F484033

General Info

Members Datasets Scaffolds Average Seq Length
866 547 1732 168

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0400493|Ga0501032_0400493_115_648
Length 177
Sequence MTIPASVHASAVKVGSRAVLIRGPSGSGKSRLAFDLILCGRSGQLPPAVLVGDDRVRLDTGAGQFAGQLLVRPVAELAGLIEIRGLGIRRTDFVAEAGVGLVVDLAAADAERLPPRQALQISIFGVEIPRIPVAADFSPLPLVVAALTTADGLPSLNPAQDCFKGIGNHITGTLAPE

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
103 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
104 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
105 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
169 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
170 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
171 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
188 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
189 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
218 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
219 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
220 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
221 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
222 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
300 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
303 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
306 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
307 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
308 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
314 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
335 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
342 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
356 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
367 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
370 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
374 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
375 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
376 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
377 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
378 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
379 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
380 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
381 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
382 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
383 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
384 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
385 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
386 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
387 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
388 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
389 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
390 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
391 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
392 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
393 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
394 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
395 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
396 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
397 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
398 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
399 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
400 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
401 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
402 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
403 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
404 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
405 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
406 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
407 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
408 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
411 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
413 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
414 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
415 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
416 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
417 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
418 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
419 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
420 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
421 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
422 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
423 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
424 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
425 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
426 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
427 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
428 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
429 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
430 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
431 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
432 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
433 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
434 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
435 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
436 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
437 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
438 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
439 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
440 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
441 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
442 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
443 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
444 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
445 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
446 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
447 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
448 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
449 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
450 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
451 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
452 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
453 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
454 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
455 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
456 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
457 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
458 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
459 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
460 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
461 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
462 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
463 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
464 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
465 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
466 2922368715
467 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
468 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
469 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
470 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
471 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
472 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
473 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
474 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
475 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
476 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
477 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
478 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
479 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
480 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
481 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
482 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
483 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
484 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
485 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
486 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
487 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
488 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
489 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
490 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
491 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
492 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
493 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
494 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
495 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
496 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
497 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
498 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
499 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
500 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
501 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
502 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
503 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
504 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
505 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
506 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
507 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
508 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
509 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
510 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
511 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
512 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
513 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
514 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
515 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
516 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
517 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
518 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
519 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
520 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
521 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
522 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
523 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
524 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
525 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
526 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
527 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
528 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
529 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
530 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
531 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
532 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
533 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
534 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
535 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
536 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
537 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
538 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
539 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
540 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
541 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
542 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
543 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
544 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
545 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
546 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
547 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.28
Metatranscriptomes 0.23
Isolates 15.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.24
Nodule 13.63
Rhizoplane 5.2
Rhizosphere 59.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0400493 3300049569 Bacteria 882
2 JGI25153J46596_10033514 3300003215 Bacteria 1694
3 JGI25153J46596_10037071 3300003215 Bacteria 1555
4 JGI25160J50197_1013318 3300003354 Bacteria 2809
5 Ga0055539_1009637 3300003752 Bacteria 1197
6 Ga0055531_10015632 3300003794 Bacteria 3329
7 Ga0065165_1012522 3300005262 Bacteria 3448
8 Ga0065165_1077129 3300005262 Bacteria 872
9 Ga0070658_10262669 3300005327 Bacteria 1466
10 Ga0070683_100067645 3300005329 Bacteria 3327
11 Ga0070683_100070645 3300005329 Bacteria 3257
12 Ga0070670_101051257 3300005331 Bacteria 741
13 Ga0070666_10407866 3300005335 Bacteria 977
14 Ga0070680_100038360 3300005336 Bacteria 3875
15 Ga0070682_100030995 3300005337 Bacteria 3231
16 Ga0068868_100824741 3300005338 Bacteria 838
17 Ga0070660_100016551 3300005339 Bacteria 5353
18 Ga0070689_100762774 3300005340 Bacteria 848
19 Ga0070691_10047567 3300005341 Bacteria 2040
20 Ga0070661_100666481 3300005344 Bacteria 845
21 Ga0070661_100922997 3300005344 Bacteria 721
22 Ga0070692_10635626 3300005345 Bacteria 711
23 Ga0070668_100291738 3300005347 Bacteria 1365
24 Ga0070668_100368644 3300005347 Bacteria 1219
25 Ga0070668_100742232 3300005347 Bacteria 868
26 Ga0070668_101065366 3300005347 Bacteria 728
27 Ga0070669_100096348 3300005353 Bacteria 2226
28 Ga0070671_100953668 3300005355 Bacteria 750
29 Ga0070659_100246541 3300005366 Bacteria 1480
30 Ga0070667_100472482 3300005367 Bacteria 1147
31 Ga0070709_10165845 3300005434 Bacteria 1539
32 Ga0070709_10182234 3300005434 Bacteria 1475
33 Ga0070714_100050500 3300005435 Bacteria 3543
34 Ga0070714_100111422 3300005435 Bacteria 2423
35 Ga0070713_100014007 3300005436 Bacteria 5937
36 Ga0070713_100450610 3300005436 Bacteria 1208
37 Ga0070710_10293085 3300005437 Bacteria 1059
38 Ga0070711_100024318 3300005439 Bacteria 3950
39 Ga0070663_100108980 3300005455 Bacteria 2078
40 Ga0070663_100348478 3300005455 Bacteria 1198
41 Ga0070678_100060242 3300005456 Bacteria 2793
42 Ga0070678_100275500 3300005456 Bacteria 1421
43 Ga0070678_100847761 3300005456 Bacteria 832
44 Ga0070662_100301729 3300005457 Bacteria 1301
45 Ga0070681_10080143 3300005458 Bacteria 3221
46 Ga0070681_10140566 3300005458 Bacteria 2344
47 Ga0070681_10262104 3300005458 Bacteria 1640
48 Ga0070681_10572299 3300005458 Bacteria 1043
49 Ga0070685_10183029 3300005466 Bacteria 1350
50 Ga0070707_100216548 3300005468 Bacteria 1866
51 Ga0070679_100304289 3300005530 Bacteria 1545
52 Ga0070679_100557305 3300005530 Bacteria 1090
53 Ga0070684_100005197 3300005535 Bacteria 9952
54 Ga0070684_100073578 3300005535 Bacteria 3011
55 Ga0070697_100508499 3300005536 Bacteria 1054
56 Ga0068853_100156985 3300005539 Bacteria 2050
57 Ga0068853_100329145 3300005539 Bacteria 1417
58 Ga0068853_100457636 3300005539 Bacteria 1201
59 Ga0070693_100722044 3300005547 Bacteria 731
60 Ga0070665_100120177 3300005548 Bacteria 2629
61 Ga0070665_100454604 3300005548 Bacteria 1290
62 Ga0070665_100945123 3300005548 Bacteria 874
63 Ga0068855_100324958 3300005563 Bacteria 1699
64 Ga0068855_100350463 3300005563 Bacteria 1626
65 Ga0070664_100149720 3300005564 Bacteria 2060
66 Ga0070664_100300874 3300005564 Bacteria 1449
67 Ga0070664_101111841 3300005564 Bacteria 744
68 Ga0068857_100639548 3300005577 Bacteria 1007
69 Ga0068857_100930309 3300005577 Bacteria 835
70 Ga0068854_100108189 3300005578 Bacteria 2093
71 Ga0068854_100225483 3300005578 Bacteria 1485
72 Ga0068856_100333155 3300005614 Bacteria 1535
73 Ga0068852_100133685 3300005616 Bacteria 2287
74 Ga0068852_100195359 3300005616 Bacteria 1912
75 Ga0068852_100432784 3300005616 Bacteria 1299
76 Ga0068852_101619923 3300005616 Bacteria 670
77 Ga0068859_100606613 3300005617 Bacteria 1187
78 Ga0068864_100282186 3300005618 Bacteria 1550
79 Ga0068851_10099579 3300005834 Bacteria 1540
80 Ga0068863_100346762 3300005841 Bacteria 1445
81 Ga0068863_100358896 3300005841 Bacteria 1420
82 Ga0068863_100536403 3300005841 Bacteria 1154
83 Ga0068863_101075487 3300005841 Bacteria 808
84 Ga0068858_100186244 3300005842 Bacteria 1961
85 Ga0068858_100406503 3300005842 Bacteria 1308
86 Ga0068858_100515121 3300005842 Bacteria 1156
87 Ga0068860_100533251 3300005843 Bacteria 1174
88 Ga0068860_101077660 3300005843 Bacteria 822
89 Ga0068862_100378117 3300005844 Bacteria 1320
90 Ga0081540_1047384 3300005983 Bacteria 2162
91 Ga0081540_1070925 3300005983 Bacteria 1612
92 Ga0081539_10088217 3300005985 Bacteria 1610
93 Ga0070717_10002055 3300006028 Bacteria 14098
94 Ga0070717_10025850 3300006028 Bacteria 4678
95 Ga0075365_10206647 3300006038 Bacteria 1376
96 Ga0075365_10232508 3300006038 Bacteria 1294
97 Ga0075365_10234257 3300006038 Bacteria 1289
98 Ga0075365_10364252 3300006038 Bacteria 1019
99 Ga0075365_10622319 3300006038 Bacteria 763
100 Ga0075368_10009616 3300006042 Bacteria 3480
101 Ga0075363_100247745 3300006048 Bacteria 1025
102 Ga0075363_100264538 3300006048 Bacteria 993
103 Ga0075363_100379374 3300006048 Bacteria 829
104 Ga0075364_10152558 3300006051 Bacteria 1557
105 Ga0075364_10262342 3300006051 Bacteria 1174
106 Ga0075364_10277744 3300006051 Bacteria 1140
107 Ga0070716_100256662 3300006173 Bacteria 1194
108 Ga0070716_100719448 3300006173 Bacteria 765
109 Ga0070712_100036410 3300006175 Bacteria 3349
110 Ga0075362_10059419 3300006177 Bacteria 1726
111 Ga0075367_10218165 3300006178 Bacteria 1193
112 Ga0075367_10324487 3300006178 Bacteria 970
113 Ga0075367_10364528 3300006178 Bacteria 912
114 Ga0075367_10596566 3300006178 Bacteria 702
115 Ga0075369_10181476 3300006186 Bacteria 968
116 Ga0075369_10211103 3300006186 Bacteria 897
117 Ga0075369_10286017 3300006186 Bacteria 768
118 Ga0075366_10018305 3300006195 Bacteria 4042
119 Ga0075366_10143689 3300006195 Bacteria 1443
120 Ga0075366_10479434 3300006195 Bacteria 768
121 Ga0097621_100672367 3300006237 Bacteria 951
122 Ga0075370_10234397 3300006353 Bacteria 1086
123 Ga0075370_10248780 3300006353 Bacteria 1053
124 Ga0068871_100454545 3300006358 Bacteria 1148
125 Ga0075428_100338329 3300006844 Bacteria 1616
126 Ga0097620_100606605 3300006931 Bacteria 1187
127 Ga0099823_1085769 3300006944 Bacteria 1141
128 Ga0075435_100142716 3300007076 Bacteria 2010
129 Ga0105240_10001522 3300009093 Bacteria 39421
130 Ga0105240_10039101 3300009093 Bacteria 6078
131 Ga0105240_10118623 3300009093 Bacteria 3188
132 Ga0105240_10377122 3300009093 Bacteria 1602
133 Ga0105245_10185096 3300009098 Bacteria 1992
134 Ga0105245_10968557 3300009098 Bacteria 894
135 Ga0105247_10181651 3300009101 Bacteria 1404
136 Ga0105247_10190188 3300009101 Bacteria 1374
137 Ga0105247_10209937 3300009101 Bacteria 1313
138 Ga0114129_10186448 3300009147 Bacteria 2819
139 Ga0105243_10907816 3300009148 Bacteria 877
140 Ga0105241_10213333 3300009174 Bacteria 1618
141 Ga0105242_10201271 3300009176 Bacteria 1769
142 Ga0105248_10127908 3300009177 Bacteria 2866
143 Ga0105248_10451617 3300009177 Bacteria 1448
144 Ga0105248_10937152 3300009177 Bacteria 978
145 Ga0105237_10043065 3300009545 Bacteria 4550
146 Ga0105237_10081784 3300009545 Bacteria 3221
147 Ga0105237_10173918 3300009545 Bacteria 2153
148 Ga0105237_10207163 3300009545 Bacteria 1961
149 Ga0105237_10543982 3300009545 Bacteria 1168
150 Ga0105237_10786368 3300009545 Bacteria 958
151 Ga0105237_10836987 3300009545 Bacteria 927
152 Ga0105238_10545277 3300009551 Bacteria 1164
153 Ga0105238_11112038 3300009551 Bacteria 813
154 Ga0105238_11404517 3300009551 Bacteria 725
155 Ga0105249_10546486 3300009553 Bacteria 1208
156 Ga0099796_10022000 3300010159 Bacteria 1972
157 Ga0105239_10175070 3300010375 Bacteria 2400
158 Ga0105239_10664518 3300010375 Bacteria 1190
159 Ga0105239_11087032 3300010375 Bacteria 920
160 Ga0105239_11165830 3300010375 Bacteria 888
161 Ga0105239_11373142 3300010375 Bacteria 815
162 Ga0105239_11609889 3300010375 Bacteria 751
163 Ga0105239_11614904 3300010375 Bacteria 750
164 Ga0105246_10048250 3300011119 Bacteria 2910
165 Ga0105246_10859604 3300011119 Bacteria 810
166 Ga0157314_1003836 3300012500 Bacteria 1082
167 Ga0157371_10136557 3300013102 Bacteria 1746
168 Ga0157370_10077383 3300013104 Bacteria 3134
169 Ga0157370_10519605 3300013104 Bacteria 1093
170 Ga0157370_10655669 3300013104 Bacteria 959
171 Ga0157369_10010577 3300013105 Bacteria 10503
172 Ga0157369_10111832 3300013105 Bacteria 2903
173 Ga0157369_10194618 3300013105 Bacteria 2130
174 Ga0157374_10229486 3300013296 Bacteria 1823
175 Ga0157374_11277486 3300013296 Bacteria 756
176 Ga0157378_11164949 3300013297 Bacteria 809
177 Ga0157378_11362339 3300013297 Bacteria 752
178 Ga0163162_10473514 3300013306 Bacteria 1384
179 Ga0163162_11186576 3300013306 Bacteria 866
180 Ga0163162_11315793 3300013306 Bacteria 821
181 Ga0163162_11664201 3300013306 Bacteria 728
182 Ga0157372_10231909 3300013307 Bacteria 2140
183 Ga0157372_10507255 3300013307 Bacteria 1406
184 Ga0157372_11521526 3300013307 Bacteria 771
185 Ga0157372_12070924 3300013307 Bacteria 654
186 Ga0157375_10457366 3300013308 Bacteria 1442
187 Ga0157375_10535403 3300013308 Bacteria 1334
188 Ga0163163_10096851 3300014325 Bacteria 2971
189 Ga0163163_10167718 3300014325 Bacteria 2242
190 Ga0157380_10759698 3300014326 Bacteria 982
191 Ga0157380_11412267 3300014326 Bacteria 747
192 Ga0157379_10065931 3300014968 Bacteria 3237
193 Ga0157376_10160668 3300014969 Bacteria 2036
194 Ga0157376_10601087 3300014969 Bacteria 1095
195 Ga0157376_10632910 3300014969 Bacteria 1068
196 Ga0163161_10277455 3300017792 Bacteria 1314
197 Ga0163161_10517824 3300017792 Bacteria 974
198 Ga0163161_10790537 3300017792 Bacteria 797
199 Ga0214544_1000007 3300021320 Bacteria 379989
200 Ga0214542_1000216 3300021321 Bacteria 92614
201 Ga0214542_1042175 3300021321 Bacteria 1106
202 Ga0214545_1000118 3300021324 Bacteria 92737
203 Ga0214545_1043334 3300021324 Bacteria 1106
204 Ga0214543_1000009 3300021327 Bacteria 384302
205 Ga0213872_10166416 3300021361 Bacteria 957
206 Ga0213874_10030678 3300021377 Bacteria 1551
207 Ga0213876_10022972 3300021384 Bacteria 3295
208 Ga0224712_10136980 3300022467 Bacteria 1074
209 Ga0209563_103176 3300025230 Bacteria 3463
210 Ga0209677_100296 3300025253 Bacteria 32613
211 Ga0209677_106519 3300025253 Bacteria 2741
212 Ga0209148_1001484 3300025254 Bacteria 11741
213 Ga0209233_1006650 3300025261 Bacteria 3707
214 Ga0209564_1021748 3300025295 Bacteria 2294
215 Ga0209758_1000030 3300025297 Bacteria 509217
216 Ga0209758_1000429 3300025297 Bacteria 71157
217 Ga0209758_1006708 3300025297 Bacteria 8117
218 Ga0209758_1033130 3300025297 Bacteria 2082
219 Ga0209758_1034727 3300025297 Bacteria 2000
220 Ga0209256_1002159 3300025299 Bacteria 16970
221 Ga0207426_1001158 3300025302 Bacteria 23695
222 Ga0207426_1008203 3300025302 Bacteria 4252
223 Ga0207426_1078254 3300025302 Bacteria 903
224 Ga0209257_1005466 3300025304 Bacteria 8912
225 Ga0209257_1026629 3300025304 Bacteria 1943
226 Ga0207710_10108429 3300025900 Bacteria 1317
227 Ga0207710_10244828 3300025900 Bacteria 895
228 Ga0207688_10049994 3300025901 Bacteria 2339
229 Ga0207680_10476417 3300025903 Bacteria 887
230 Ga0207647_10017521 3300025904 Bacteria 4868
231 Ga0207647_10191221 3300025904 Bacteria 1186
232 Ga0207699_10241754 3300025906 Bacteria 1240
233 Ga0207645_10385829 3300025907 Bacteria 941
234 Ga0207705_10048892 3300025909 Bacteria 3043
235 Ga0207705_10168126 3300025909 Bacteria 1650
236 Ga0207684_10073655 3300025910 Bacteria 2901
237 Ga0207654_10253672 3300025911 Bacteria 1180
238 Ga0207707_10016071 3300025912 Bacteria 6527
239 Ga0207707_10082019 3300025912 Bacteria 2815
240 Ga0207707_10185538 3300025912 Bacteria 1815
241 Ga0207707_10269126 3300025912 Bacteria 1477
242 Ga0207695_10000006 3300025913 Bacteria 1135309
243 Ga0207671_10498170 3300025914 Bacteria 971
244 Ga0207671_10498693 3300025914 Bacteria 971
245 Ga0207671_10558395 3300025914 Bacteria 913
246 Ga0207671_10585255 3300025914 Bacteria 890
247 Ga0207671_10692660 3300025914 Bacteria 811
248 Ga0207693_10037984 3300025915 Bacteria 3793
249 Ga0207663_10018567 3300025916 Bacteria 3900
250 Ga0207657_10003442 3300025919 Bacteria 16882
251 Ga0207657_10208275 3300025919 Bacteria 1570
252 Ga0207652_10015649 3300025921 Bacteria 6174
253 Ga0207652_10270126 3300025921 Bacteria 1534
254 Ga0207681_10475865 3300025923 Bacteria 1019
255 Ga0207694_10243918 3300025924 Bacteria 1469
256 Ga0207694_10362224 3300025924 Bacteria 1202
257 Ga0207694_11148492 3300025924 Bacteria 657
258 Ga0207650_10694664 3300025925 Bacteria 859
259 Ga0207700_10004386 3300025928 Bacteria 8309
260 Ga0207700_10036905 3300025928 Bacteria 3534
261 Ga0207700_10359390 3300025928 Bacteria 1269
262 Ga0207664_10112953 3300025929 Bacteria 2262
263 Ga0207664_10175510 3300025929 Bacteria 1837
264 Ga0207644_10122338 3300025931 Bacteria 1982
265 Ga0207690_10029081 3300025932 Bacteria 3510
266 Ga0207690_10673141 3300025932 Bacteria 849
267 Ga0207690_10702476 3300025932 Bacteria 831
268 Ga0207706_10163428 3300025933 Bacteria 1957
269 Ga0207669_10865854 3300025937 Bacteria 753
270 Ga0207665_10220392 3300025939 Bacteria 1390
271 Ga0207665_10429433 3300025939 Bacteria 1011
272 Ga0207665_10611723 3300025939 Bacteria 851
273 Ga0207691_10580733 3300025940 Bacteria 949
274 Ga0207711_10323460 3300025941 Bacteria 1425
275 Ga0207689_10939625 3300025942 Bacteria 730
276 Ga0207661_10000379 3300025944 Bacteria 28634
277 Ga0207661_10042228 3300025944 Bacteria 3594
278 Ga0207679_10144070 3300025945 Bacteria 1930
279 Ga0207679_10520126 3300025945 Bacteria 1064
280 Ga0207679_10886879 3300025945 Bacteria 815
281 Ga0207679_11449195 3300025945 Bacteria 630
282 Ga0207667_10226493 3300025949 Bacteria 1915
283 Ga0207651_10749486 3300025960 Bacteria 863
284 Ga0207712_11183865 3300025961 Bacteria 681
285 Ga0207668_10055426 3300025972 Bacteria 2755
286 Ga0207668_10292695 3300025972 Bacteria 1340
287 Ga0207668_10909319 3300025972 Bacteria 783
288 Ga0207640_11174499 3300025981 Bacteria 681
289 Ga0207658_10909768 3300025986 Bacteria 801
290 Ga0207677_10038493 3300026023 Bacteria 3136
291 Ga0207677_10767693 3300026023 Bacteria 860
292 Ga0207703_10181174 3300026035 Bacteria 1859
293 Ga0207639_10086651 3300026041 Bacteria 2494
294 Ga0207639_10184081 3300026041 Bacteria 1779
295 Ga0207639_10313636 3300026041 Bacteria 1390
296 Ga0207639_11012424 3300026041 Bacteria 778
297 Ga0207639_11217732 3300026041 Bacteria 707
298 Ga0207678_10077612 3300026067 Bacteria 2845
299 Ga0207678_10174915 3300026067 Bacteria 1833
300 Ga0207678_10975831 3300026067 Bacteria 750
301 Ga0207702_10229166 3300026078 Bacteria 1735
302 Ga0207702_10285899 3300026078 Bacteria 1561
303 Ga0207702_10337813 3300026078 Bacteria 1438
304 Ga0207702_10480126 3300026078 Bacteria 1209
305 Ga0207641_10513023 3300026088 Bacteria 1165
306 Ga0207648_10593045 3300026089 Bacteria 1021
307 Ga0207648_10821384 3300026089 Bacteria 866
308 Ga0207676_10405994 3300026095 Bacteria 1274
309 Ga0207676_11325365 3300026095 Bacteria 715
310 Ga0207674_10663277 3300026116 Bacteria 1007
311 Ga0207674_11046140 3300026116 Bacteria 785
312 Ga0207675_100157667 3300026118 Bacteria 2163
313 Ga0207675_100953586 3300026118 Bacteria 875
314 Ga0207683_10089043 3300026121 Bacteria 2747
315 Ga0207683_10147116 3300026121 Bacteria 2125
316 Ga0207683_10488983 3300026121 Bacteria 1136
317 Ga0207683_11075637 3300026121 Bacteria 746
318 Ga0207698_10143546 3300026142 Bacteria 2061
319 Ga0207698_10158800 3300026142 Bacteria 1974
320 Ga0209389_1000015 3300027296 Bacteria 188311
321 Ga0209389_1000035 3300027296 Bacteria 127089
322 Ga0209589_1000039 3300027357 Bacteria 127084
323 Ga0209489_100072 3300027361 Bacteria 138111
324 Ga0209489_100084 3300027361 Bacteria 127094
325 Ga0209700_100034 3300027363 Bacteria 197276
326 Ga0209813_10020652 3300027866 Bacteria 1845
327 Ga0268266_10033807 3300028379 Bacteria 4345
328 Ga0268266_10039481 3300028379 Bacteria 4021
329 Ga0268266_10392170 3300028379 Bacteria 1311
330 Ga0268266_11075393 3300028379 Bacteria 778
331 Ga0268264_10776862 3300028381 Bacteria 956
332 Ga0268264_10908123 3300028381 Bacteria 884
333 Ga0307517_10000066 3300028786 Bacteria 141370
334 Ga0265340_10078084 3300031247 Bacteria 1561
335 Ga0265339_10002540 3300031249 Bacteria 13011
336 Ga0307508_10023991 3300031616 Bacteria 5535
337 Ga0307516_10334304 3300031730 Bacteria 1183
338 Ga0307405_10580691 3300031731 Bacteria 912
339 Ga0307405_10781400 3300031731 Bacteria 798
340 Ga0307407_10330785 3300031903 Bacteria 1072
341 Ga0307412_10218952 3300031911 Bacteria 1458
342 Ga0307416_100321671 3300032002 Bacteria 1549
343 Ga0307416_101615683 3300032002 Bacteria 753
344 Ga0307411_11077849 3300032005 Bacteria 723
345 Ga0307415_100265892 3300032126 Bacteria 1402
346 Ga0307510_10009663 3300033180 Bacteria 11491
347 Ga0316215_1007381 3300033544 Bacteria 1071
348 Ga0316213_1003479 3300033546 Bacteria 1043
349 Ga0373958_0126472 3300034819 Bacteria 622
350 Ga0373928_0032860 3300035084 Bacteria 1158
351 Ga0373934_0060865 3300035086 Bacteria 1504
352 Ga0373944_0094694 3300035089 Bacteria 1002
353 Ga0373944_0235089 3300035089 Bacteria 673
354 Ga0373923_0004740 3300035111 Bacteria 4544
355 Ga0373939_0080834 3300035114 Bacteria 1079
356 Ga0373945_0198753 3300035116 Bacteria 831
357 Ga0373954_0179668 3300035118 Bacteria 1037
358 Ga0373956_0086675 3300035119 Bacteria 1441
359 Ga0373957_0199298 3300035120 Bacteria 834
360 Ga0373943_0008271 3300035170 Bacteria 4668
361 Ga0373943_0142886 3300035170 Bacteria 1291
362 Ga0373946_0022042 3300035171 Bacteria 2476
363 Ga0373955_0012972 3300035172 Bacteria 4018
364 Ga0373935_0008474 3300035692 Bacteria 6153
365 Ga0373935_0498589 3300035692 Bacteria 884
366 Ga0373927_0026977 3300035695 Bacteria 3753
367 Ga0373927_0057019 3300035695 Bacteria 2526
368 Ga0373927_0361617 3300035695 Bacteria 957
369 Ga0373933_0115072 3300035724 Bacteria 1680
370 Ga0373947_0005615 3300035725 Bacteria 7313
371 Ga0373947_0052888 3300035725 Bacteria 2447
372 Ga0373947_0451247 3300035725 Bacteria 871
373 Ga0372808_009171 3300036459 Bacteria 1380
374 Ga0373925_0686444 3300037068 Bacteria 844
375 Ga0373925_0934269 3300037068 Bacteria 715
376 Ga0395899_0047216 3300037312 Bacteria 3206
377 Ga0395900_0041199 3300037418 Bacteria 4762
378 Ga0395900_0133440 3300037418 Bacteria 2544
379 Ga0395898_0020298 3300037466 Bacteria 6749
380 Ga0395898_0074171 3300037466 Bacteria 3287
381 Ga0395898_0195700 3300037466 Bacteria 1931
382 Ga0395905_0004327 3300037471 Bacteria 14794
383 Ga0395905_0764011 3300037471 Bacteria 869
384 Ga0395905_0801988 3300037471 Bacteria 844
385 Ga0436364_0136702 3300037853 Bacteria 1269
386 Ga0436364_1443852 3300037853 Bacteria 758
387 Ga0395901_0129731 3300038443 Bacteria 2649
388 Ga0395901_0181707 3300038443 Bacteria 2206
389 Ga0395901_1091263 3300038443 Bacteria 769
390 Ga0436365_0661667 3300039437 Bacteria 1876
391 Ga0436365_1810308 3300039437 Bacteria 3241
392 Ga0436365_1812884 3300039437 Bacteria 1134
393 Ga0436361_0536082 3300039447 Bacteria 3581
394 Ga0436363_1392658 3300039450 Bacteria 7115
395 Ga0451791_0030660 3300041451 Bacteria 2006
396 Ga0451791_1119922 3300041451 Bacteria 719
397 Ga0451791_1553070 3300041451 Bacteria 900
398 Ga0451795_0110462 3300041456 Bacteria 934
399 Ga0451795_0382645 3300041456 Bacteria 650
400 Ga0451802_0059232 3300041460 Bacteria 1596
401 Ga0451839_1326352 3300041496 Bacteria 1033
402 Ga0451841_0245673 3300041498 Bacteria 1742
403 Ga0451843_1639070 3300041509 Bacteria 677
404 Ga0451853_2076652 3300041512 Bacteria 2420
405 Ga0466972_0133985 3300044658 Bacteria 1166
406 Ga0466966_0002003 3300044684 Bacteria 13212
407 Ga0466961_0000018 3300044693 Bacteria 109837
408 Ga0466964_0039193 3300044706 Bacteria 1908
409 Ga0466964_0078685 3300044706 Bacteria 1410
410 Ga0466968_0009927 3300044735 Bacteria 3676
411 Ga0466970_0053360 3300044765 Bacteria 2159
412 Ga0466970_0138054 3300044765 Bacteria 1342
413 Ga0466957_0163488 3300044842 Bacteria 1447
414 Ga0466957_0230093 3300044842 Bacteria 1227
415 Ga0466960_0133576 3300044901 Bacteria 1312
416 Ga0466959_0002636 3300045049 Bacteria 11514
417 Ga0466959_0034315 3300045049 Bacteria 3752
418 Ga0466959_0040827 3300045049 Bacteria 3427
419 Ga0466967_0050248 3300045976 Bacteria 3650
420 Ga0466967_0337734 3300045976 Bacteria 1456
421 Ga0495592_0077819 3300046454 Bacteria 2403
422 Ga0495603_0099252 3300046455 Bacteria 1700
423 Ga0495603_0136144 3300046455 Bacteria 1429
424 Ga0495603_0164673 3300046455 Bacteria 1285
425 Ga0495590_0137261 3300046457 Bacteria 882
426 Ga0495629_0005545 3300046459 Bacteria 9419
427 Ga0495629_0169381 3300046459 Bacteria 1516
428 Ga0495629_0224091 3300046459 Bacteria 1297
429 Ga0495638_0008455 3300046460 Bacteria 7296
430 Ga0495651_0025977 3300046462 Bacteria 4559
431 Ga0495651_0070775 3300046462 Bacteria 2653
432 Ga0495653_0038982 3300046463 Bacteria 3725
433 Ga0495653_0108209 3300046463 Bacteria 2002
434 Ga0495653_0553673 3300046463 Bacteria 711
435 Ga0495580_0014347 3300046472 Bacteria 6010
436 Ga0495582_0038446 3300046473 Bacteria 2633
437 Ga0495605_0080857 3300046474 Bacteria 1520
438 Ga0495605_0109262 3300046474 Bacteria 1263
439 Ga0495639_0003783 3300046475 Bacteria 6502
440 Ga0495639_0039176 3300046475 Bacteria 2130
441 Ga0495639_0424034 3300046475 Bacteria 674
442 Ga0495662_0078274 3300046476 Bacteria 1606
443 Ga0495662_0093420 3300046476 Bacteria 1468
444 Ga0495664_0226851 3300046477 Bacteria 1130
445 Ga0495664_0297060 3300046477 Bacteria 975
446 Ga0495664_0422029 3300046477 Bacteria 800
447 Ga0495584_0264556 3300046491 Bacteria 874
448 Ga0495584_0375279 3300046491 Bacteria 722
449 Ga0495585_0211912 3300046492 Bacteria 981
450 Ga0495585_0236509 3300046492 Bacteria 916
451 Ga0495606_0050032 3300046507 Bacteria 2736
452 Ga0495606_0221853 3300046507 Bacteria 1064
453 Ga0495606_0315685 3300046507 Bacteria 841
454 Ga0495608_0016024 3300046511 Bacteria 5189
455 Ga0495608_0211113 3300046511 Bacteria 1220
456 Ga0495610_0053526 3300046512 Bacteria 1954
457 Ga0495610_0072907 3300046512 Bacteria 1597
458 Ga0495618_0035125 3300046514 Bacteria 3146
459 Ga0495618_0049203 3300046514 Bacteria 2662
460 Ga0495620_0158049 3300046515 Bacteria 881
461 Ga0495628_0074122 3300046516 Bacteria 2652
462 Ga0495628_0276804 3300046516 Bacteria 1247
463 Ga0495628_0876483 3300046516 Bacteria 624
464 Ga0495630_0020544 3300046517 Bacteria 4869
465 Ga0495631_0064808 3300046518 Bacteria 1581
466 Ga0495632_0247967 3300046519 Bacteria 799
467 Ga0495632_0325487 3300046519 Bacteria 678
468 Ga0495643_0036835 3300046522 Bacteria 2685
469 Ga0495644_0189540 3300046523 Bacteria 791
470 Ga0495648_0056155 3300046524 Bacteria 2370
471 Ga0495648_0193408 3300046524 Bacteria 1024
472 Ga0495648_0268938 3300046524 Bacteria 814
473 Ga0495652_0047256 3300046529 Bacteria 3691
474 Ga0495652_0692549 3300046529 Bacteria 686
475 Ga0495654_0182459 3300046530 Bacteria 908
476 Ga0495640_0016318 3300046533 Bacteria 5559
477 Ga0495640_0045368 3300046533 Bacteria 3050
478 Ga0495640_0338854 3300046533 Bacteria 929
479 Ga0495640_0773403 3300046533 Bacteria 573
480 Ga0495586_0082041 3300046535 Bacteria 1773
481 Ga0495587_0020507 3300046536 Bacteria 4080
482 Ga0495587_0381424 3300046536 Bacteria 784
483 Ga0495598_0046390 3300046537 Bacteria 1291
484 Ga0495609_0154446 3300046538 Bacteria 975
485 Ga0495597_0055721 3300046542 Bacteria 1733
486 Ga0495597_0196583 3300046542 Bacteria 809
487 Ga0495645_0044979 3300046543 Bacteria 3220
488 Ga0495645_0107774 3300046543 Bacteria 1974
489 Ga0495622_0016420 3300046557 Bacteria 3447
490 Ga0495633_0211282 3300046558 Bacteria 889
491 Ga0495667_0035941 3300046559 Bacteria 3309
492 Ga0495667_0052128 3300046559 Bacteria 2697
493 Ga0495667_0168329 3300046559 Bacteria 1408
494 Ga0495668_0421866 3300046616 Bacteria 733
495 Ga0495634_0046734 3300046642 Bacteria 2920
496 Ga0495634_0194143 3300046642 Bacteria 1264
497 Ga0495611_0374785 3300046648 Bacteria 652
498 Ga0495625_0013351 3300046660 Bacteria 6602
499 Ga0495625_0119428 3300046660 Bacteria 1795
500 Ga0495635_0040207 3300046663 Bacteria 3231
501 Ga0495635_0118868 3300046663 Bacteria 1803
502 Ga0495659_0025848 3300046664 Bacteria 2012
503 Ga0495661_0058502 3300046665 Bacteria 2297
504 Ga0495588_0020269 3300046674 Bacteria 3265
505 Ga0495588_0188651 3300046674 Bacteria 1089
506 Ga0495588_0332121 3300046674 Bacteria 799
507 Ga0495588_0381867 3300046674 Bacteria 740
508 Ga0495657_0003331 3300046675 Bacteria 13160
509 Ga0495599_0022898 3300046678 Bacteria 3902
510 Ga0495599_0486596 3300046678 Bacteria 727
511 Ga0495623_0024029 3300046679 Bacteria 3931
512 Ga0495623_0124733 3300046679 Bacteria 1547
513 Ga0495646_0100261 3300046680 Bacteria 1661
514 Ga0495647_0005990 3300046681 Bacteria 4006
515 Ga0495647_0041458 3300046681 Bacteria 1753
516 Ga0495658_0008260 3300046683 Bacteria 5156
517 Ga0495613_0022819 3300046689 Bacteria 4663
518 Ga0495613_0046915 3300046689 Bacteria 3193
519 Ga0495624_0127579 3300046690 Bacteria 1560
520 Ga0495624_0232827 3300046690 Bacteria 1115
521 Ga0495670_0447845 3300046691 Bacteria 699
522 Ga0495671_0207267 3300046692 Bacteria 950
523 Ga0495671_0226628 3300046692 Bacteria 904
524 Ga0495671_0278232 3300046692 Bacteria 806
525 Ga0495649_0048054 3300046694 Bacteria 2319
526 Ga0495649_0097376 3300046694 Bacteria 1565
527 Ga0495649_0238660 3300046694 Bacteria 936
528 Ga0495649_0428427 3300046694 Bacteria 662
529 Ga0495589_0069690 3300046794 Bacteria 1720
530 Ga0495589_0110926 3300046794 Bacteria 1324
531 Ga0495589_0333053 3300046794 Bacteria 700
532 Ga0495600_0156994 3300046809 Bacteria 1471
533 Ga0495600_0231258 3300046809 Bacteria 1180
534 Ga0495660_0055114 3300046810 Bacteria 2153
535 Ga0495581_0064567 3300047315 Bacteria 2115
536 Ga0495581_0327593 3300047315 Bacteria 894
537 Ga0495604_0007178 3300047317 Bacteria 8823
538 Ga0495604_0011216 3300047317 Bacteria 7113
539 Ga0495604_0220001 3300047317 Bacteria 1307
540 Ga0495636_0054292 3300047318 Bacteria 1683
541 Ga0495674_0013462 3300047319 Bacteria 7692
542 Ga0495674_0072115 3300047319 Bacteria 2979
543 Ga0495674_0733476 3300047319 Bacteria 773
544 Ga0495672_0043340 3300047320 Bacteria 2706
545 Ga0495676_0020621 3300047321 Bacteria 5777
546 Ga0495676_0113996 3300047321 Bacteria 1978
547 Ga0495676_0321838 3300047321 Bacteria 1039
548 Ga0495680_0002619 3300047322 Bacteria 18287
549 Ga0495683_0334152 3300047323 Bacteria 643
550 Ga0495683_0348650 3300047323 Bacteria 625
551 Ga0495687_081653 3300047443 Bacteria 1264
552 Ga0495675_0007823 3300047444 Bacteria 6599
553 Ga0495679_038314 3300047446 Bacteria 1502
554 Ga0495685_180499 3300047447 Bacteria 680
555 Ga0495673_0064702 3300047469 Bacteria 1554
556 Ga0495673_0099566 3300047469 Bacteria 1177
557 Ga0495681_0197805 3300047470 Bacteria 817
558 Ga0495684_0120392 3300047471 Bacteria 1977
559 Ga0495684_0427188 3300047471 Bacteria 925
560 Ga0495686_0315776 3300047472 Bacteria 858
561 Ga0495593_0003341 3300047673 Bacteria 9611
562 Ga0495593_0030634 3300047673 Bacteria 2943
563 Ga0495593_0157334 3300047673 Bacteria 1148
564 Ga0495602_0048059 3300048088 Bacteria 3839
565 Ga0495602_0246879 3300048088 Bacteria 1332
566 Ga0495615_0083588 3300048090 Bacteria 879
567 Ga0495626_0056962 3300048091 Bacteria 1788
568 Ga0495626_0196950 3300048091 Bacteria 828
569 Ga0496100_0277751 3300048903 Bacteria 1248
570 Ga0496101_0168879 3300048904 Bacteria 1680
571 Ga0496101_0434334 3300048904 Bacteria 1035
572 Ga0496102_0029630 3300048905 Bacteria 4898
573 Ga0496102_0135069 3300048905 Bacteria 2311
574 Ga0496102_0636288 3300048905 Bacteria 990
575 Ga0496102_0976846 3300048905 Bacteria 768
576 Ga0496103_0016458 3300048906 Bacteria 4413
577 Ga0496104_0002055 3300048907 Bacteria 17481
578 Ga0496104_0047669 3300048907 Bacteria 4038
579 Ga0496104_0093803 3300048907 Bacteria 2871
580 Ga0496104_0208826 3300048907 Bacteria 1864
581 Ga0496105_0000745 3300048908 Bacteria 22090
582 Ga0496105_0027123 3300048908 Bacteria 4676
583 Ga0496105_0095923 3300048908 Bacteria 2449
584 Ga0496105_0525320 3300048908 Bacteria 926
585 Ga0496106_0128417 3300048909 Bacteria 1986
586 Ga0496107_0042886 3300048910 Bacteria 3250
587 Ga0496107_0095035 3300048910 Bacteria 2180
588 Ga0496108_0127781 3300048911 Bacteria 2183
589 Ga0496108_0163040 3300048911 Bacteria 1927
590 Ga0496108_1150531 3300048911 Bacteria 658
591 Ga0496109_0042780 3300048912 Bacteria 4105
592 Ga0496109_0171892 3300048912 Bacteria 2033
593 Ga0496109_0202106 3300048912 Bacteria 1868
594 Ga0496110_0058446 3300048913 Bacteria 3396
595 Ga0496110_0116321 3300048913 Bacteria 2407
596 Ga0496110_0459296 3300048913 Bacteria 1160
597 Ga0496111_0085755 3300048914 Bacteria 2303
598 Ga0496111_0096784 3300048914 Bacteria 2166
599 Ga0496112_0087025 3300048915 Bacteria 3091
600 Ga0496112_0107518 3300048915 Bacteria 2759
601 Ga0496112_0210571 3300048915 Bacteria 1901
602 Ga0496112_0390376 3300048915 Bacteria 1332
603 Ga0496113_0281726 3300048916 Bacteria 1329
604 Ga0496114_0035582 3300048917 Bacteria 4112
605 Ga0496115_0021454 3300048918 Bacteria 4991
606 Ga0496115_0037752 3300048918 Bacteria 3829
607 Ga0496115_0043348 3300048918 Bacteria 3588
608 Ga0496116_0037200 3300048919 Bacteria 3397
609 Ga0496117_0084392 3300048920 Bacteria 2072
610 Ga0496117_0177875 3300048920 Bacteria 1227
611 Ga0496117_0178316 3300048920 Bacteria 1224
612 Ga0496117_0263319 3300048920 Bacteria 933
613 Ga0496118_0024046 3300048921 Bacteria 5271
614 Ga0496118_0176871 3300048921 Bacteria 1295
615 Ga0496119_0009075 3300048922 Bacteria 8617
616 Ga0496119_0025547 3300048922 Bacteria 4121
617 Ga0496119_0389365 3300048922 Bacteria 667
618 Ga0496120_0032183 3300048923 Bacteria 3165
619 Ga0496121_0021718 3300048924 Bacteria 6272
620 Ga0496121_0026391 3300048924 Bacteria 5476
621 Ga0496121_0201185 3300048924 Bacteria 1419
622 Ga0496121_0212495 3300048924 Bacteria 1369
623 Ga0496121_0235287 3300048924 Bacteria 1280
624 Ga0496121_0343443 3300048924 Bacteria 997
625 Ga0496122_0056773 3300048925 Bacteria 2915
626 Ga0496124_0501360 3300048927 Bacteria 814
627 Ga0496125_0036077 3300048928 Bacteria 4324
628 Ga0496125_0130278 3300048928 Bacteria 1772
629 Ga0496125_0192633 3300048928 Bacteria 1344
630 Ga0496125_0237682 3300048928 Bacteria 1159
631 Ga0496126_0021458 3300048929 Bacteria 6306
632 Ga0496126_0073568 3300048929 Bacteria 3037
633 Ga0496126_0180249 3300048929 Bacteria 1795
634 Ga0496126_0236647 3300048929 Bacteria 1527
635 Ga0496126_0255698 3300048929 Bacteria 1458
636 Ga0496126_0291159 3300048929 Bacteria 1350
637 Ga0496126_0307291 3300048929 Bacteria 1306
638 Ga0495682_0059826 3300049460 Bacteria 1376
639 Ga0501031_0067076 3300049568 Bacteria 2338
640 Ga0501032_0127464 3300049569 Bacteria 1680
641 Ga0501033_0042269 3300049570 Bacteria 3398
642 Ga0501034_0130715 3300049571 Bacteria 2494
643 Ga0501036_0078810 3300049572 Bacteria 2786
644 Ga0501036_0342315 3300049572 Bacteria 1249
645 Ga0501038_0169176 3300049574 Bacteria 1770
646 Ga0501039_0042185 3300049575 Bacteria 3525
647 Ga0501046_0085782 3300049580 Bacteria 2427
648 Ga0501046_0159344 3300049580 Bacteria 1698
649 Ga0501047_0128083 3300049581 Bacteria 2418
650 Ga0501048_0075701 3300049582 Bacteria 2375
651 Ga0501067_0606110 3300049583 Bacteria 614
652 Ga0501070_0052265 3300049586 Bacteria 3391
653 Ga0501070_0075254 3300049586 Bacteria 2795
654 Ga0501071_0132872 3300049587 Bacteria 1850
655 Ga0501074_0032975 3300049590 Bacteria 3753
656 Ga0501074_0092394 3300049590 Bacteria 2167
657 Ga0501079_0286475 3300049741 Bacteria 1288
658 Ga0501080_0004892 3300049742 Bacteria 11942
659 Ga0501080_0167470 3300049742 Bacteria 2027
660 Ga0501044_0086872 3300049823 Bacteria 3159
661 Ga0501044_1382913 3300049823 Bacteria 569
662 nmdc:mga00v17_162327_c1 3300050491 Bacteria 1439
663 nmdc:mga00v17_70575_c1 3300050491 Bacteria 2164
664 nmdc:mga0yw44_190730_c1 3300050492 Bacteria 1352
665 nmdc:mga0k408_209435_c1 3300050493 Bacteria 1164
666 nmdc:mga0k408_869509_c1 3300050493 Bacteria 524
667 nmdc:mga07m45_368410_c1 3300050496 Bacteria 835
668 nmdc:mga05p37_213133_c1 3300050507 Bacteria 2334
669 nmdc:mga0qj67_309975_c1 3300050509 Bacteria 1278
670 nmdc:mga08y16_1404567_c1 3300050511 Bacteria 661
671 nmdc:mga0rr50_128322_c1 3300050513 Bacteria 2027
672 nmdc:mga08x19_156422_c1 3300050514 Bacteria 1546
673 nmdc:mga0sz30_142571_c1 3300050516 Bacteria 1058
674 nmdc:mga0sz30_156936_c1 3300050516 Bacteria 1008
675 nmdc:mga0sz30_86682_c2 3300050516 Bacteria 785
676 nmdc:mga0sz30_93636_c1 3300050516 Bacteria 1309
677 Ga0495601_0218484 3300053077 Bacteria 1245
678 Ga0495601_0261416 3300053077 Bacteria 1130
679 Ga0495612_0065275 3300053078 Bacteria 1512
680 Ga0500635_0055646 3300053080 Bacteria 1367
681 Ga0495595_0048111 3300053084 Bacteria 1969
682 Ga0495619_0296705 3300053085 Bacteria 1120
683 Ga0500578_0073568 3300053086 Bacteria 2177
684 Ga0500578_0151304 3300053086 Bacteria 1445
685 Ga0500578_0298316 3300053086 Bacteria 956
686 Ga0500643_000231 3300053087 Bacteria 51641
687 Ga0500644_0216071 3300053088 Bacteria 798
688 Ga0500647_0022727 3300053091 Bacteria 2937
689 Ga0500583_0038068 3300053092 Bacteria 2163
690 Ga0500651_0025302 3300053093 Bacteria 3724
691 Ga0500566_0000931 3300053094 Bacteria 16746
692 Ga0500641_0164704 3300053096 Bacteria 955
693 Ga0500650_0291985 3300053098 Bacteria 723
694 Ga0500555_002267 3300053103 Bacteria 5601
695 Ga0500555_097694 3300053103 Bacteria 749
696 Ga0500556_0264943 3300053104 Bacteria 675
697 Ga0500557_000179 3300053105 Bacteria 12626
698 Ga0500562_011871 3300053108 Bacteria 2213
699 Ga0500569_010567 3300053109 Bacteria 2180
700 Ga0500572_000668 3300053111 Bacteria 11350
701 Ga0500572_007171 3300053111 Bacteria 2575
702 Ga0500608_122841 3300053122 Bacteria 1175
703 Ga0500642_0000087 3300053130 Bacteria 48287
704 Ga0500652_335308 3300053131 Bacteria 576
705 Ga0500658_0073809 3300053134 Bacteria 1445
706 Ga0500559_0017216 3300053136 Bacteria 3051
707 Ga0500568_0045168 3300053139 Bacteria 1754
708 Ga0500577_0213391 3300053142 Bacteria 834
709 Ga0500604_0137025 3300053151 Bacteria 825
710 Ga0500616_0097472 3300053153 Bacteria 1443
711 Ga0500622_0004589 3300053156 Bacteria 8601
712 Ga0500627_0008055 3300053158 Bacteria 3718
713 Ga0500634_0065140 3300053161 Bacteria 1924
714 Ga0500638_095670 3300053162 Bacteria 1392
715 Ga0500639_002805 3300053163 Bacteria 8756
716 Ga0500636_0033935 3300053177 Bacteria 3019
717 Ga0500636_0523645 3300053177 Bacteria 519
718 Ga0500570_144234 3300053724 Bacteria 866
719 Ga0500611_052493 3300053727 Bacteria 939
720 Ga0500645_007988 3300053730 Bacteria 3645
721 Ga0500645_155811 3300053730 Bacteria 627
722 Ga0500609_033795 3300053731 Bacteria 704
723 Ga0500596_001693 3300053735 Bacteria 4468
724 Ga0500596_013426 3300053735 Bacteria 1237
725 Ga0500596_020443 3300053735 Bacteria 996
726 Ga0500599_001236 3300053736 Bacteria 2916
727 Ga0501084_0199140 3300054114 Bacteria 1690
728 Ga0501084_0499665 3300054114 Bacteria 1028
729 Ga0500661_016839 3300055283 Bacteria 1306
730 Ga0466962_0077533 3300061719 Bacteria 1589
731 Ga0530510_0480126 3300061734 Bacteria 941
732 2507504688 2507262055 Bacteria 8048963
733 2508539895 2508501009 Bacteria 7784016
734 2508694970 2508501042 Bacteria 8719808
735 2509149921 2508501128 Bacteria 8613869
736 2513625618 2513237092 Bacteria 8341956
737 2513652996 2513237095 Bacteria 8976980
738 2513701748 2513237102 Bacteria 7703324
739 2513874029 2513237139 Bacteria 8737671
740 2513889659 2513237141 Bacteria 8496279
741 2515627774 2515154112 Bacteria 8294334
742 2528850591 2528768022 Bacteria 10457665
743 2617377148 2617270741 Bacteria 8201522
744 2805920387 2802429603 Bacteria 8777136
745 2818243503 2816332527 Bacteria 8933356
746 2824605825 2824600985 Bacteria 8488197
747 2824611961 2824609381 Bacteria 8672835
748 2824622837 2824617872 Bacteria 8814715
749 2824631926 2824626560 Bacteria 8813858
750 2824639127 2824635225 Bacteria 8785348
751 2824650741 2824644064 Bacteria 8743947
752 2824658792 2824653114 Bacteria 8493680
753 2824664310 2824661429 Bacteria 9877870
754 2824676900 2824671348 Bacteria 8369588
755 2824693277 2824687955 Bacteria 8360029
756 2824701521 2824696289 Bacteria 8335049
757 2824719443 2824714736 Bacteria 8717648
758 2824732612 2824723954 Bacteria 8758240
759 2824734125 2824732956 Bacteria 7810675
760 2824749187 2824746037 Bacteria 7911610
761 2824780108 2824773399 Bacteria 8360218
762 2841942719 2841941048 Bacteria 8688029
763 2841952929 2841949485 Bacteria 8680857
764 2841971042 2841966195 Bacteria 8673214
765 2842049583 2842045827 Bacteria 8006841
766 2847943065 2847939898 Bacteria 8606328
767 2857515773 2857509624 Bacteria 7472071
768 2874593713 2874590934 Bacteria 8299676
769 2874647976 2874645413 Bacteria 8214782
770 2876772804 2876771140 Bacteria 8287509
771 2876826467 2876818435 Bacteria 8274608
772 2879077500 2879074833 Bacteria 8279565
773 2879089968 2879083081 Bacteria 8587928
774 2879105506 2879099564 Bacteria 10442239
775 2879134396 2879127579 Bacteria 8294491
776 2879147355 2879142872 Bacteria 8267021
777 2881666090 2881665667 Bacteria 8175609
778 2885369066 2885366525 Bacteria 8326213
779 2888378859 2888378607 Bacteria 9652610
780 2888427286 2888419890 Bacteria 7857137
781 2889036116 2889033259 Bacteria 9099371
782 2904669393 2904666416 Bacteria 8226587
783 2906645611 2906643746 Bacteria 8722424
784 2908783062 2908775508 Bacteria 8092255
785 2922377718
786 2922389183 2922386360 Bacteria 7017218
787 2929623313 2929615660 Bacteria 9193770
788 2929632596 2929624759 Bacteria 9339455
789 2932789207 2932784394 Bacteria 9704911
790 2932818133 2932809354 Bacteria 9135765
791 2932820283 2932818245 Bacteria 9955613
792 2932834457 2932828146 Bacteria 9745859
793 2933585216 2933577622 Bacteria 9116884
794 2935615117 2935608549 Bacteria 8203142
795 2935620140 2935616580 Bacteria 9032984
796 2935640458 2935638405 Bacteria 10015038
797 2935651526 2935648319 Bacteria 8801166
798 2935659706 2935656913 Bacteria 8965014
799 2935668652 2935665750 Bacteria 9571747
800 2935681954 2935675223 Bacteria 9928132
801 2935686960 2935684952 Bacteria 9590419
802 2935697070 2935694250 Bacteria 9291695
803 2935709838 2935703347 Bacteria 10242284
804 2935716648 2935713505 Bacteria 9608509
805 2935723227 2935722832 Bacteria 9608746
806 2935734784 2935732158 Bacteria 9706831
807 2935744425 2935741537 Bacteria 9707219
808 2935752926 2935750917 Bacteria 9590372
809 2935766824 2935760218 Bacteria 9817913
810 2935779697 2935777560 Bacteria 8077691
811 2935789685 2935785616 Bacteria 7962367
812 2935797947 2935793552 Bacteria 8012592
813 2935804572 2935801545 Bacteria 9301974
814 2935818212 2935810662 Bacteria 9401221
815 2935825845 2935819856 Bacteria 8261050
816 2935831964 2935827899 Bacteria 10038562
817 2935841204 2935837841 Bacteria 9454360
818 2935851464 2935847175 Bacteria 8228321
819 2935859026 2935855204 Bacteria 9035059
820 2935864207 2935864058 Bacteria 9784707
821 2935875441 2935873716 Bacteria 9632195
822 2935910510 2935908558 Bacteria 8568796
823 2935918086 2935916978 Bacteria 9113783
824 2935927579 2935926038 Bacteria 8601059
825 2935936549 2935934488 Bacteria 8602579
826 2935943898 2935942939 Bacteria 8599779
827 2935952335 2935951376 Bacteria 8602333
828 2935964003 2935959822 Bacteria 7869783
829 2935969175 2935967501 Bacteria 8603075
830 2935978439 2935975950 Bacteria 8347125
831 2935984628 2935984226 Bacteria 8302647
832 2935995580 2935992306 Bacteria 9802711
833 2936008000 2936002035 Bacteria 9362176
834 2936014122 2936011229 Bacteria 8801034
835 2936022969 2936019824 Bacteria 8804134
836 2936031105 2936028420 Bacteria 8965941
837 2936044822 2936037263 Bacteria 9446081
838 2936049227 2936046547 Bacteria 8903709
839 2936055673 2936055302 Bacteria 8785755
840 2940558839 2940556831 Bacteria 9590747
841 2941543430 2941538514 Bacteria 9402094
842 3005506429 3005506211 Bacteria 6943378
843 3005588923 3005587118 Bacteria 7794411
844 3005595588 3005594810 Bacteria 8716512
845 3005718838 3005718088 Bacteria 8283608
846 8016517585 8016511872 Bacteria 9921665
847 8016549740 8016548790 Bacteria 8155074
848 8016558158 8016557553 Bacteria 8154380
849 8016581597 8016575299 Bacteria 8154085
850 8016596163 8016595262 Bacteria 8149947
851 8016607063 8016603502 Bacteria 8731218
852 8016636468 8016630954 Bacteria 9217207
853 8017059036 8017057580 Bacteria 10023680
854 8019541049 8019538911 Bacteria 7872763
855 8019576603 8019576017 Bacteria 10049540
856 8019594478 8019586578 Bacteria 10212056
857 8019607084 8019597564 Bacteria 10041141
858 8019611424 8019608314 Bacteria 10042931
859 8019622204 8019619141 Bacteria 9218857
860 8019631112 8019629233 Bacteria 8687553
861 8019639512 8019638758 Bacteria 9062356
862 8019677333 8019668869 Bacteria 8791617
863 8019696865 8019687851 Bacteria 8712826
864 8055743255 8055742211 Bacteria 9226248
865 8056678435 8056673599 Bacteria 7871253
866 8056970696 8056967851 Bacteria 9038162
867 Ga0501032_0400493
868 JGI25153J46596_10033514
869 JGI25153J46596_10037071
870 JGI25160J50197_1013318
871 Ga0055539_1009637
872 Ga0055531_10015632
873 Ga0065165_1012522
874 Ga0065165_1077129
875 Ga0070658_10262669
876 Ga0070683_100067645
877 Ga0070683_100070645
878 Ga0070670_101051257
879 Ga0070666_10407866
880 Ga0070680_100038360
881 Ga0070682_100030995
882 Ga0068868_100824741
883 Ga0070660_100016551
884 Ga0070689_100762774
885 Ga0070691_10047567
886 Ga0070661_100666481
887 Ga0070661_100922997
888 Ga0070692_10635626
889 Ga0070668_100291738
890 Ga0070668_100368644
891 Ga0070668_100742232
892 Ga0070668_101065366
893 Ga0070669_100096348
894 Ga0070671_100953668
895 Ga0070659_100246541
896 Ga0070667_100472482
897 Ga0070709_10165845
898 Ga0070709_10182234
899 Ga0070714_100050500
900 Ga0070714_100111422
901 Ga0070713_100014007
902 Ga0070713_100450610
903 Ga0070710_10293085
904 Ga0070711_100024318
905 Ga0070663_100108980
906 Ga0070663_100348478
907 Ga0070678_100060242
908 Ga0070678_100275500
909 Ga0070678_100847761
910 Ga0070662_100301729
911 Ga0070681_10080143
912 Ga0070681_10140566
913 Ga0070681_10262104
914 Ga0070681_10572299
915 Ga0070685_10183029
916 Ga0070707_100216548
917 Ga0070679_100304289
918 Ga0070679_100557305
919 Ga0070684_100005197
920 Ga0070684_100073578
921 Ga0070697_100508499
922 Ga0068853_100156985
923 Ga0068853_100329145
924 Ga0068853_100457636
925 Ga0070693_100722044
926 Ga0070665_100120177
927 Ga0070665_100454604
928 Ga0070665_100945123
929 Ga0068855_100324958
930 Ga0068855_100350463
931 Ga0070664_100149720
932 Ga0070664_100300874
933 Ga0070664_101111841
934 Ga0068857_100639548
935 Ga0068857_100930309
936 Ga0068854_100108189
937 Ga0068854_100225483
938 Ga0068856_100333155
939 Ga0068852_100133685
940 Ga0068852_100195359
941 Ga0068852_100432784
942 Ga0068852_101619923
943 Ga0068859_100606613
944 Ga0068864_100282186
945 Ga0068851_10099579
946 Ga0068863_100346762
947 Ga0068863_100358896
948 Ga0068863_100536403
949 Ga0068863_101075487
950 Ga0068858_100186244
951 Ga0068858_100406503
952 Ga0068858_100515121
953 Ga0068860_100533251
954 Ga0068860_101077660
955 Ga0068862_100378117
956 Ga0081540_1047384
957 Ga0081540_1070925
958 Ga0081539_10088217
959 Ga0070717_10002055
960 Ga0070717_10025850
961 Ga0075365_10206647
962 Ga0075365_10232508
963 Ga0075365_10234257
964 Ga0075365_10364252
965 Ga0075365_10622319
966 Ga0075368_10009616
967 Ga0075363_100247745
968 Ga0075363_100264538
969 Ga0075363_100379374
970 Ga0075364_10152558
971 Ga0075364_10262342
972 Ga0075364_10277744
973 Ga0070716_100256662
974 Ga0070716_100719448
975 Ga0070712_100036410
976 Ga0075362_10059419
977 Ga0075367_10218165
978 Ga0075367_10324487
979 Ga0075367_10364528
980 Ga0075367_10596566
981 Ga0075369_10181476
982 Ga0075369_10211103
983 Ga0075369_10286017
984 Ga0075366_10018305
985 Ga0075366_10143689
986 Ga0075366_10479434
987 Ga0097621_100672367
988 Ga0075370_10234397
989 Ga0075370_10248780
990 Ga0068871_100454545
991 Ga0075428_100338329
992 Ga0097620_100606605
993 Ga0099823_1085769
994 Ga0075435_100142716
995 Ga0105240_10001522
996 Ga0105240_10039101
997 Ga0105240_10118623
998 Ga0105240_10377122
999 Ga0105245_10185096
1000 Ga0105245_10968557
1001 Ga0105247_10181651
1002 Ga0105247_10190188
1003 Ga0105247_10209937
1004 Ga0114129_10186448
1005 Ga0105243_10907816
1006 Ga0105241_10213333
1007 Ga0105242_10201271
1008 Ga0105248_10127908
1009 Ga0105248_10451617
1010 Ga0105248_10937152
1011 Ga0105237_10043065
1012 Ga0105237_10081784
1013 Ga0105237_10173918
1014 Ga0105237_10207163
1015 Ga0105237_10543982
1016 Ga0105237_10786368
1017 Ga0105237_10836987
1018 Ga0105238_10545277
1019 Ga0105238_11112038
1020 Ga0105238_11404517
1021 Ga0105249_10546486
1022 Ga0099796_10022000
1023 Ga0105239_10175070
1024 Ga0105239_10664518
1025 Ga0105239_11087032
1026 Ga0105239_11165830
1027 Ga0105239_11373142
1028 Ga0105239_11609889
1029 Ga0105239_11614904
1030 Ga0105246_10048250
1031 Ga0105246_10859604
1032 Ga0157314_1003836
1033 Ga0157371_10136557
1034 Ga0157370_10077383
1035 Ga0157370_10519605
1036 Ga0157370_10655669
1037 Ga0157369_10010577
1038 Ga0157369_10111832
1039 Ga0157369_10194618
1040 Ga0157374_10229486
1041 Ga0157374_11277486
1042 Ga0157378_11164949
1043 Ga0157378_11362339
1044 Ga0163162_10473514
1045 Ga0163162_11186576
1046 Ga0163162_11315793
1047 Ga0163162_11664201
1048 Ga0157372_10231909
1049 Ga0157372_10507255
1050 Ga0157372_11521526
1051 Ga0157372_12070924
1052 Ga0157375_10457366
1053 Ga0157375_10535403
1054 Ga0163163_10096851
1055 Ga0163163_10167718
1056 Ga0157380_10759698
1057 Ga0157380_11412267
1058 Ga0157379_10065931
1059 Ga0157376_10160668
1060 Ga0157376_10601087
1061 Ga0157376_10632910
1062 Ga0163161_10277455
1063 Ga0163161_10517824
1064 Ga0163161_10790537
1065 Ga0214544_1000007
1066 Ga0214542_1000216
1067 Ga0214542_1042175
1068 Ga0214545_1000118
1069 Ga0214545_1043334
1070 Ga0214543_1000009
1071 Ga0213872_10166416
1072 Ga0213874_10030678
1073 Ga0213876_10022972
1074 Ga0224712_10136980
1075 Ga0209563_103176
1076 Ga0209677_100296
1077 Ga0209677_106519
1078 Ga0209148_1001484
1079 Ga0209233_1006650
1080 Ga0209564_1021748
1081 Ga0209758_1000030
1082 Ga0209758_1000429
1083 Ga0209758_1006708
1084 Ga0209758_1033130
1085 Ga0209758_1034727
1086 Ga0209256_1002159
1087 Ga0207426_1001158
1088 Ga0207426_1008203
1089 Ga0207426_1078254
1090 Ga0209257_1005466
1091 Ga0209257_1026629
1092 Ga0207710_10108429
1093 Ga0207710_10244828
1094 Ga0207688_10049994
1095 Ga0207680_10476417
1096 Ga0207647_10017521
1097 Ga0207647_10191221
1098 Ga0207699_10241754
1099 Ga0207645_10385829
1100 Ga0207705_10048892
1101 Ga0207705_10168126
1102 Ga0207684_10073655
1103 Ga0207654_10253672
1104 Ga0207707_10016071
1105 Ga0207707_10082019
1106 Ga0207707_10185538
1107 Ga0207707_10269126
1108 Ga0207695_10000006
1109 Ga0207671_10498170
1110 Ga0207671_10498693
1111 Ga0207671_10558395
1112 Ga0207671_10585255
1113 Ga0207671_10692660
1114 Ga0207693_10037984
1115 Ga0207663_10018567
1116 Ga0207657_10003442
1117 Ga0207657_10208275
1118 Ga0207652_10015649
1119 Ga0207652_10270126
1120 Ga0207681_10475865
1121 Ga0207694_10243918
1122 Ga0207694_10362224
1123 Ga0207694_11148492
1124 Ga0207650_10694664
1125 Ga0207700_10004386
1126 Ga0207700_10036905
1127 Ga0207700_10359390
1128 Ga0207664_10112953
1129 Ga0207664_10175510
1130 Ga0207644_10122338
1131 Ga0207690_10029081
1132 Ga0207690_10673141
1133 Ga0207690_10702476
1134 Ga0207706_10163428
1135 Ga0207669_10865854
1136 Ga0207665_10220392
1137 Ga0207665_10429433
1138 Ga0207665_10611723
1139 Ga0207691_10580733
1140 Ga0207711_10323460
1141 Ga0207689_10939625
1142 Ga0207661_10000379
1143 Ga0207661_10042228
1144 Ga0207679_10144070
1145 Ga0207679_10520126
1146 Ga0207679_10886879
1147 Ga0207679_11449195
1148 Ga0207667_10226493
1149 Ga0207651_10749486
1150 Ga0207712_11183865
1151 Ga0207668_10055426
1152 Ga0207668_10292695
1153 Ga0207668_10909319
1154 Ga0207640_11174499
1155 Ga0207658_10909768
1156 Ga0207677_10038493
1157 Ga0207677_10767693
1158 Ga0207703_10181174
1159 Ga0207639_10086651
1160 Ga0207639_10184081
1161 Ga0207639_10313636
1162 Ga0207639_11012424
1163 Ga0207639_11217732
1164 Ga0207678_10077612
1165 Ga0207678_10174915
1166 Ga0207678_10975831
1167 Ga0207702_10229166
1168 Ga0207702_10285899
1169 Ga0207702_10337813
1170 Ga0207702_10480126
1171 Ga0207641_10513023
1172 Ga0207648_10593045
1173 Ga0207648_10821384
1174 Ga0207676_10405994
1175 Ga0207676_11325365
1176 Ga0207674_10663277
1177 Ga0207674_11046140
1178 Ga0207675_100157667
1179 Ga0207675_100953586
1180 Ga0207683_10089043
1181 Ga0207683_10147116
1182 Ga0207683_10488983
1183 Ga0207683_11075637
1184 Ga0207698_10143546
1185 Ga0207698_10158800
1186 Ga0209389_1000015
1187 Ga0209389_1000035
1188 Ga0209589_1000039
1189 Ga0209489_100072
1190 Ga0209489_100084
1191 Ga0209700_100034
1192 Ga0209813_10020652
1193 Ga0268266_10033807
1194 Ga0268266_10039481
1195 Ga0268266_10392170
1196 Ga0268266_11075393
1197 Ga0268264_10776862
1198 Ga0268264_10908123
1199 Ga0307517_10000066
1200 Ga0265340_10078084
1201 Ga0265339_10002540
1202 Ga0307508_10023991
1203 Ga0307516_10334304
1204 Ga0307405_10580691
1205 Ga0307405_10781400
1206 Ga0307407_10330785
1207 Ga0307412_10218952
1208 Ga0307416_100321671
1209 Ga0307416_101615683
1210 Ga0307411_11077849
1211 Ga0307415_100265892
1212 Ga0307510_10009663
1213 Ga0316215_1007381
1214 Ga0316213_1003479
1215 Ga0373958_0126472
1216 Ga0373928_0032860
1217 Ga0373934_0060865
1218 Ga0373944_0094694
1219 Ga0373944_0235089
1220 Ga0373923_0004740
1221 Ga0373939_0080834
1222 Ga0373945_0198753
1223 Ga0373954_0179668
1224 Ga0373956_0086675
1225 Ga0373957_0199298
1226 Ga0373943_0008271
1227 Ga0373943_0142886
1228 Ga0373946_0022042
1229 Ga0373955_0012972
1230 Ga0373935_0008474
1231 Ga0373935_0498589
1232 Ga0373927_0026977
1233 Ga0373927_0057019
1234 Ga0373927_0361617
1235 Ga0373933_0115072
1236 Ga0373947_0005615
1237 Ga0373947_0052888
1238 Ga0373947_0451247
1239 Ga0372808_009171
1240 Ga0373925_0686444
1241 Ga0373925_0934269
1242 Ga0395899_0047216
1243 Ga0395900_0041199
1244 Ga0395900_0133440
1245 Ga0395898_0020298
1246 Ga0395898_0074171
1247 Ga0395898_0195700
1248 Ga0395905_0004327
1249 Ga0395905_0764011
1250 Ga0395905_0801988
1251 Ga0436364_0136702
1252 Ga0436364_1443852
1253 Ga0395901_0129731
1254 Ga0395901_0181707
1255 Ga0395901_1091263
1256 Ga0436365_0661667
1257 Ga0436365_1810308
1258 Ga0436365_1812884
1259 Ga0436361_0536082
1260 Ga0436363_1392658
1261 Ga0451791_0030660
1262 Ga0451791_1119922
1263 Ga0451791_1553070
1264 Ga0451795_0110462
1265 Ga0451795_0382645
1266 Ga0451802_0059232
1267 Ga0451839_1326352
1268 Ga0451841_0245673
1269 Ga0451843_1639070
1270 Ga0451853_2076652
1271 Ga0466972_0133985
1272 Ga0466966_0002003
1273 Ga0466961_0000018
1274 Ga0466964_0039193
1275 Ga0466964_0078685
1276 Ga0466968_0009927
1277 Ga0466970_0053360
1278 Ga0466970_0138054
1279 Ga0466957_0163488
1280 Ga0466957_0230093
1281 Ga0466960_0133576
1282 Ga0466959_0002636
1283 Ga0466959_0034315
1284 Ga0466959_0040827
1285 Ga0466967_0050248
1286 Ga0466967_0337734
1287 Ga0495592_0077819
1288 Ga0495603_0099252
1289 Ga0495603_0136144
1290 Ga0495603_0164673
1291 Ga0495590_0137261
1292 Ga0495629_0005545
1293 Ga0495629_0169381
1294 Ga0495629_0224091
1295 Ga0495638_0008455
1296 Ga0495651_0025977
1297 Ga0495651_0070775
1298 Ga0495653_0038982
1299 Ga0495653_0108209
1300 Ga0495653_0553673
1301 Ga0495580_0014347
1302 Ga0495582_0038446
1303 Ga0495605_0080857
1304 Ga0495605_0109262
1305 Ga0495639_0003783
1306 Ga0495639_0039176
1307 Ga0495639_0424034
1308 Ga0495662_0078274
1309 Ga0495662_0093420
1310 Ga0495664_0226851
1311 Ga0495664_0297060
1312 Ga0495664_0422029
1313 Ga0495584_0264556
1314 Ga0495584_0375279
1315 Ga0495585_0211912
1316 Ga0495585_0236509
1317 Ga0495606_0050032
1318 Ga0495606_0221853
1319 Ga0495606_0315685
1320 Ga0495608_0016024
1321 Ga0495608_0211113
1322 Ga0495610_0053526
1323 Ga0495610_0072907
1324 Ga0495618_0035125
1325 Ga0495618_0049203
1326 Ga0495620_0158049
1327 Ga0495628_0074122
1328 Ga0495628_0276804
1329 Ga0495628_0876483
1330 Ga0495630_0020544
1331 Ga0495631_0064808
1332 Ga0495632_0247967
1333 Ga0495632_0325487
1334 Ga0495643_0036835
1335 Ga0495644_0189540
1336 Ga0495648_0056155
1337 Ga0495648_0193408
1338 Ga0495648_0268938
1339 Ga0495652_0047256
1340 Ga0495652_0692549
1341 Ga0495654_0182459
1342 Ga0495640_0016318
1343 Ga0495640_0045368
1344 Ga0495640_0338854
1345 Ga0495640_0773403
1346 Ga0495586_0082041
1347 Ga0495587_0020507
1348 Ga0495587_0381424
1349 Ga0495598_0046390
1350 Ga0495609_0154446
1351 Ga0495597_0055721
1352 Ga0495597_0196583
1353 Ga0495645_0044979
1354 Ga0495645_0107774
1355 Ga0495622_0016420
1356 Ga0495633_0211282
1357 Ga0495667_0035941
1358 Ga0495667_0052128
1359 Ga0495667_0168329
1360 Ga0495668_0421866
1361 Ga0495634_0046734
1362 Ga0495634_0194143
1363 Ga0495611_0374785
1364 Ga0495625_0013351
1365 Ga0495625_0119428
1366 Ga0495635_0040207
1367 Ga0495635_0118868
1368 Ga0495659_0025848
1369 Ga0495661_0058502
1370 Ga0495588_0020269
1371 Ga0495588_0188651
1372 Ga0495588_0332121
1373 Ga0495588_0381867
1374 Ga0495657_0003331
1375 Ga0495599_0022898
1376 Ga0495599_0486596
1377 Ga0495623_0024029
1378 Ga0495623_0124733
1379 Ga0495646_0100261
1380 Ga0495647_0005990
1381 Ga0495647_0041458
1382 Ga0495658_0008260
1383 Ga0495613_0022819
1384 Ga0495613_0046915
1385 Ga0495624_0127579
1386 Ga0495624_0232827
1387 Ga0495670_0447845
1388 Ga0495671_0207267
1389 Ga0495671_0226628
1390 Ga0495671_0278232
1391 Ga0495649_0048054
1392 Ga0495649_0097376
1393 Ga0495649_0238660
1394 Ga0495649_0428427
1395 Ga0495589_0069690
1396 Ga0495589_0110926
1397 Ga0495589_0333053
1398 Ga0495600_0156994
1399 Ga0495600_0231258
1400 Ga0495660_0055114
1401 Ga0495581_0064567
1402 Ga0495581_0327593
1403 Ga0495604_0007178
1404 Ga0495604_0011216
1405 Ga0495604_0220001
1406 Ga0495636_0054292
1407 Ga0495674_0013462
1408 Ga0495674_0072115
1409 Ga0495674_0733476
1410 Ga0495672_0043340
1411 Ga0495676_0020621
1412 Ga0495676_0113996
1413 Ga0495676_0321838
1414 Ga0495680_0002619
1415 Ga0495683_0334152
1416 Ga0495683_0348650
1417 Ga0495687_081653
1418 Ga0495675_0007823
1419 Ga0495679_038314
1420 Ga0495685_180499
1421 Ga0495673_0064702
1422 Ga0495673_0099566
1423 Ga0495681_0197805
1424 Ga0495684_0120392
1425 Ga0495684_0427188
1426 Ga0495686_0315776
1427 Ga0495593_0003341
1428 Ga0495593_0030634
1429 Ga0495593_0157334
1430 Ga0495602_0048059
1431 Ga0495602_0246879
1432 Ga0495615_0083588
1433 Ga0495626_0056962
1434 Ga0495626_0196950
1435 Ga0496100_0277751
1436 Ga0496101_0168879
1437 Ga0496101_0434334
1438 Ga0496102_0029630
1439 Ga0496102_0135069
1440 Ga0496102_0636288
1441 Ga0496102_0976846
1442 Ga0496103_0016458
1443 Ga0496104_0002055
1444 Ga0496104_0047669
1445 Ga0496104_0093803
1446 Ga0496104_0208826
1447 Ga0496105_0000745
1448 Ga0496105_0027123
1449 Ga0496105_0095923
1450 Ga0496105_0525320
1451 Ga0496106_0128417
1452 Ga0496107_0042886
1453 Ga0496107_0095035
1454 Ga0496108_0127781
1455 Ga0496108_0163040
1456 Ga0496108_1150531
1457 Ga0496109_0042780
1458 Ga0496109_0171892
1459 Ga0496109_0202106
1460 Ga0496110_0058446
1461 Ga0496110_0116321
1462 Ga0496110_0459296
1463 Ga0496111_0085755
1464 Ga0496111_0096784
1465 Ga0496112_0087025
1466 Ga0496112_0107518
1467 Ga0496112_0210571
1468 Ga0496112_0390376
1469 Ga0496113_0281726
1470 Ga0496114_0035582
1471 Ga0496115_0021454
1472 Ga0496115_0037752
1473 Ga0496115_0043348
1474 Ga0496116_0037200
1475 Ga0496117_0084392
1476 Ga0496117_0177875
1477 Ga0496117_0178316
1478 Ga0496117_0263319
1479 Ga0496118_0024046
1480 Ga0496118_0176871
1481 Ga0496119_0009075
1482 Ga0496119_0025547
1483 Ga0496119_0389365
1484 Ga0496120_0032183
1485 Ga0496121_0021718
1486 Ga0496121_0026391
1487 Ga0496121_0201185
1488 Ga0496121_0212495
1489 Ga0496121_0235287
1490 Ga0496121_0343443
1491 Ga0496122_0056773
1492 Ga0496124_0501360
1493 Ga0496125_0036077
1494 Ga0496125_0130278
1495 Ga0496125_0192633
1496 Ga0496125_0237682
1497 Ga0496126_0021458
1498 Ga0496126_0073568
1499 Ga0496126_0180249
1500 Ga0496126_0236647
1501 Ga0496126_0255698
1502 Ga0496126_0291159
1503 Ga0496126_0307291
1504 Ga0495682_0059826
1505 Ga0501031_0067076
1506 Ga0501032_0127464
1507 Ga0501033_0042269
1508 Ga0501034_0130715
1509 Ga0501036_0078810
1510 Ga0501036_0342315
1511 Ga0501038_0169176
1512 Ga0501039_0042185
1513 Ga0501046_0085782
1514 Ga0501046_0159344
1515 Ga0501047_0128083
1516 Ga0501048_0075701
1517 Ga0501067_0606110
1518 Ga0501070_0052265
1519 Ga0501070_0075254
1520 Ga0501071_0132872
1521 Ga0501074_0032975
1522 Ga0501074_0092394
1523 Ga0501079_0286475
1524 Ga0501080_0004892
1525 Ga0501080_0167470
1526 Ga0501044_0086872
1527 Ga0501044_1382913
1528 nmdc:mga00v17_162327_c1
1529 nmdc:mga00v17_70575_c1
1530 nmdc:mga0yw44_190730_c1
1531 nmdc:mga0k408_209435_c1
1532 nmdc:mga0k408_869509_c1
1533 nmdc:mga07m45_368410_c1
1534 nmdc:mga05p37_213133_c1
1535 nmdc:mga0qj67_309975_c1
1536 nmdc:mga08y16_1404567_c1
1537 nmdc:mga0rr50_128322_c1
1538 nmdc:mga08x19_156422_c1
1539 nmdc:mga0sz30_142571_c1
1540 nmdc:mga0sz30_156936_c1
1541 nmdc:mga0sz30_86682_c2
1542 nmdc:mga0sz30_93636_c1
1543 Ga0495601_0218484
1544 Ga0495601_0261416
1545 Ga0495612_0065275
1546 Ga0500635_0055646
1547 Ga0495595_0048111
1548 Ga0495619_0296705
1549 Ga0500578_0073568
1550 Ga0500578_0151304
1551 Ga0500578_0298316
1552 Ga0500643_000231
1553 Ga0500644_0216071
1554 Ga0500647_0022727
1555 Ga0500583_0038068
1556 Ga0500651_0025302
1557 Ga0500566_0000931
1558 Ga0500641_0164704
1559 Ga0500650_0291985
1560 Ga0500555_002267
1561 Ga0500555_097694
1562 Ga0500556_0264943
1563 Ga0500557_000179
1564 Ga0500562_011871
1565 Ga0500569_010567
1566 Ga0500572_000668
1567 Ga0500572_007171
1568 Ga0500608_122841
1569 Ga0500642_0000087
1570 Ga0500652_335308
1571 Ga0500658_0073809
1572 Ga0500559_0017216
1573 Ga0500568_0045168
1574 Ga0500577_0213391
1575 Ga0500604_0137025
1576 Ga0500616_0097472
1577 Ga0500622_0004589
1578 Ga0500627_0008055
1579 Ga0500634_0065140
1580 Ga0500638_095670
1581 Ga0500639_002805
1582 Ga0500636_0033935
1583 Ga0500636_0523645
1584 Ga0500570_144234
1585 Ga0500611_052493
1586 Ga0500645_007988
1587 Ga0500645_155811
1588 Ga0500609_033795
1589 Ga0500596_001693
1590 Ga0500596_013426
1591 Ga0500596_020443
1592 Ga0500599_001236
1593 Ga0501084_0199140
1594 Ga0501084_0499665
1595 Ga0500661_016839
1596 Ga0466962_0077533
1597 Ga0530510_0480126
1598 2507504688
1599 2508539895
1600 2508694970
1601 2509149921
1602 2513625618
1603 2513652996
1604 2513701748
1605 2513874029
1606 2513889659
1607 2515627774
1608 2528850591
1609 2617377148
1610 2805920387
1611 2818243503
1612 2824605825
1613 2824611961
1614 2824622837
1615 2824631926
1616 2824639127
1617 2824650741
1618 2824658792
1619 2824664310
1620 2824676900
1621 2824693277
1622 2824701521
1623 2824719443
1624 2824732612
1625 2824734125
1626 2824749187
1627 2824780108
1628 2841942719
1629 2841952929
1630 2841971042
1631 2842049583
1632 2847943065
1633 2857515773
1634 2874593713
1635 2874647976
1636 2876772804
1637 2876826467
1638 2879077500
1639 2879089968
1640 2879105506
1641 2879134396
1642 2879147355
1643 2881666090
1644 2885369066
1645 2888378859
1646 2888427286
1647 2889036116
1648 2904669393
1649 2906645611
1650 2908783062
1651 2922377718
1652 2922389183
1653 2929623313
1654 2929632596
1655 2932789207
1656 2932818133
1657 2932820283
1658 2932834457
1659 2933585216
1660 2935615117
1661 2935620140
1662 2935640458
1663 2935651526
1664 2935659706
1665 2935668652
1666 2935681954
1667 2935686960
1668 2935697070
1669 2935709838
1670 2935716648
1671 2935723227
1672 2935734784
1673 2935744425
1674 2935752926
1675 2935766824
1676 2935779697
1677 2935789685
1678 2935797947
1679 2935804572
1680 2935818212
1681 2935825845
1682 2935831964
1683 2935841204
1684 2935851464
1685 2935859026
1686 2935864207
1687 2935875441
1688 2935910510
1689 2935918086
1690 2935927579
1691 2935936549
1692 2935943898
1693 2935952335
1694 2935964003
1695 2935969175
1696 2935978439
1697 2935984628
1698 2935995580
1699 2936008000
1700 2936014122
1701 2936022969
1702 2936031105
1703 2936044822
1704 2936049227
1705 2936055673
1706 2940558839
1707 2941543430
1708 3005506429
1709 3005588923
1710 3005595588
1711 3005718838
1712 8016517585
1713 8016549740
1714 8016558158
1715 8016581597
1716 8016596163
1717 8016607063
1718 8016636468
1719 8017059036
1720 8019541049
1721 8019576603
1722 8019594478
1723 8019607084
1724 8019611424
1725 8019622204
1726 8019631112
1727 8019639512
1728 8019677333
1729 8019696865
1730 8055743255
1731 8056678435
1732 8056970696

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07475

Hpr_kinase_C

HPr Serine kinase C-terminal domain

1

149

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xal-assembly1.cif.gz_A y99f mutant of thermus thermophilus hb8 thymidylate kinase 0.9086 27 49
5x8k-assembly1.cif.gz_A v158t mutant of thermus thermophilus hb8 thymidylate kinase 0.9028 27 49
5x8a-assembly1.cif.gz_B crystal structure of atp bound thymidylate kinase from thermus thermophilus hb8 0.8969 27 49
4rfv-assembly1.cif.gz_A structure of the mycobacterium tuberculosis aps kinase cysc cys556ala mutant 0.8873 25 49
5x8v-assembly1.cif.gz_A y92h mutant of thermus thermophilus hb8 thymidylate kinase 0.882 27 49
ID Description Score Start End Superfamily
af_Q4DDG5_124_392_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9102 25 48 3.40.50.300
af_Q10DY0_3_261_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8333 25 55 3.40.50.300
af_P96394_152_310_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8041 25 47 3.40.50.300
af_Q9GS21_1_131_3.30.390.110 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1; 0.7837 62 73 3.30.390.110
3tqfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7834 11 149 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W6SQG8-F1-model_v4 Serine kinase of HPr protein (Carbohydrate metabolism regulator) 0.9921 13 154 GO:0000155
GO:0005524
GO:0006109
AF-B6JJT4-F1-model_v4 HprK/P domain protein 0.9917 10 152 GO:0000155
GO:0005524
GO:0006109
AF-A0A431MAJ2-F1-model_v4 Serine kinase 0.9886 7 152 GO:0000155
GO:0005524
GO:0006109
AF-A0A7T8BWW8-F1-model_v4 deleted 0.9883 8 154
AF-A3WS26-F1-model_v4 HPr kinase/phosphorylase C-terminal domain-containing protein 0.9875 11 153 GO:0000155
GO:0005524
GO:0006109

Map