| 1207 | Ga0307412_10218952 | |||
| 1208 | Ga0307416_100321671 | |||
| 1209 | Ga0307416_101615683 | |||
| 1210 | Ga0307411_11077849 | |||
| 1211 | Ga0307415_100265892 | |||
| 1212 | Ga0307510_10009663 | |||
| 1213 | Ga0316215_1007381 | |||
| 1214 | Ga0316213_1003479 | |||
| 1215 | Ga0373958_0126472 | |||
| 1216 | Ga0373928_0032860 | |||
| 1217 | Ga0373934_0060865 | |||
| 1218 | Ga0373944_0094694 | |||
| 1219 | Ga0373944_0235089 | |||
| 1220 | Ga0373923_0004740 | |||
| 1221 | Ga0373939_0080834 | |||
| 1222 | Ga0373945_0198753 | |||
| 1223 | Ga0373954_0179668 | |||
| 1224 | Ga0373956_0086675 | |||
| 1225 | Ga0373957_0199298 | |||
| 1226 | Ga0373943_0008271 | |||
| 1227 | Ga0373943_0142886 | |||
| 1228 | Ga0373946_0022042 | |||
| 1229 | Ga0373955_0012972 | |||
| 1230 | Ga0373935_0008474 | |||
| 1231 | Ga0373935_0498589 | |||
| 1232 | Ga0373927_0026977 | |||
| 1233 | Ga0373927_0057019 | |||
| 1234 | Ga0373927_0361617 | |||
| 1235 | Ga0373933_0115072 | |||
| 1236 | Ga0373947_0005615 | |||
| 1237 | Ga0373947_0052888 | |||
| 1238 | Ga0373947_0451247 | |||
| 1239 | Ga0372808_009171 | |||
| 1240 | Ga0373925_0686444 | |||
| 1241 | Ga0373925_0934269 | |||
| 1242 | Ga0395899_0047216 | |||
| 1243 | Ga0395900_0041199 | |||
| 1244 | Ga0395900_0133440 | |||
| 1245 | Ga0395898_0020298 | |||
| 1246 | Ga0395898_0074171 | |||
| 1247 | Ga0395898_0195700 | |||
| 1248 | Ga0395905_0004327 | |||
| 1249 | Ga0395905_0764011 | |||
| 1250 | Ga0395905_0801988 | |||
| 1251 | Ga0436364_0136702 | |||
| 1252 | Ga0436364_1443852 | |||
| 1253 | Ga0395901_0129731 | |||
| 1254 | Ga0395901_0181707 | |||
| 1255 | Ga0395901_1091263 | |||
| 1256 | Ga0436365_0661667 | |||
| 1257 | Ga0436365_1810308 | |||
| 1258 | Ga0436365_1812884 | |||
| 1259 | Ga0436361_0536082 | |||
| 1260 | Ga0436363_1392658 | |||
| 1261 | Ga0451791_0030660 | |||
| 1262 | Ga0451791_1119922 | |||
| 1263 | Ga0451791_1553070 | |||
| 1264 | Ga0451795_0110462 | |||
| 1265 | Ga0451795_0382645 | |||
| 1266 | Ga0451802_0059232 | |||
| 1267 | Ga0451839_1326352 | |||
| 1268 | Ga0451841_0245673 | |||
| 1269 | Ga0451843_1639070 | |||
| 1270 | Ga0451853_2076652 | |||
| 1271 | Ga0466972_0133985 | |||
| 1272 | Ga0466966_0002003 | |||
| 1273 | Ga0466961_0000018 | |||
| 1274 | Ga0466964_0039193 | |||
| 1275 | Ga0466964_0078685 | |||
| 1276 | Ga0466968_0009927 | |||
| 1277 | Ga0466970_0053360 | |||
| 1278 | Ga0466970_0138054 | |||
| 1279 | Ga0466957_0163488 | |||
| 1280 | Ga0466957_0230093 | |||
| 1281 | Ga0466960_0133576 | |||
| 1282 | Ga0466959_0002636 | |||
| 1283 | Ga0466959_0034315 | |||
| 1284 | Ga0466959_0040827 | |||
| 1285 | Ga0466967_0050248 | |||
| 1286 | Ga0466967_0337734 | |||
| 1287 | Ga0495592_0077819 | |||
| 1288 | Ga0495603_0099252 | |||
| 1289 | Ga0495603_0136144 | |||
| 1290 | Ga0495603_0164673 | |||
| 1291 | Ga0495590_0137261 | |||
| 1292 | Ga0495629_0005545 | |||
| 1293 | Ga0495629_0169381 | |||
| 1294 | Ga0495629_0224091 | |||
| 1295 | Ga0495638_0008455 | |||
| 1296 | Ga0495651_0025977 | |||
| 1297 | Ga0495651_0070775 | |||
| 1298 | Ga0495653_0038982 | |||
| 1299 | Ga0495653_0108209 | |||
| 1300 | Ga0495653_0553673 | |||
| 1301 | Ga0495580_0014347 | |||
| 1302 | Ga0495582_0038446 | |||
| 1303 | Ga0495605_0080857 | |||
| 1304 | Ga0495605_0109262 | |||
| 1305 | Ga0495639_0003783 | |||
| 1306 | Ga0495639_0039176 | |||
| 1307 | Ga0495639_0424034 | |||
| 1308 | Ga0495662_0078274 | |||
| 1309 | Ga0495662_0093420 | |||
| 1310 | Ga0495664_0226851 | |||
| 1311 | Ga0495664_0297060 | |||
| 1312 | Ga0495664_0422029 | |||
| 1313 | Ga0495584_0264556 | |||
| 1314 | Ga0495584_0375279 | |||
| 1315 | Ga0495585_0211912 | |||
| 1316 | Ga0495585_0236509 | |||
| 1317 | Ga0495606_0050032 | |||
| 1318 | Ga0495606_0221853 | |||
| 1319 | Ga0495606_0315685 | |||
| 1320 | Ga0495608_0016024 | |||
| 1321 | Ga0495608_0211113 | |||
| 1322 | Ga0495610_0053526 | |||
| 1323 | Ga0495610_0072907 | |||
| 1324 | Ga0495618_0035125 | |||
| 1325 | Ga0495618_0049203 | |||
| 1326 | Ga0495620_0158049 | |||
| 1327 | Ga0495628_0074122 | |||
| 1328 | Ga0495628_0276804 | |||
| 1329 | Ga0495628_0876483 | |||
| 1330 | Ga0495630_0020544 | |||
| 1331 | Ga0495631_0064808 | |||
| 1332 | Ga0495632_0247967 | |||
| 1333 | Ga0495632_0325487 | |||
| 1334 | Ga0495643_0036835 | |||
| 1335 | Ga0495644_0189540 | |||
| 1336 | Ga0495648_0056155 | |||
| 1337 | Ga0495648_0193408 | |||
| 1338 | Ga0495648_0268938 | |||
| 1339 | Ga0495652_0047256 | |||
| 1340 | Ga0495652_0692549 | |||
| 1341 | Ga0495654_0182459 | |||
| 1342 | Ga0495640_0016318 | |||
| 1343 | Ga0495640_0045368 | |||
| 1344 | Ga0495640_0338854 | |||
| 1345 | Ga0495640_0773403 | |||
| 1346 | Ga0495586_0082041 | |||
| 1347 | Ga0495587_0020507 | |||
| 1348 | Ga0495587_0381424 | |||
| 1349 | Ga0495598_0046390 | |||
| 1350 | Ga0495609_0154446 | |||
| 1351 | Ga0495597_0055721 | |||
| 1352 | Ga0495597_0196583 | |||
| 1353 | Ga0495645_0044979 | |||
| 1354 | Ga0495645_0107774 | |||
| 1355 | Ga0495622_0016420 | |||
| 1356 | Ga0495633_0211282 | |||
| 1357 | Ga0495667_0035941 | |||
| 1358 | Ga0495667_0052128 | |||
| 1359 | Ga0495667_0168329 | |||
| 1360 | Ga0495668_0421866 | |||
| 1361 | Ga0495634_0046734 | |||
| 1362 | Ga0495634_0194143 | |||
| 1363 | Ga0495611_0374785 | |||
| 1364 | Ga0495625_0013351 | |||
| 1365 | Ga0495625_0119428 | |||
| 1366 | Ga0495635_0040207 | |||
| 1367 | Ga0495635_0118868 | |||
| 1368 | Ga0495659_0025848 | |||
| 1369 | Ga0495661_0058502 | |||
| 1370 | Ga0495588_0020269 | |||
| 1371 | Ga0495588_0188651 | |||
| 1372 | Ga0495588_0332121 | |||
| 1373 | Ga0495588_0381867 | |||
| 1374 | Ga0495657_0003331 | |||
| 1375 | Ga0495599_0022898 | |||
| 1376 | Ga0495599_0486596 | |||
| 1377 | Ga0495623_0024029 | |||
| 1378 | Ga0495623_0124733 | |||
| 1379 | Ga0495646_0100261 | |||
| 1380 | Ga0495647_0005990 | |||
| 1381 | Ga0495647_0041458 | |||
| 1382 | Ga0495658_0008260 | |||
| 1383 | Ga0495613_0022819 | |||
| 1384 | Ga0495613_0046915 | |||
| 1385 | Ga0495624_0127579 | |||
| 1386 | Ga0495624_0232827 | |||
| 1387 | Ga0495670_0447845 | |||
| 1388 | Ga0495671_0207267 | |||
| 1389 | Ga0495671_0226628 | |||
| 1390 | Ga0495671_0278232 | |||
| 1391 | Ga0495649_0048054 | |||
| 1392 | Ga0495649_0097376 | |||
| 1393 | Ga0495649_0238660 | |||
| 1394 | Ga0495649_0428427 | |||
| 1395 | Ga0495589_0069690 | |||
| 1396 | Ga0495589_0110926 | |||
| 1397 | Ga0495589_0333053 | |||
| 1398 | Ga0495600_0156994 | |||
| 1399 | Ga0495600_0231258 | |||
| 1400 | Ga0495660_0055114 | |||
| 1401 | Ga0495581_0064567 | |||
| 1402 | Ga0495581_0327593 | |||
| 1403 | Ga0495604_0007178 | |||
| 1404 | Ga0495604_0011216 | |||
| 1405 | Ga0495604_0220001 | |||
| 1406 | Ga0495636_0054292 | |||
| 1407 | Ga0495674_0013462 | |||
| 1408 | Ga0495674_0072115 | |||
| 1409 | Ga0495674_0733476 | |||
| 1410 | Ga0495672_0043340 | |||
| 1411 | Ga0495676_0020621 | |||
| 1412 | Ga0495676_0113996 | |||
| 1413 | Ga0495676_0321838 | |||
| 1414 | Ga0495680_0002619 | |||
| 1415 | Ga0495683_0334152 | |||
| 1416 | Ga0495683_0348650 | |||
| 1417 | Ga0495687_081653 | |||
| 1418 | Ga0495675_0007823 | |||
| 1419 | Ga0495679_038314 | |||
| 1420 | Ga0495685_180499 | |||
| 1421 | Ga0495673_0064702 | |||
| 1422 | Ga0495673_0099566 | |||
| 1423 | Ga0495681_0197805 | |||
| 1424 | Ga0495684_0120392 | |||
| 1425 | Ga0495684_0427188 | |||
| 1426 | Ga0495686_0315776 | |||
| 1427 | Ga0495593_0003341 | |||
| 1428 | Ga0495593_0030634 | |||
| 1429 | Ga0495593_0157334 | |||
| 1430 | Ga0495602_0048059 | |||
| 1431 | Ga0495602_0246879 | |||
| 1432 | Ga0495615_0083588 | |||
| 1433 | Ga0495626_0056962 | |||
| 1434 | Ga0495626_0196950 | |||
| 1435 | Ga0496100_0277751 | |||
| 1436 | Ga0496101_0168879 | |||
| 1437 | Ga0496101_0434334 | |||
| 1438 | Ga0496102_0029630 | |||
| 1439 | Ga0496102_0135069 | |||
| 1440 | Ga0496102_0636288 | |||
| 1441 | Ga0496102_0976846 | |||
| 1442 | Ga0496103_0016458 | |||
| 1443 | Ga0496104_0002055 | |||
| 1444 | Ga0496104_0047669 | |||
| 1445 | Ga0496104_0093803 | |||
| 1446 | Ga0496104_0208826 | |||
| 1447 | Ga0496105_0000745 | |||
| 1448 | Ga0496105_0027123 | |||
| 1449 | Ga0496105_0095923 | |||
| 1450 | Ga0496105_0525320 | |||
| 1451 | Ga0496106_0128417 | |||
| 1452 | Ga0496107_0042886 | |||
| 1453 | Ga0496107_0095035 | |||
| 1454 | Ga0496108_0127781 | |||
| 1455 | Ga0496108_0163040 | |||
| 1456 | Ga0496108_1150531 | |||
| 1457 | Ga0496109_0042780 | |||
| 1458 | Ga0496109_0171892 | |||
| 1459 | Ga0496109_0202106 | |||
| 1460 | Ga0496110_0058446 | |||
| 1461 | Ga0496110_0116321 | |||
| 1462 | Ga0496110_0459296 | |||
| 1463 | Ga0496111_0085755 | |||
| 1464 | Ga0496111_0096784 | |||
| 1465 | Ga0496112_0087025 | |||
| 1466 | Ga0496112_0107518 | |||
| 1467 | Ga0496112_0210571 | |||
| 1468 | Ga0496112_0390376 | |||
| 1469 | Ga0496113_0281726 | |||
| 1470 | Ga0496114_0035582 | |||
| 1471 | Ga0496115_0021454 | |||
| 1472 | Ga0496115_0037752 | |||
| 1473 | Ga0496115_0043348 | |||
| 1474 | Ga0496116_0037200 | |||
| 1475 | Ga0496117_0084392 | |||
| 1476 | Ga0496117_0177875 | |||
| 1477 | Ga0496117_0178316 | |||
| 1478 | Ga0496117_0263319 | |||
| 1479 | Ga0496118_0024046 | |||
| 1480 | Ga0496118_0176871 | |||
| 1481 | Ga0496119_0009075 | |||
| 1482 | Ga0496119_0025547 | |||
| 1483 | Ga0496119_0389365 | |||
| 1484 | Ga0496120_0032183 | |||
| 1485 | Ga0496121_0021718 | |||
| 1486 | Ga0496121_0026391 | |||
| 1487 | Ga0496121_0201185 | |||
| 1488 | Ga0496121_0212495 | |||
| 1489 | Ga0496121_0235287 | |||
| 1490 | Ga0496121_0343443 | |||
| 1491 | Ga0496122_0056773 | |||
| 1492 | Ga0496124_0501360 | |||
| 1493 | Ga0496125_0036077 | |||
| 1494 | Ga0496125_0130278 | |||
| 1495 | Ga0496125_0192633 | |||
| 1496 | Ga0496125_0237682 | |||
| 1497 | Ga0496126_0021458 | |||
| 1498 | Ga0496126_0073568 | |||
| 1499 | Ga0496126_0180249 | |||
| 1500 | Ga0496126_0236647 | |||
| 1501 | Ga0496126_0255698 | |||
| 1502 | Ga0496126_0291159 | |||
| 1503 | Ga0496126_0307291 | |||
| 1504 | Ga0495682_0059826 | |||
| 1505 | Ga0501031_0067076 | |||
| 1506 | Ga0501032_0127464 | |||
| 1507 | Ga0501033_0042269 | |||
| 1508 | Ga0501034_0130715 | |||
| 1509 | Ga0501036_0078810 | |||
| 1510 | Ga0501036_0342315 | |||
| 1511 | Ga0501038_0169176 | |||
| 1512 | Ga0501039_0042185 | |||
| 1513 | Ga0501046_0085782 | |||
| 1514 | Ga0501046_0159344 | |||
| 1515 | Ga0501047_0128083 | |||
| 1516 | Ga0501048_0075701 | |||
| 1517 | Ga0501067_0606110 | |||
| 1518 | Ga0501070_0052265 | |||
| 1519 | Ga0501070_0075254 | |||
| 1520 | Ga0501071_0132872 | |||
| 1521 | Ga0501074_0032975 | |||
| 1522 | Ga0501074_0092394 | |||
| 1523 | Ga0501079_0286475 | |||
| 1524 | Ga0501080_0004892 | |||
| 1525 | Ga0501080_0167470 | |||
| 1526 | Ga0501044_0086872 | |||
| 1527 | Ga0501044_1382913 | |||
| 1528 | nmdc:mga00v17_162327_c1 | |||
| 1529 | nmdc:mga00v17_70575_c1 | |||
| 1530 | nmdc:mga0yw44_190730_c1 | |||
| 1531 | nmdc:mga0k408_209435_c1 | |||
| 1532 | nmdc:mga0k408_869509_c1 | |||
| 1533 | nmdc:mga07m45_368410_c1 | |||
| 1534 | nmdc:mga05p37_213133_c1 | |||
| 1535 | nmdc:mga0qj67_309975_c1 | |||
| 1536 | nmdc:mga08y16_1404567_c1 | |||
| 1537 | nmdc:mga0rr50_128322_c1 | |||
| 1538 | nmdc:mga08x19_156422_c1 | |||
| 1539 | nmdc:mga0sz30_142571_c1 | |||
| 1540 | nmdc:mga0sz30_156936_c1 | |||
| 1541 | nmdc:mga0sz30_86682_c2 | |||
| 1542 | nmdc:mga0sz30_93636_c1 | |||
| 1543 | Ga0495601_0218484 | |||
| 1544 | Ga0495601_0261416 | |||
| 1545 | Ga0495612_0065275 | |||
| 1546 | Ga0500635_0055646 | |||
| 1547 | Ga0495595_0048111 | |||
| 1548 | Ga0495619_0296705 | |||
| 1549 | Ga0500578_0073568 | |||
| 1550 | Ga0500578_0151304 | |||
| 1551 | Ga0500578_0298316 | |||
| 1552 | Ga0500643_000231 | |||
| 1553 | Ga0500644_0216071 | |||
| 1554 | Ga0500647_0022727 | |||
| 1555 | Ga0500583_0038068 | |||
| 1556 | Ga0500651_0025302 | |||
| 1557 | Ga0500566_0000931 | |||
| 1558 | Ga0500641_0164704 | |||
| 1559 | Ga0500650_0291985 | |||
| 1560 | Ga0500555_002267 | |||
| 1561 | Ga0500555_097694 | |||
| 1562 | Ga0500556_0264943 | |||
| 1563 | Ga0500557_000179 | |||
| 1564 | Ga0500562_011871 | |||
| 1565 | Ga0500569_010567 | |||
| 1566 | Ga0500572_000668 | |||
| 1567 | Ga0500572_007171 | |||
| 1568 | Ga0500608_122841 | |||
| 1569 | Ga0500642_0000087 | |||
| 1570 | Ga0500652_335308 | |||
| 1571 | Ga0500658_0073809 | |||
| 1572 | Ga0500559_0017216 | |||
| 1573 | Ga0500568_0045168 | |||
| 1574 | Ga0500577_0213391 | |||
| 1575 | Ga0500604_0137025 | |||
| 1576 | Ga0500616_0097472 | |||
| 1577 | Ga0500622_0004589 | |||
| 1578 | Ga0500627_0008055 | |||
| 1579 | Ga0500634_0065140 | |||
| 1580 | Ga0500638_095670 | |||
| 1581 | Ga0500639_002805 | |||
| 1582 | Ga0500636_0033935 | |||
| 1583 | Ga0500636_0523645 | |||
| 1584 | Ga0500570_144234 | |||
| 1585 | Ga0500611_052493 | |||
| 1586 | Ga0500645_007988 | |||
| 1587 | Ga0500645_155811 | |||
| 1588 | Ga0500609_033795 | |||
| 1589 | Ga0500596_001693 | |||
| 1590 | Ga0500596_013426 | |||
| 1591 | Ga0500596_020443 | |||
| 1592 | Ga0500599_001236 | |||
| 1593 | Ga0501084_0199140 | |||
| 1594 | Ga0501084_0499665 | |||
| 1595 | Ga0500661_016839 | |||
| 1596 | Ga0466962_0077533 | |||
| 1597 | Ga0530510_0480126 | |||
| 1598 | 2507504688 | |||
| 1599 | 2508539895 | |||
| 1600 | 2508694970 | |||
| 1601 | 2509149921 | |||
| 1602 | 2513625618 | |||
| 1603 | 2513652996 | |||
| 1604 | 2513701748 | |||
| 1605 | 2513874029 | |||
| 1606 | 2513889659 | |||
| 1607 | 2515627774 | |||
| 1608 | 2528850591 | |||
| 1609 | 2617377148 | |||
| 1610 | 2805920387 | |||
| 1611 | 2818243503 | |||
| 1612 | 2824605825 | |||
| 1613 | 2824611961 | |||
| 1614 | 2824622837 | |||
| 1615 | 2824631926 | |||
| 1616 | 2824639127 | |||
| 1617 | 2824650741 | |||
| 1618 | 2824658792 | |||
| 1619 | 2824664310 | |||
| 1620 | 2824676900 | |||
| 1621 | 2824693277 | |||
| 1622 | 2824701521 | |||
| 1623 | 2824719443 | |||
| 1624 | 2824732612 | |||
| 1625 | 2824734125 | |||
| 1626 | 2824749187 | |||
| 1627 | 2824780108 | |||
| 1628 | 2841942719 | |||
| 1629 | 2841952929 | |||
| 1630 | 2841971042 | |||
| 1631 | 2842049583 | |||
| 1632 | 2847943065 | |||
| 1633 | 2857515773 | |||
| 1634 | 2874593713 | |||
| 1635 | 2874647976 | |||
| 1636 | 2876772804 | |||
| 1637 | 2876826467 | |||
| 1638 | 2879077500 | |||
| 1639 | 2879089968 | |||
| 1640 | 2879105506 | |||
| 1641 | 2879134396 | |||
| 1642 | 2879147355 | |||
| 1643 | 2881666090 | |||
| 1644 | 2885369066 | |||
| 1645 | 2888378859 | |||
| 1646 | 2888427286 | |||
| 1647 | 2889036116 | |||
| 1648 | 2904669393 | |||
| 1649 | 2906645611 | |||
| 1650 | 2908783062 | |||
| 1651 | 2922377718 | |||
| 1652 | 2922389183 | |||
| 1653 | 2929623313 | |||
| 1654 | 2929632596 | |||
| 1655 | 2932789207 | |||
| 1656 | 2932818133 | |||
| 1657 | 2932820283 | |||
| 1658 | 2932834457 | |||
| 1659 | 2933585216 | |||
| 1660 | 2935615117 | |||
| 1661 | 2935620140 | |||
| 1662 | 2935640458 | |||
| 1663 | 2935651526 | |||
| 1664 | 2935659706 | |||
| 1665 | 2935668652 | |||
| 1666 | 2935681954 | |||
| 1667 | 2935686960 | |||
| 1668 | 2935697070 | |||
| 1669 | 2935709838 | |||
| 1670 | 2935716648 | |||
| 1671 | 2935723227 | |||
| 1672 | 2935734784 | |||
| 1673 | 2935744425 | |||
| 1674 | 2935752926 | |||
| 1675 | 2935766824 | |||
| 1676 | 2935779697 | |||
| 1677 | 2935789685 | |||
| 1678 | 2935797947 | |||
| 1679 | 2935804572 | |||
| 1680 | 2935818212 | |||
| 1681 | 2935825845 | |||
| 1682 | 2935831964 | |||
| 1683 | 2935841204 | |||
| 1684 | 2935851464 | |||
| 1685 | 2935859026 | |||
| 1686 | 2935864207 | |||
| 1687 | 2935875441 | |||
| 1688 | 2935910510 | |||
| 1689 | 2935918086 | |||
| 1690 | 2935927579 | |||
| 1691 | 2935936549 | |||
| 1692 | 2935943898 | |||
| 1693 | 2935952335 | |||
| 1694 | 2935964003 | |||
| 1695 | 2935969175 | |||
| 1696 | 2935978439 | |||
| 1697 | 2935984628 | |||
| 1698 | 2935995580 | |||
| 1699 | 2936008000 | |||
| 1700 | 2936014122 | |||
| 1701 | 2936022969 | |||
| 1702 | 2936031105 | |||
| 1703 | 2936044822 | |||
| 1704 | 2936049227 | |||
| 1705 | 2936055673 | |||
| 1706 | 2940558839 | |||
| 1707 | 2941543430 | |||
| 1708 | 3005506429 | |||
| 1709 | 3005588923 | |||
| 1710 | 3005595588 | |||
| 1711 | 3005718838 | |||
| 1712 | 8016517585 | |||
| 1713 | 8016549740 | |||
| 1714 | 8016558158 | |||
| 1715 | 8016581597 | |||
| 1716 | 8016596163 | |||
| 1717 | 8016607063 | |||
| 1718 | 8016636468 | |||
| 1719 | 8017059036 | |||
| 1720 | 8019541049 | |||
| 1721 | 8019576603 | |||
| 1722 | 8019594478 | |||
| 1723 | 8019607084 | |||
| 1724 | 8019611424 | |||
| 1725 | 8019622204 | |||
| 1726 | 8019631112 | |||
| 1727 | 8019639512 | |||
| 1728 | 8019677333 | |||
| 1729 | 8019696865 | |||
| 1730 | 8055743255 | |||
| 1731 | 8056678435 | |||
| 1732 | 8056970696 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xal-assembly1.cif.gz_A | y99f mutant of thermus thermophilus hb8 thymidylate kinase | 0.9086 | 27 | 49 |
| 5x8k-assembly1.cif.gz_A | v158t mutant of thermus thermophilus hb8 thymidylate kinase | 0.9028 | 27 | 49 |
| 5x8a-assembly1.cif.gz_B | crystal structure of atp bound thymidylate kinase from thermus thermophilus hb8 | 0.8969 | 27 | 49 |
| 4rfv-assembly1.cif.gz_A | structure of the mycobacterium tuberculosis aps kinase cysc cys556ala mutant | 0.8873 | 25 | 49 |
| 5x8v-assembly1.cif.gz_A | y92h mutant of thermus thermophilus hb8 thymidylate kinase | 0.882 | 27 | 49 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DDG5_124_392_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9102 | 25 | 48 | 3.40.50.300 |
| af_Q10DY0_3_261_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8333 | 25 | 55 | 3.40.50.300 |
| af_P96394_152_310_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8041 | 25 | 47 | 3.40.50.300 |
| af_Q9GS21_1_131_3.30.390.110 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1; | 0.7837 | 62 | 73 | 3.30.390.110 |
| 3tqfB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7834 | 11 | 149 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W6SQG8-F1-model_v4 | Serine kinase of HPr protein (Carbohydrate metabolism regulator) | 0.9921 | 13 | 154 |
GO:0000155
GO:0005524 GO:0006109 |
| AF-B6JJT4-F1-model_v4 | HprK/P domain protein | 0.9917 | 10 | 152 |
GO:0000155
GO:0005524 GO:0006109 |
| AF-A0A431MAJ2-F1-model_v4 | Serine kinase | 0.9886 | 7 | 152 |
GO:0000155
GO:0005524 GO:0006109 |
| AF-A0A7T8BWW8-F1-model_v4 | deleted | 0.9883 | 8 | 154 |
|
| AF-A3WS26-F1-model_v4 | HPr kinase/phosphorylase C-terminal domain-containing protein | 0.9875 | 11 | 153 |
GO:0000155
GO:0005524 GO:0006109 |