F484041

General Info

Members Datasets Scaffolds Average Seq Length
866 715 1732 232

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2854896431|2854897367
Length 254
Sequence ATATAQTYISSAQLETPMILDAARLSLTNLFAPETRNVFWKTLGLTILVLVGLWFSLRELFAYYAWPWMAAFFPDLPDWTGWLTFIAAIAASIGLALGLALLIAPITALIAGLFLDDVAEVVEKRDYPNDPPGKALPLGQAIIGSIKFLGVVIVGNIIALFLLFIPGINLIAFFLVNGYLLGREFFEFAAMRFRTPTEARAFRSKHSSTVFMAGLLIACFLAVPIVNLLTPLFAAGLMVHLHKAISKRDPAFKG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
40 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
41 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
54 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
55 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
56 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
57 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
58 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
81 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
85 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
95 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
96 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
97 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
98 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
101 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
102 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
103 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
104 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
107 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
108 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
109 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
110 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
111 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
203 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
204 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
205 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
206 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
207 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
208 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
209 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
210 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
215 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
216 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
220 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
221 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
222 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
227 2509276019 Ensifer aridi TW10 Isolate Nodule
228 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
229 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
230 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
231 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
232 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
233 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
234 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
235 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
236 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
237 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
238 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
239 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
240 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
241 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
242 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
243 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
244 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
245 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
246 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
247 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
248 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
249 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
250 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
251 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
252 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
253 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
254 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
255 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
256 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
257 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
258 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
259 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
260 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
261 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
262 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
263 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
264 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
265 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
266 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
267 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
268 2534681786 Brucella suis 92/29 Isolate Unclassified
269 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
270 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
271 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
272 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
273 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
274 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
275 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
276 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
277 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
278 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
279 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
280 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
281 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
282 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
283 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
284 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
285 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
286 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
287 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
288 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
289 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
290 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
291 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
292 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
293 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
294 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
295 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
296 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
297 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
298 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
299 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
300 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
301 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
302 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
303 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
304 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
305 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
306 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
307 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
308 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
309 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
310 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
311 2643221557 Ensifer sp. Root558 Isolate Unclassified
312 2643221558 Rhizobium sp. Root149 Isolate Unclassified
313 2643221582 Rhizobium sp. Root651 Isolate Unclassified
314 2643221599 Rhizobium sp. Root708 Isolate Unclassified
315 2643221607 Rhizobium sp. Root73 Isolate Unclassified
316 2643221610 Ensifer sp. Root74 Isolate Unclassified
317 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
318 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
319 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
320 2643221668 Ensifer sp. Root423 Isolate Unclassified
321 2643221675 Ensifer sp. Root1298 Isolate Unclassified
322 2643221680 Ensifer sp. Root1312 Isolate Unclassified
323 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
324 2643221688 Rhizobium sp. Root482 Isolate Unclassified
325 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
326 2643221693 Rhizobium sp. Root491 Isolate Unclassified
327 2643221719 Rhizobium sp. Root274 Isolate Unclassified
328 2643221723 Ensifer sp. Root278 Isolate Unclassified
329 2643221726 Ensifer sp. Root954 Isolate Unclassified
330 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
331 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
332 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
333 2718217882 Rhizobium sp. N741 Isolate Nodule
334 2718217927 Rhizobium sp. N324 Isolate Nodule
335 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
336 2718218009 Rhizobium sp. N561 Isolate Nodule
337 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
338 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
339 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
340 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
341 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
342 2718218363 Rhizobium sp. N113 Isolate Nodule
343 2718218365 Rhizobium sp. N731 Isolate Nodule
344 2718218366 Rhizobium sp. N621 Isolate Nodule
345 2718218423 Rhizobium sp. N941 Isolate Nodule
346 2721755514 Rhizobium sp. N6212 Isolate Nodule
347 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
348 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
349 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
350 2721755809 Rhizobium sp. N541 Isolate Nodule
351 2721755810 Rhizobium sp. N871 Isolate Nodule
352 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
353 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
354 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
355 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
356 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
357 2728369365 Rhizobium sp. N1341 Isolate Nodule
358 2728369397 Rhizobium sp. N1314 Isolate Nodule
359 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
360 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
361 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
362 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
363 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
364 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
365 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
366 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
367 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
368 2791355256 Rhizobium sp. M10 Isolate Nodule
369 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
370 2791355260 Rhizobium sp. L9 Isolate Nodule
371 2791355262 Rhizobium sp. M1 Isolate Nodule
372 2791355264 Rhizobium sp. S9 Isolate Nodule
373 2791355265 Rhizobium sp. H4 Isolate Nodule
374 2791355266 Rhizobium sp. L43 Isolate Nodule
375 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
376 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
377 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
378 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
379 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
380 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
381 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
382 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
383 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
384 2802429633 Rhizobium anhuiense J3 Isolate Nodule
385 2802429634 Rhizobium anhuiense S10 Isolate Nodule
386 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
387 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
388 2802429637 Rhizobium anhuiense C15 Isolate Nodule
389 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
390 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
391 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
392 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
393 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
394 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
395 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
396 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
397 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
398 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
399 2838048938 Rhizobium pisi 27/80 Isolate Nodule
400 2838061910 Rhizobium phaseoli L15 Isolate Nodule
401 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
402 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
403 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
404 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
405 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
406 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
407 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
408 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
409 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
410 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
411 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
412 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
413 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
414 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
415 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
416 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
417 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
418 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
419 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
420 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
421 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
422 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
423 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
424 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
425 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
426 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
427 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
428 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
429 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
430 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
431 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
432 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
433 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
434 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
435 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
436 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
437 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
438 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
439 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
440 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
441 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
442 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
443 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
444 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
445 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
446 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
447 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
448 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
449 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
450 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
451 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
452 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
453 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
454 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
455 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
456 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
457 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
458 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
459 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
460 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
461 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
462 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
463 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
464 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
465 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
466 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
467 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
468 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
469 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
470 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
471 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
472 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
473 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
474 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
475 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
476 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
477 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
478 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
479 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
480 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
481 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
482 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
483 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
484 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
485 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
486 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
487 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
488 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
489 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
490 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
491 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
492 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
493 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
494 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
495 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
496 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
497 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
498 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
499 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
500 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
501 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
502 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
503 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
504 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
505 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
506 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
507 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
508 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
509 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
510 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
511 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
512 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
513 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
514 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
515 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
516 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
517 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
518 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
519 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
520 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
521 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
522 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
523 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
524 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
525 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
526 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
527 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
528 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
529 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
530 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
531 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
532 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
533 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
534 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
535 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
536 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
537 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
538 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
539 2933599457 Rhizobium phaseoli M3 Isolate Nodule
540 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
541 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
542 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
543 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
544 2936381700 Rhizobium chutanense C16 Isolate Unclassified
545 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
546 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
547 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
548 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
549 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
550 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
551 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
552 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
553 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
554 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
555 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
556 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
557 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
558 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
559 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
560 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
561 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
562 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
563 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
564 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
565 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
566 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
567 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
568 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
569 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
570 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
571 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
572 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
573 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
574 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
575 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
576 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
577 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
578 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
579 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
580 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
581 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
582 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
583 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
584 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
585 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
586 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
587 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
588 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
589 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
590 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
591 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
592 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
593 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
594 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
595 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
596 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
597 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
598 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
599 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
600 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
601 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
602 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
603 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
604 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
605 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
606 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
607 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
608 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
609 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
610 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
611 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
612 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
613 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
614 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
615 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
616 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
617 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
618 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
619 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
620 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
621 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
622 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
623 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
624 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
625 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
626 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
627 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
628 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
629 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
630 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
631 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
632 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
633 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
634 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
635 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
636 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
637 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
638 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
639 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
640 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
641 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
642 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
643 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
644 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
645 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
646 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
647 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
648 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
649 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
650 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
651 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
652 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
653 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
654 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
655 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
656 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
657 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
658 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
659 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
660 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
661 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
662 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
663 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
664 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
665 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
666 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
667 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
668 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
669 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
670 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
671 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
672 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
673 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
674 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
675 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
676 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
677 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
678 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
679 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
680 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
681 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
682 8005275841 Rhizobium sp. N4311 Isolate Nodule
683 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
684 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
685 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
686 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
687 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
688 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
689 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
690 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
691 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
692 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
693 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
694 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
695 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
696 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
697 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
698 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
699 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
700 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
701 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
702 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
703 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
704 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
705 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
706 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
707 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
708 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
709 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
710 8024501048 Rhizobium sp. H4 Isolate Nodule
711 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
712 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
713 8056382006 Rhizobium croatiense 13T Isolate Nodule
714 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
715 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.07
Metatranscriptomes 0.35
Isolates 56.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 14.43
Nodule 45.03
Rhizoplane 1.62
Rhizosphere 23.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006141 3300001979 Bacteria 5014
2 JGI25158J39367_1000067 3300002739 Bacteria 23368
3 JGI25152J39213_1000617 3300002773 Bacteria 19093
4 JGI25152J39213_1001046 3300002773 Bacteria 13136
5 JGI25152J39213_1007830 3300002773 Bacteria 2721
6 JGI25159J45721_1000023 3300002987 Bacteria 116643
7 JGI25159J45721_1000690 3300002987 Bacteria 14818
8 JGI25151J46595_10003849 3300003187 Bacteria 8119
9 JGI25151J46595_10013034 3300003187 Bacteria 3755
10 JGI25151J46595_10019779 3300003187 Bacteria 2851
11 JGI25165J46597_1003966 3300003214 Bacteria 3392
12 JGI25153J46596_10000837 3300003215 Bacteria 18811
13 rootH1_10070514 3300003316 Bacteria 3062
14 rootH1_10070669 3300003316 Bacteria 4665
15 rootL2_10106171 3300003322 Bacteria 6080
16 rootL2_10173186 3300003322 Bacteria 2902
17 rootH1_10012212 3300003323 Bacteria 2202
18 rootH1_10188506 3300003323 Bacteria 1790
19 JGI25160J50197_1000061 3300003354 Bacteria 116643
20 JGI25160J50197_1003385 3300003354 Bacteria 7146
21 JGI25161J50226_1000103 3300003374 Bacteria 67942
22 JGI25161J50226_1004258 3300003374 Bacteria 3036
23 Ga0055526_1000562 3300003771 Bacteria 29362
24 Ga0055526_1001848 3300003771 Bacteria 14656
25 Ga0055526_1004244 3300003771 Bacteria 8687
26 Ga0055526_1015494 3300003771 Bacteria 3058
27 Ga0055526_1049235 3300003771 Bacteria 975
28 Ga0055524_1006120 3300003775 Bacteria 5264
29 Ga0055524_1009115 3300003775 Bacteria 4065
30 Ga0055524_1042435 3300003775 Bacteria 1131
31 Ga0055524_1044318 3300003775 Bacteria 1082
32 Ga0055528_1000581 3300003790 Bacteria 27606
33 Ga0055528_1000777 3300003790 Bacteria 22196
34 Ga0055528_1000954 3300003790 Bacteria 19173
35 Ga0055528_1018148 3300003790 Bacteria 2398
36 Ga0055540_1014273 3300003792 Bacteria 2375
37 Ga0058692_1027301 3300003856 Bacteria 1114
38 Ga0055543_1000029 3300004625 Bacteria 131452
39 Ga0055543_1000247 3300004625 Bacteria 41352
40 Ga0065165_1000047 3300005262 Bacteria 197811
41 Ga0065165_1003871 3300005262 Bacteria 9931
42 Ga0065165_1005227 3300005262 Bacteria 7452
43 Ga0070669_100211128 3300005353 Bacteria 1531
44 Ga0070665_100031575 3300005548 Bacteria 5332
45 Ga0070665_100064304 3300005548 Bacteria 3679
46 Ga0070665_100072449 3300005548 Bacteria 3453
47 Ga0070665_100181096 3300005548 Bacteria 2108
48 Ga0068854_100131282 3300005578 Bacteria 1913
49 Ga0068856_100073835 3300005614 Bacteria 3377
50 Ga0068856_100337400 3300005614 Bacteria 1525
51 Ga0081455_10336886 3300005937 Bacteria 1069
52 Ga0075365_10003524 3300006038 Bacteria 8090
53 Ga0075365_10117922 3300006038 Bacteria 1829
54 Ga0075368_10095261 3300006042 Bacteria 1219
55 Ga0075363_100025707 3300006048 Bacteria 3006
56 Ga0075362_10004298 3300006177 Bacteria 5095
57 Ga0075367_10031713 3300006178 Bacteria 3036
58 Ga0075369_10034102 3300006186 Bacteria 2160
59 Ga0075366_10194290 3300006195 Bacteria 1233
60 Ga0075370_10281206 3300006353 Bacteria 988
61 Ga0079104_1000063 3300006946 Bacteria 159519
62 Ga0079104_1003920 3300006946 Bacteria 6646
63 Ga0079104_1007819 3300006946 Bacteria 3816
64 Ga0099826_10031887 3300006948 Bacteria 3805
65 Ga0105240_10000019 3300009093 Bacteria 406211
66 Ga0105243_10009838 3300009148 Bacteria 7277
67 Ga0105248_10578310 3300009177 Bacteria 1267
68 Ga0105237_10002910 3300009545 Bacteria 20751
69 Ga0123341_1061718 3300009765 Bacteria 1824
70 Ga0123342_1017862 3300009766 Bacteria 5800
71 Ga0105033_101349 3300009986 Bacteria 1993
72 Ga0105239_10006284 3300010375 Bacteria 13818
73 Ga0105246_10241300 3300011119 Bacteria 1429
74 Ga0157373_10011904 3300013100 Bacteria 6391
75 Ga0157373_10167766 3300013100 Bacteria 1545
76 Ga0157371_10000005 3300013102 Bacteria 416456
77 Ga0157370_10000036 3300013104 Bacteria 136933
78 Ga0157370_10003629 3300013104 Bacteria 18051
79 Ga0157369_10423168 3300013105 Bacteria 1381
80 Ga0171463_1001 3300013249 Bacteria 1406070
81 Ga0182007_10003737 3300015262 Bacteria 7109
82 Ga0182005_1005785 3300015265 Bacteria 3838
83 Ga0183363_1069 3300015690 Bacteria 30410
84 Ga0163161_10225970 3300017792 Bacteria 1451
85 Ga0214544_1000652 3300021320 Bacteria 65892
86 Ga0214542_1000146 3300021321 Bacteria 103035
87 Ga0214543_1000054 3300021327 Bacteria 140288
88 Ga0228711_1000006 3300022739 Bacteria 202437
89 Ga0228710_1000004 3300022740 Bacteria 250560
90 Ga0209436_100026 3300025208 Bacteria 90859
91 Ga0209436_101144 3300025208 Bacteria 9800
92 Ga0209437_104045 3300025233 Bacteria 2602
93 Ga0207425_1025107 3300025245 Bacteria 1232
94 Ga0209646_1004280 3300025246 Bacteria 2623
95 Ga0209677_100155 3300025253 Bacteria 62873
96 Ga0209129_1000203 3300025258 Bacteria 70739
97 Ga0209129_1002674 3300025258 Bacteria 8430
98 Ga0209233_1000459 3300025261 Bacteria 26552
99 Ga0209673_1000037 3300025273 Bacteria 313804
100 Ga0209673_1000320 3300025273 Bacteria 88073
101 Ga0209673_1003729 3300025273 Bacteria 8710
102 Ga0209673_1005902 3300025273 Bacteria 6054
103 Ga0209673_1026708 3300025273 Bacteria 1890
104 Ga0209673_1046747 3300025273 Bacteria 1179
105 Ga0209130_1000005 3300025284 Bacteria 599620
106 Ga0209130_1000030 3300025284 Bacteria 323323
107 Ga0209676_1001526 3300025292 Bacteria 21036
108 Ga0209025_1000037 3300025294 Bacteria 383429
109 Ga0209025_1000445 3300025294 Bacteria 81092
110 Ga0209025_1000566 3300025294 Bacteria 67702
111 Ga0209025_1000777 3300025294 Bacteria 52804
112 Ga0209025_1044100 3300025294 Bacteria 1869
113 Ga0209564_1000113 3300025295 Bacteria 211564
114 Ga0209564_1000207 3300025295 Bacteria 135313
115 Ga0209564_1000345 3300025295 Bacteria 88073
116 Ga0209564_1013159 3300025295 Bacteria 3538
117 Ga0209564_1046400 3300025295 Bacteria 1107
118 Ga0209758_1000561 3300025297 Bacteria 58483
119 Ga0209758_1001098 3300025297 Bacteria 35006
120 Ga0209758_1001230 3300025297 Bacteria 32053
121 Ga0209758_1004194 3300025297 Bacteria 12234
122 Ga0209050_1006048 3300025298 Bacteria 7327
123 Ga0209256_1000343 3300025299 Bacteria 75902
124 Ga0209256_1001345 3300025299 Bacteria 26077
125 Ga0209256_1001773 3300025299 Bacteria 20488
126 Ga0209256_1002948 3300025299 Bacteria 12766
127 Ga0209256_1006537 3300025299 Bacteria 6118
128 Ga0207426_1000015 3300025302 Bacteria 599316
129 Ga0207426_1000047 3300025302 Bacteria 417011
130 Ga0209051_1000900 3300025303 Bacteria 29687
131 Ga0209051_1012578 3300025303 Bacteria 4087
132 Ga0209051_1016583 3300025303 Bacteria 3325
133 Ga0209051_1040409 3300025303 Bacteria 1672
134 Ga0209051_1048253 3300025303 Bacteria 1445
135 Ga0207695_10000049 3300025913 Bacteria 406233
136 Ga0207671_10000107 3300025914 Bacteria 128950
137 Ga0207681_10226437 3300025923 Bacteria 1449
138 Ga0207681_10233765 3300025923 Bacteria 1428
139 Ga0207709_10009993 3300025935 Bacteria 5227
140 Ga0207702_10079070 3300026078 Bacteria 2849
141 Ga0207702_10789618 3300026078 Bacteria 938
142 Ga0209281_1000102 3300027111 Bacteria 221665
143 Ga0209281_1000110 3300027111 Bacteria 215631
144 Ga0209281_1002636 3300027111 Bacteria 6873
145 Ga0209371_1001449 3300027312 Bacteria 16072
146 Ga0209282_1000013 3300027666 Bacteria 215053
147 Ga0209282_1058003 3300027666 Bacteria 2173
148 Ga0268266_10021832 3300028379 Bacteria 5454
149 Ga0268266_10185595 3300028379 Bacteria 1896
150 Ga0268266_10240447 3300028379 Bacteria 1671
151 Ga0268256_1007425 3300030500 Bacteria 3915
152 Ga0268256_1007696 3300030500 Bacteria 3799
153 Ga0316181_1082338 3300030744 Bacteria 1094
154 Ga0307408_100344821 3300031548 Bacteria 1262
155 Ga0307405_10265698 3300031731 Bacteria 1284
156 Ga0307410_10116073 3300031852 Bacteria 1945
157 Ga0307406_10027412 3300031901 Bacteria 3433
158 Ga0307412_10136755 3300031911 Bacteria 1789
159 Ga0315914_1000004 3300031967 Bacteria 288534
160 Ga0307416_100670239 3300032002 Bacteria 1124
161 Ga0307414_10297086 3300032004 Bacteria 1364
162 Ga0315913_1000011 3300033430 Bacteria 140532
163 Ga0315915_1000003 3300033464 Bacteria 407996
164 Ga0439436_0029616 3300041404 Bacteria 1594
165 Ga0439439_0044887 3300041406 Bacteria 1151
166 Ga0439466_0051517 3300041411 Bacteria 1348
167 Ga0439465_0004511 3300041413 Bacteria 4502
168 Ga0451798_1165102 3300041458 Bacteria 1617
169 Ga0451833_0841414 3300041491 Bacteria 2783
170 Ga0451835_0025022 3300041492 Bacteria 4591
171 Ga0451839_0537862 3300041496 Bacteria 2154
172 Ga0451840_20407 3300041497 Bacteria 1154
173 Ga0451841_0362176 3300041498 Bacteria 6494
174 Ga0451845_0189690 3300041501 Bacteria 5806
175 Ga0451846_59899 3300041502 Bacteria 1340
176 Ga0451847_0407225 3300041503 Bacteria 3145
177 Ga0451851_0589931 3300041507 Bacteria 1996
178 Ga0451854_17764 3300041510 Bacteria 1920
179 Ga0451855_1428311 3300041511 Bacteria 2032
180 Ga0451853_2604503 3300041512 Bacteria 992
181 Ga0439432_012345 3300042006 Bacteria 2927
182 Ga0439449_0007873 3300042007 Bacteria 4047
183 Ga0466970_0008760 3300044765 Bacteria 5098
184 Ga0466958_0084385 3300045836 Bacteria 1959
185 Ga0466967_0248948 3300045976 Bacteria 1697
186 Ga0495638_0001560 3300046460 Bacteria 20568
187 Ga0495638_0022297 3300046460 Bacteria 4158
188 Ga0495651_0281639 3300046462 Bacteria 1123
189 Ga0495650_0045045 3300046471 Bacteria 1860
190 Ga0495605_0001581 3300046474 Bacteria 14752
191 Ga0495605_0015928 3300046474 Bacteria 4079
192 Ga0495664_0218446 3300046477 Bacteria 1154
193 Ga0495585_0015731 3300046492 Bacteria 4393
194 Ga0495585_0137905 3300046492 Bacteria 1279
195 Ga0495607_0021784 3300046501 Bacteria 4030
196 Ga0495607_0024359 3300046501 Bacteria 3774
197 Ga0495607_0242805 3300046501 Bacteria 870
198 Ga0495583_0004102 3300046506 Bacteria 10683
199 Ga0495583_0046252 3300046506 Bacteria 2008
200 Ga0495583_0077553 3300046506 Bacteria 1449
201 Ga0495606_0020019 3300046507 Bacteria 4951
202 Ga0495606_0078858 3300046507 Bacteria 2053
203 Ga0495610_0004323 3300046512 Bacteria 10546
204 Ga0495610_0058561 3300046512 Bacteria 1842
205 Ga0495610_0130056 3300046512 Bacteria 1094
206 Ga0495616_0034897 3300046513 Bacteria 2607
207 Ga0495616_0107212 3300046513 Bacteria 1302
208 Ga0495618_0047231 3300046514 Bacteria 2718
209 Ga0495620_0020442 3300046515 Bacteria 3233
210 Ga0495620_0028388 3300046515 Bacteria 2602
211 Ga0495620_0030713 3300046515 Bacteria 2470
212 Ga0495631_0005801 3300046518 Bacteria 6439
213 Ga0495631_0083975 3300046518 Bacteria 1372
214 Ga0495632_0006694 3300046519 Bacteria 7369
215 Ga0495632_0009273 3300046519 Bacteria 5943
216 Ga0495632_0010663 3300046519 Bacteria 5422
217 Ga0495632_0041251 3300046519 Bacteria 2320
218 Ga0495643_0024954 3300046522 Bacteria 3387
219 Ga0495643_0025371 3300046522 Bacteria 3354
220 Ga0495643_0052037 3300046522 Bacteria 2200
221 Ga0495643_0067686 3300046522 Bacteria 1880
222 Ga0495648_0045422 3300046524 Bacteria 2732
223 Ga0495648_0091538 3300046524 Bacteria 1701
224 Ga0495663_0074003 3300046525 Bacteria 1089
225 Ga0495654_0000408 3300046530 Bacteria 36662
226 Ga0495654_0124005 3300046530 Bacteria 1166
227 Ga0495587_0143795 3300046536 Bacteria 1360
228 Ga0495609_0021789 3300046538 Bacteria 2956
229 Ga0495597_0018144 3300046542 Bacteria 3304
230 Ga0495633_0007601 3300046558 Bacteria 6211
231 Ga0495633_0038569 3300046558 Bacteria 2281
232 Ga0495633_0050071 3300046558 Bacteria 1970
233 Ga0495633_0057257 3300046558 Bacteria 1831
234 Ga0495633_0078683 3300046558 Bacteria 1535
235 Ga0495668_0005353 3300046616 Bacteria 8751
236 Ga0495634_0258148 3300046642 Bacteria 1064
237 Ga0495625_0003067 3300046660 Bacteria 17106
238 Ga0495625_0025045 3300046660 Bacteria 4531
239 Ga0495625_0036744 3300046660 Bacteria 3598
240 Ga0495635_0208520 3300046663 Bacteria 1324
241 Ga0495588_0022538 3300046674 Bacteria 3113
242 Ga0495588_0052821 3300046674 Bacteria 2095
243 Ga0495588_0138507 3300046674 Bacteria 1285
244 Ga0495658_0108399 3300046683 Bacteria 1667
245 Ga0495613_0318582 3300046689 Bacteria 1074
246 Ga0495624_0046648 3300046690 Bacteria 2755
247 Ga0495670_0006590 3300046691 Bacteria 5708
248 Ga0495671_0017731 3300046692 Bacteria 3787
249 Ga0495649_0038046 3300046694 Bacteria 2641
250 Ga0495649_0129950 3300046694 Bacteria 1329
251 Ga0495660_0048323 3300046810 Bacteria 2327
252 Ga0495660_0181854 3300046810 Bacteria 1016
253 Ga0495604_0017151 3300047317 Bacteria 5792
254 Ga0495672_0016425 3300047320 Bacteria 4988
255 Ga0495687_018606 3300047443 Bacteria 3431
256 Ga0495681_0006830 3300047470 Bacteria 7417
257 Ga0495681_0101250 3300047470 Bacteria 1259
258 Ga0495686_0054771 3300047472 Bacteria 2496
259 Ga0495602_0215024 3300048088 Bacteria 1456
260 Ga0495615_0009826 3300048090 Bacteria 1894
261 Ga0495615_0022902 3300048090 Bacteria 1426
262 Ga0495626_0068646 3300048091 Bacteria 1598
263 Ga0496100_0007627 3300048903 Bacteria 5985
264 Ga0496102_0012555 3300048905 Bacteria 7336
265 Ga0496103_0016980 3300048906 Bacteria 4349
266 Ga0496106_0003583 3300048909 Bacteria 11571
267 Ga0496106_0156112 3300048909 Bacteria 1802
268 Ga0496107_0070478 3300048910 Bacteria 2538
269 Ga0496113_0024768 3300048916 Bacteria 4271
270 Ga0496116_0010063 3300048919 Bacteria 7977
271 Ga0496116_0016495 3300048919 Bacteria 5775
272 Ga0496116_0184986 3300048919 Bacteria 1110
273 Ga0496117_0000030 3300048920 Bacteria 389141
274 Ga0496117_0006839 3300048920 Bacteria 11346
275 Ga0496117_0135370 3300048920 Bacteria 1485
276 Ga0496118_0007677 3300048921 Bacteria 11346
277 Ga0496118_0014905 3300048921 Bacteria 7240
278 Ga0496118_0034452 3300048921 Bacteria 4130
279 Ga0496118_0037803 3300048921 Bacteria 3879
280 Ga0496118_0047915 3300048921 Bacteria 3307
281 Ga0496119_0029300 3300048922 Bacteria 3737
282 Ga0496120_0000148 3300048923 Bacteria 116605
283 Ga0496120_0021592 3300048923 Bacteria 4067
284 Ga0496121_0000180 3300048924 Bacteria 141128
285 Ga0496121_0008349 3300048924 Bacteria 12224
286 Ga0496121_0010414 3300048924 Bacteria 10492
287 Ga0496121_0011115 3300048924 Bacteria 10045
288 Ga0496121_0017230 3300048924 Bacteria 7397
289 Ga0496121_0110756 3300048924 Bacteria 2094
290 Ga0496121_0426630 3300048924 Bacteria 861
291 Ga0496122_0000050 3300048925 Bacteria 267874
292 Ga0496122_0000107 3300048925 Bacteria 193163
293 Ga0496122_0011226 3300048925 Bacteria 9107
294 Ga0496122_0012504 3300048925 Bacteria 8439
295 Ga0496123_0000023 3300048926 Bacteria 346894
296 Ga0496123_0000063 3300048926 Bacteria 216072
297 Ga0496123_0008789 3300048926 Bacteria 9209
298 Ga0496123_0011979 3300048926 Bacteria 7440
299 Ga0496123_0049612 3300048926 Bacteria 2812
300 Ga0496124_0000239 3300048927 Bacteria 106633
301 Ga0496124_0014927 3300048927 Bacteria 7479
302 Ga0496124_0015123 3300048927 Bacteria 7417
303 Ga0496124_0039121 3300048927 Bacteria 4113
304 Ga0496124_0048499 3300048927 Bacteria 3628
305 Ga0496124_0064978 3300048927 Bacteria 3044
306 Ga0496124_0096370 3300048927 Bacteria 2403
307 Ga0496124_0108345 3300048927 Bacteria 2240
308 Ga0496124_0165566 3300048927 Bacteria 1718
309 Ga0496124_0287709 3300048927 Bacteria 1194
310 Ga0496125_0007031 3300048928 Bacteria 12034
311 Ga0496125_0023453 3300048928 Bacteria 5695
312 Ga0496125_0035442 3300048928 Bacteria 4376
313 Ga0496126_0038574 3300048929 Bacteria 4443
314 Ga0496126_0189724 3300048929 Bacteria 1741
315 Ga0495678_005327 3300049459 Bacteria 7132
316 Ga0495678_014668 3300049459 Bacteria 3636
317 Ga0495678_108921 3300049459 Bacteria 948
318 Ga0495682_0102137 3300049460 Bacteria 1028
319 Ga0501032_0228711 3300049569 Bacteria 1209
320 Ga0501033_0000396 3300049570 Bacteria 41913
321 Ga0501033_0109279 3300049570 Bacteria 2014
322 Ga0501034_0107266 3300049571 Bacteria 2785
323 Ga0501036_0139702 3300049572 Bacteria 2045
324 Ga0501036_0445591 3300049572 Bacteria 1079
325 Ga0501037_0303348 3300049573 Bacteria 1108
326 Ga0501038_0282515 3300049574 Bacteria 1306
327 Ga0501047_0059391 3300049581 Bacteria 3692
328 Ga0501068_0050894 3300049584 Bacteria 2505
329 Ga0501073_0054307 3300049589 Bacteria 2805
330 Ga0501080_0059988 3300049742 Bacteria 3540
331 Ga0501083_0043269 3300049744 Bacteria 3051
332 Ga0501083_0058872 3300049744 Bacteria 2570
333 Ga0501280_001541 3300049776 Bacteria 4181
334 Ga0501035_0000647 3300049822 Bacteria 38388
335 Ga0501044_0196867 3300049823 Bacteria 1974
336 nmdc:mga03n38_58670_c1 3300050490 Bacteria 1745
337 nmdc:mga00v17_78_c1 3300050491 Bacteria 40508
338 nmdc:mga00v17_873_c1 3300050491 Bacteria 16289
339 nmdc:mga0yw44_1126_c1 3300050492 Bacteria 10326
340 nmdc:mga0yw44_849_c2 3300050492 Bacteria 8506
341 nmdc:mga0k408_12534_c1 3300050493 Bacteria 4637
342 nmdc:mga07m45_229797_c1 3300050496 Bacteria 1079
343 nmdc:mga0sz30_7278_c1 3300050516 Bacteria 4148
344 Ga0500610_0029659 3300053079 Bacteria 2766
345 Ga0495619_0317561 3300053085 Bacteria 1078
346 Ga0500651_0070257 3300053093 Bacteria 2180
347 Ga0500651_0194612 3300053093 Bacteria 1199
348 Ga0500556_0040022 3300053104 Bacteria 1646
349 Ga0500557_000419 3300053105 Bacteria 5531
350 Ga0500560_023540 3300053107 Bacteria 1787
351 Ga0500560_070726 3300053107 Bacteria 1149
352 Ga0500569_001099 3300053109 Bacteria 4945
353 Ga0500569_001580 3300053109 Bacteria 4327
354 Ga0500572_003518 3300053111 Bacteria 3571
355 Ga0500594_0001893 3300053118 Bacteria 4530
356 Ga0500607_097855 3300053121 Bacteria 1463
357 Ga0500618_016104 3300053125 Bacteria 1876
358 Ga0500658_0006087 3300053134 Bacteria 4486
359 Ga0500561_0000626 3300053137 Bacteria 5636
360 Ga0500568_0002693 3300053139 Bacteria 10297
361 Ga0500568_0012784 3300053139 Bacteria 3848
362 Ga0500588_0017592 3300053146 Bacteria 1869
363 Ga0500590_053858 3300053148 Bacteria 2038
364 Ga0500604_0027115 3300053151 Bacteria 1655
365 Ga0500616_0000402 3300053153 Bacteria 59210
366 Ga0500616_0000944 3300053153 Bacteria 31705
367 Ga0500622_0001576 3300053156 Bacteria 17943
368 Ga0500624_000722 3300053157 Bacteria 8197
369 Ga0500633_0000642 3300053160 Bacteria 5817
370 Ga0500634_0005454 3300053161 Bacteria 6042
371 Ga0500634_0006057 3300053161 Bacteria 5811
372 Ga0500636_0000005 3300053177 Bacteria 197561
373 Ga0500636_0002277 3300053177 Bacteria 10652
374 Ga0500645_011390 3300053730 Bacteria 2906
375 Ga0501082_0033964 3300060353 Bacteria 4400
376 Ga0466962_0109891 3300061719 Bacteria 1327
377 2854897367 2854896431 Bacteria 5869725
378 2509379590 2509276019 Bacteria 6802256
379 2509447992 2509276033 Bacteria 7180565
380 2510134930 2510065019 Bacteria 6903379
381 2510843047 2510461069 Bacteria 5505000
382 2510896351 2510461076 Bacteria 8618824
383 2511135959 2510917022 Bacteria 6504556
384 2511169829 2510917026 Bacteria 7046020
385 2511183859 2510917028 Bacteria 6185411
386 2511197347 2510917030 Bacteria 7460662
387 2511498805 2511231052 Bacteria 6974333
388 2512534947 2512047086 Bacteria 6850303
389 2512973233 2512875026 Bacteria 6861065
390 2513580066 2513237085 Bacteria 7695351
391 2513587275 2513237086 Bacteria 7265287
392 2513599818 2513237088 Bacteria 6927906
393 2513603589 2513237089 Bacteria 6553624
394 2513619020 2513237091 Bacteria 6900273
395 2513631224 2513237093 Bacteria 7545552
396 2513710881 2513237103 Bacteria 7647401
397 2513867057 2513237138 Bacteria 7368160
398 2513880567 2513237140 Bacteria 7076289
399 2513904293 2513237143 Bacteria 6664116
400 2513908096 2513237144 Bacteria 7530820
401 2513983294 2513237156 Bacteria 6402557
402 2514001569 2513237159 Bacteria 6810126
403 2514005829 2513237160 Bacteria 6650282
404 2514023240 2513237162 Bacteria 7468464
405 2515114016 2515075009 Bacteria 7288508
406 2515637148 2515154113 Bacteria 7807172
407 2515642928 2515154114 Bacteria 7848616
408 2515656676 2515154116 Bacteria 7552979
409 2515743620 2515154134 Bacteria 7220242
410 2516895083 2516653046 Bacteria 6989037
411 2517037653 2516653077 Bacteria 7555578
412 2517077941 2516653085 Bacteria 7346596
413 2517096735 2517093000 Bacteria 7412387
414 2517410448 2517287029 Bacteria 6905599
415 2517571766 2517487022 Bacteria 7227575
416 2524452505 2524023207 Bacteria 6813453
417 2524459977 2524023209 Bacteria 6679728
418 2530647049 2529292951 Bacteria 6916614
419 2535483954 2534681786 Bacteria 3308809
420 2535519318 2534681796 Bacteria 7146037
421 2551678063 2551306084 Bacteria 8942552
422 2551685788 2551306085 Bacteria 7347181
423 2551695554 2551306086 Bacteria 6843938
424 2551700270 2551306087 Bacteria 7351905
425 2551710198 2551306089 Bacteria 7162724
426 2551721184 2551306090 Bacteria 7953713
427 2551725021 2551306091 Bacteria 7086830
428 2551738855 2551306092 Bacteria 6992595
429 2551740662 2551306093 Bacteria 7064773
430 2558862892 2558860100 Bacteria 8458965
431 2559297598 2558860242 Bacteria 5568029
432 2585224683 2582581298 Bacteria 7315509
433 2585255491 2582581304 Bacteria 5831370
434 2585264463 2582581306 Bacteria 6450535
435 2585274382 2582581307 Bacteria 6597605
436 2585282947 2582581308 Bacteria 7413247
437 2585322487 2582581315 Bacteria 7318924
438 2585335101 2582581316 Bacteria 7774528
439 2585389827 2582581865 Bacteria 6644329
440 2585396488 2582581866 Bacteria 6859583
441 2585402335 2582581867 Bacteria 7184437
442 2585528981 2585427526 Bacteria 7258840
443 2585532440 2585427527 Bacteria 7273426
444 2585540926 2585427528 Bacteria 6842387
445 2585547239 2585427529 Bacteria 7395659
446 2585554543 2585427530 Bacteria 7383882
447 2585560831 2585427531 Bacteria 6992870
448 2585822365 2585427590 Bacteria 6824633
449 2585839688 2585427593 Bacteria 7141551
450 2585899030 2585427608 Bacteria 6544331
451 2585903373 2585427609 Bacteria 6667127
452 2585997245 2585427633 Bacteria 6413184
453 2586001852 2585427634 Bacteria 6455027
454 2587981508 2585428125 Bacteria 6662905
455 2599332382 2599185156 Bacteria 5403036
456 2599606182 2599185210 Bacteria 5624189
457 2599720016 2599185236 Bacteria 6875203
458 2600195218 2599185352 Bacteria 7228948
459 2616295648 2615840624 Bacteria 6557588
460 2616307490 2615840626 Bacteria 7921970
461 2616555036 2615840698 Bacteria 7319877
462 2643805725 2643221557 Bacteria 7184309
463 2643813318 2643221558 Bacteria 5460675
464 2643917564 2643221582 Bacteria 5804683
465 2644006556 2643221599 Bacteria 6292121
466 2644051840 2643221607 Bacteria 6314006
467 2644065900 2643221610 Bacteria 7480339
468 2644196001 2643221634 Bacteria 6705461
469 2644201647 2643221636 Bacteria 6583769
470 2644299337 2643221653 Bacteria 4569637
471 2644380205 2643221668 Bacteria 7306521
472 2644417231 2643221675 Bacteria 7473456
473 2644450627 2643221680 Bacteria 7473610
474 2644480708 2643221686 Bacteria 6310811
475 2644495763 2643221688 Bacteria 5260751
476 2644498581 2643221689 Bacteria 6042950
477 2644522747 2643221693 Bacteria 5513853
478 2644657565 2643221719 Bacteria 4568197
479 2644671414 2643221723 Bacteria 7095460
480 2644692948 2643221726 Bacteria 7455827
481 2657682721 2657244999 Bacteria 5946535
482 2671112269 2667528174 Bacteria 6435400
483 2692319616 2690316117 Bacteria 6800650
484 2719182684 2718217882 Bacteria 6556348
485 2719387353 2718217927 Bacteria 6972593
486 2719666998 2718217997 Bacteria 6740740
487 2719733402 2718218009 Bacteria 6478651
488 2720493418 2718218199 Bacteria 6740745
489 2720614889 2718218232 Bacteria 6720332
490 2720621660 2718218233 Bacteria 6662049
491 2720632988 2718218235 Bacteria 6630699
492 2720776712 2718218269 Bacteria 6906114
493 2721148797 2718218363 Bacteria 6524337
494 2721160181 2718218365 Bacteria 6274507
495 2721165610 2718218366 Bacteria 6425255
496 2721400988 2718218423 Bacteria 6438183
497 2722841780 2721755514 Bacteria 6424414
498 2723028302 2721755556 Bacteria 6745503
499 2723561930 2721755684 Bacteria 6859907
500 2723568560 2721755685 Bacteria 6704835
501 2724039801 2721755809 Bacteria 6438790
502 2724046158 2721755810 Bacteria 6479005
503 2724091319 2721755819 Bacteria 6906405
504 2724105825 2721755822 Bacteria 6726041
505 2724111653 2721755823 Bacteria 6752556
506 2725950821 2724679232 Bacteria 7646494
507 2730109238 2728369352 Bacteria 6745171
508 2730165919 2728369365 Bacteria 6555560
509 2730299813 2728369397 Bacteria 6274511
510 2739035482 2738541333 Bacteria 7106503
511 2766065227 2765235942 Bacteria 7445910
512 2770196557 2767802442 Bacteria 5747986
513 2776269340 2775506902 Bacteria 6208009
514 2776283521 2775506904 Bacteria 5954060
515 2778176100 2775507266 Bacteria 7392367
516 2792620931 2791355091 Bacteria 6135441
517 2792625147 2791355092 Bacteria 6248105
518 2792637561 2791355094 Bacteria 7011481
519 2793293537 2791355256 Bacteria 6798008
520 2793312990 2791355259 Bacteria 7254731
521 2793319637 2791355260 Bacteria 6598818
522 2793333479 2791355262 Bacteria 6774204
523 2793347458 2791355264 Bacteria 6429314
524 2793353788 2791355265 Bacteria 6539969
525 2793359607 2791355266 Bacteria 7116587
526 2802720872 2802428858 Bacteria 6636079
527 2802724476 2802428859 Bacteria 6667919
528 2802729858 2802428860 Bacteria 6525526
529 2802737203 2802428861 Bacteria 6534206
530 2802746331 2802428862 Bacteria 6633353
531 2802751820 2802428863 Bacteria 6410669
532 2804753943 2802429268 Bacteria 6094027
533 2805929492 2802429605 Bacteria 6875453
534 2805935327 2802429606 Bacteria 6346811
535 2806044469 2802429633 Bacteria 7341974
536 2806052670 2802429634 Bacteria 7083200
537 2806058970 2802429635 Bacteria 7650140
538 2806068367 2802429636 Bacteria 7597525
539 2806074487 2802429637 Bacteria 7067217
540 2808989107 2808606387 Bacteria 5697198
541 2819243905 2818991272 Bacteria 4622173
542 2819609512 2818991448 Bacteria 6772224
543 2819639610 2818991453 Bacteria 7181617
544 2819686532 2818991461 Bacteria 7026071
545 2821126262 2821123053 Bacteria 7836056
546 2838019195 2838016132 Bacteria 6577831
547 2838024215 2838022645 Bacteria 6494267
548 2838034712 2838029111 Bacteria 6603031
549 2838047454 2838042994 Bacteria 6046894
550 2838051087 2838048938 Bacteria 6044578
551 2838063935 2838061910 Bacteria 6794874
552 2838073418 2838068647 Bacteria 6208656
553 2838674636 2838668709 Bacteria 6671819
554 2838679974 2838675328 Bacteria 4909118
555 2838684868 2838680041 Bacteria 6545511
556 2838691223 2838686498 Bacteria 7807632
557 2838699295 2838694306 Bacteria 6853137
558 2838707006 2838701080 Bacteria 6669771
559 2838712776 2838707686 Bacteria 6619912
560 2838717771 2838714209 Bacteria 5525906
561 2838724545 2838719591 Bacteria 5523910
562 2838729513 2838724970 Bacteria 4908691
563 2838735706 2838729681 Bacteria 7400765
564 2838737262 2838736955 Bacteria 5760694
565 2838748608 2838742623 Bacteria 7396178
566 2840766557 2840764183 Bacteria 6358399
567 2841842369 2841840854 Bacteria 5761912
568 2841849949 2841846520 Bacteria 5345850
569 2841853957 2841851746 Bacteria 7532261
570 2841864284 2841859092 Bacteria 5436171
571 2842082253 2842077413 Bacteria 6508645
572 2842113338 2842110456 Bacteria 7656360
573 2842123178 2842118031 Bacteria 7033875
574 2842128421 2842124991 Bacteria 5346824
575 2842134656 2842130223 Bacteria 4909145
576 2842142149 2842140634 Bacteria 5759631
577 2842151696 2842146304 Bacteria 5957337
578 2842156512 2842152218 Bacteria 4908957
579 2842162525 2842156927 Bacteria 6894975
580 2842170047 2842163707 Bacteria 6916235
581 2842174016 2842170452 Bacteria 5525737
582 2842180133 2842175837 Bacteria 4908771
583 2842184962 2842180545 Bacteria 6888678
584 2842192132 2842187318 Bacteria 5524014
585 2842198629 2842192696 Bacteria 6147454
586 2842199757 2842198810 Bacteria 6608673
587 2842208404 2842205361 Bacteria 6340321
588 2842216588 2842211629 Bacteria 5523832
589 2842219982 2842217011 Bacteria 7497767
590 2842229168 2842224351 Bacteria 5524473
591 2842235665 2842229732 Bacteria 7475766
592 2842241922 2842237096 Bacteria 6620661
593 2842249301 2842243621 Bacteria 7421798
594 2842256785 2842250916 Bacteria 6579627
595 2842263562 2842257432 Bacteria 7401195
596 2842269914 2842264693 Bacteria 6472963
597 2842275698 2842271015 Bacteria 7807131
598 2842281587 2842278818 Bacteria 6340002
599 2842296254 2842291075 Bacteria 7076806
600 2842298798 2842298080 Bacteria 6123127
601 2842308318 2842304105 Bacteria 7023636
602 2842316409 2842311132 Bacteria 6616990
603 2842321297 2842317721 Bacteria 6793725
604 2842359333 2842357229 Bacteria 6485165
605 2842375544 2842370503 Bacteria 7038661
606 2842382654 2842377471 Bacteria 7140707
607 2842390055 2842384541 Bacteria 7057858
608 2842398422 2842395702 Bacteria 6780583
609 2842406622 2842402390 Bacteria 6681310
610 2842412951 2842409023 Bacteria 6687331
611 2842419594 2842415677 Bacteria 6596907
612 2842427053 2842422224 Bacteria 6239196
613 2842433841 2842428310 Bacteria 6767288
614 2842440127 2842434925 Bacteria 6502746
615 2842446862 2842441272 Bacteria 6769273
616 2842453636 2842447887 Bacteria 6754142
617 2842468210 2842462802 Bacteria 6588055
618 2842474736 2842469257 Bacteria 6752936
619 2842481395 2842475841 Bacteria 6603183
620 2842495546 2842489311 Bacteria 6620893
621 2842499063 2842495871 Bacteria 6820686
622 2842508359 2842502639 Bacteria 6604161
623 2842520969 2842515876 Bacteria 5436280
624 2842527168 2842521101 Bacteria 6569494
625 2842922650 2842922631 Bacteria 5824079
626 2844457397 2844454524 Bacteria 7952546
627 2847421161 2847417321 Bacteria 6913799
628 2848995999 2848992105 Bacteria 6810864
629 2850079374 2850079185 Bacteria 6848280
630 2854921499 2854916844 Bacteria 5725939
631 2855843093 2855839649 Bacteria 7135830
632 2855877714 2855872281 Bacteria 6964271
633 2857518808 2857516855 Bacteria 7787325
634 2857532823 2857531043 Bacteria 6754041
635 2858802049 2858800743 Bacteria 6603254
636 2891375245 2891373044 Bacteria 5202277
637 2894653489 2894652903 Bacteria 4587256
638 2899793167 2899792073 Bacteria 4926588
639 2899805232 2899803654 Bacteria 5577784
640 2899849633 2899845264 Bacteria 5672268
641 2913298433 2913295892 Bacteria 6333755
642 2915982726 2915980308 Bacteria 6624279
643 2915993087 2915986958 Bacteria 6739310
644 2915996805 2915993759 Bacteria 7016183
645 2916002295 2916000859 Bacteria 6865702
646 2916009329 2916007675 Bacteria 6898660
647 2916019641 2916014648 Bacteria 6946486
648 2916027306 2916021584 Bacteria 6854472
649 2916028899 2916028427 Bacteria 6748433
650 2916037049 2916035215 Bacteria 6755766
651 2916056696 2916055098 Bacteria 6758838
652 2916063888 2916061851 Bacteria 6737736
653 2916072144 2916068649 Bacteria 6943657
654 2919104665 2919100787 Bacteria 7710546
655 2919118051 2919114240 Bacteria 5700270
656 2919173541 2919171160 Bacteria 6499771
657 2919410756 2919408235 Bacteria 6149349
658 2920822777 2920822456 Bacteria 6897201
659 2921202061 2921201388 Bacteria 6926299
660 2921209896 2921208531 Bacteria 6745326
661 2921243062 2921237296 Bacteria 6876710
662 2921244407 2921244191 Bacteria 6568419
663 2921256299 2921250672 Bacteria 6677771
664 2921260038 2921257292 Bacteria 6808382
665 2921265864 2921263974 Bacteria 6864552
666 2921286401 2921282425 Bacteria 6826397
667 2921294767 2921289301 Bacteria 7316391
668 2921299181 2921296804 Bacteria 7176999
669 2923558673 2923556063 Bacteria 6793593
670 2924145353 2924144063 Bacteria 6883928
671 2924152344 2924150972 Bacteria 7169444
672 2924162481 2924158325 Bacteria 7188855
673 2924172149 2924165586 Bacteria 7260590
674 2924177634 2924172951 Bacteria 6749356
675 2924182746 2924179722 Bacteria 6843264
676 2924190356 2924186466 Bacteria 6876637
677 2924197329 2924193448 Bacteria 6955718
678 2924202108 2924200457 Bacteria 6757188
679 2924211029 2924207177 Bacteria 6917007
680 2924216635 2924214083 Bacteria 7080103
681 2924225162 2924221636 Bacteria 7113495
682 2924230432 2924228884 Bacteria 6633132
683 2926757816 2926754445 Bacteria 5964435
684 2926764559 2926760298 Bacteria 5505990
685 2933010434 2933006813 Bacteria 4912075
686 2933011619 2933011516 Bacteria 5439334
687 2933019889 2933016740 Bacteria 6355406
688 2933574767 2933570622 Bacteria 7023390
689 2933589371 2933586486 Bacteria 7667493
690 2933603452 2933599457 Bacteria 5858799
691 2935901193 2935894831 Bacteria 6620579
692 2935903375 2935901341 Bacteria 7341747
693 2936374781 2936367885 Bacteria 7324495
694 2936380473 2936375103 Bacteria 6652732
695 2936382364 2936381700 Bacteria 7006523
696 2937005771 2937002841 Bacteria 6934057
697 2937010476 2937009748 Bacteria 6746052
698 2937017346 2937016420 Bacteria 6782579
699 2937028289 2937023124 Bacteria 6815156
700 2937030612 2937029754 Bacteria 6424026
701 2937039082 2937036028 Bacteria 6846469
702 2937045652 2937042894 Bacteria 6741576
703 2937050849 2937049772 Bacteria 6757901
704 2937062514 2937056579 Bacteria 7107896
705 2937065750 2937063883 Bacteria 7199456
706 2937076195 2937071275 Bacteria 6984483
707 2937083953 2937078374 Bacteria 6610289
708 2937090786 2937084907 Bacteria 6618516
709 2937096066 2937091812 Bacteria 6979387
710 2937104490 2937098957 Bacteria 7249374
711 2937108202 2937106411 Bacteria 6947143
712 2937115848 2937113482 Bacteria 6505872
713 2937122090 2937119839 Bacteria 6597547
714 2957378047 2957375807 Bacteria 6425588
715 2957383337 2957382221 Bacteria 6737050
716 2957390633 2957388812 Bacteria 6778072
717 2957401540 2957395598 Bacteria 6822399
718 2957405088 2957402308 Bacteria 6741770
719 2957409996 2957408893 Bacteria 6558585
720 2957421309 2957415311 Bacteria 6991633
721 2957426755 2957422303 Bacteria 7172205
722 2957430176 2957430029 Bacteria 7022557
723 2957442444 2957437181 Bacteria 6568994
724 2957450828 2957443900 Bacteria 6869977
725 2957451790 2957450854 Bacteria 6765715
726 2957460759 2957457609 Bacteria 6967680
727 2957468089 2957464669 Bacteria 6568877
728 2957475880 2957471148 Bacteria 6797643
729 2957481855 2957478035 Bacteria 6756658
730 2957490859 2957484790 Bacteria 6703082
731 2957492783 2957491536 Bacteria 6695180
732 2957499525 2957498199 Bacteria 7126688
733 2957510787 2957505466 Bacteria 7253085
734 2960585906 2960584000 Bacteria 6864594
735 2960593138 2960591022 Bacteria 6622873
736 2960600883 2960597568 Bacteria 6550735
737 2960607705 2960603979 Bacteria 6898737
738 2960620161 2960617483 Bacteria 6727748
739 2960635402 2960631154 Bacteria 6732508
740 2960640367 2960637947 Bacteria 7296468
741 2960650859 2960645483 Bacteria 7211087
742 2960655130 2960652885 Bacteria 7083688
743 2960660967 2960660292 Bacteria 7041660
744 2960670961 2960667422 Bacteria 6763020
745 2960677482 2960674078 Bacteria 6609048
746 2960682686 2960680706 Bacteria 6624464
747 2964610393 2964607997 Bacteria 7101408
748 2964621174 2964615318 Bacteria 6809089
749 2964628775 2964621998 Bacteria 6834995
750 2964631474 2964628898 Bacteria 7083044
751 2964642609 2964636051 Bacteria 7091832
752 2964645493 2964643177 Bacteria 6820887
753 2964651347 2964649959 Bacteria 6675118
754 2964660195 2964656573 Bacteria 7100150
755 2964667478 2964663802 Bacteria 7019362
756 2964672941 2964670856 Bacteria 6851364
757 2964684779 2964678106 Bacteria 6792020
758 2964686388 2964685014 Bacteria 6839111
759 2964695238 2964691889 Bacteria 6802758
760 2964699951 2964698721 Bacteria 6765331
761 2964706371 2964705432 Bacteria 7114648
762 2964714194 2964712639 Bacteria 6695970
763 2964726047 2964719344 Bacteria 7286602
764 2967666652 2967664464 Bacteria 6948836
765 2967676724 2967671571 Bacteria 7021409
766 2967683455 2967678726 Bacteria 7264382
767 2967688423 2967686174 Bacteria 6678622
768 2967694545 2967693043 Bacteria 6804451
769 2967701040 2967699805 Bacteria 6854538
770 2967714276 2967706974 Bacteria 7186053
771 2967716303 2967714385 Bacteria 7000047
772 2967725849 2967721400 Bacteria 7073753
773 2967733843 2967728569 Bacteria 6641507
774 2967740858 2967735183 Bacteria 6827012
775 2967744758 2967742019 Bacteria 6794534
776 2967751494 2967748971 Bacteria 6733771
777 2967756346 2967755722 Bacteria 6814706
778 2967766345 2967762386 Bacteria 6923502
779 2967771934 2967769361 Bacteria 6587838
780 2967776920 2967775926 Bacteria 6738189
781 2970020849 2970019648 Bacteria 7072033
782 2970032004 2970026789 Bacteria 6785236
783 2970034778 2970033650 Bacteria 7118744
784 2970046457 2970040964 Bacteria 6731123
785 2970052189 2970047711 Bacteria 7088379
786 2970055974 2970054988 Bacteria 6611507
787 2970064634 2970061556 Bacteria 7099761
788 2970074417 2970068827 Bacteria 7123112
789 2970077126 2970076120 Bacteria 6697332
790 2970087551 2970082768 Bacteria 6183754
791 2970091788 2970088815 Bacteria 6933825
792 2970099268 2970095765 Bacteria 6936963
793 2970104287 2970102677 Bacteria 6812532
794 2970112574 2970109326 Bacteria 6863976
795 2970118916 2970116247 Bacteria 6501857
796 2970122807 2970122695 Bacteria 6625855
797 2970130946 2970129317 Bacteria 6806560
798 2970139388 2970136068 Bacteria 7207982
799 2970145332 2970143518 Bacteria 6446480
800 2970153283 2970149975 Bacteria 6779706
801 2970160434 2970156795 Bacteria 7168044
802 2970165664 2970164137 Bacteria 6861252
803 2970177349 2970170962 Bacteria 6876229
804 2970186180 2970184632 Bacteria 7054431
805 2970194358 2970191845 Bacteria 7032787
806 2977525593 2977523885 Bacteria 6960446
807 2977530871 2977530762 Bacteria 6951399
808 2977538729 2977537788 Bacteria 6929320
809 2977546899 2977544691 Bacteria 6875412
810 2977556359 2977551784 Bacteria 7125765
811 2977561895 2977558990 Bacteria 6863948
812 2977570569 2977565890 Bacteria 6901543
813 2977576316 2977572785 Bacteria 6763888
814 2977581022 2977579622 Bacteria 6772100
815 2979090333 2979089926 Bacteria 5670289
816 2979095861 2979095461 Bacteria 5669583
817 2984604504 2984601300 Bacteria 5455244
818 2989352013 2989349275 Bacteria 6349068
819 2989774583 2989771324 Bacteria 5605128
820 2989780442 2989776772 Bacteria 4843317
821 3003931303 3003930520 Bacteria 5667563
822 3005415397 3005409236 Bacteria 7188837
823 3005418394 3005416602 Bacteria 7064308
824 3005455675 3005452660 Bacteria 5889319
825 639650089 639633055 Bacteria 7751309
826 643827722 643692032 Bacteria 6891900
827 648738240 648276728 Bacteria 6968865
828 650844040 650716007 Bacteria 5573770
829 8003573242 8003570095 Bacteria 5747666
830 8003995678 8003992118 Bacteria 7266902
831 8004003437 8003999396 Bacteria 7063185
832 8005248246 8005246636 Bacteria 4933972
833 8005282100 8005275841 Bacteria 6929066
834 8005285085 8005282627 Bacteria 6675747
835 8005294178 8005289223 Bacteria 6634003
836 8005306592 8005301065 Bacteria 6614431
837 8005309483 8005307578 Bacteria 7395396
838 8005318714 8005314921 Bacteria 7072929
839 8005378464 8005376324 Bacteria 6590079
840 8005434036 8005430974 Bacteria 6689030
841 8005464704 8005460587 Bacteria 7157962
842 8005488404 8005484373 Bacteria 6297373
843 8005501751 8005497431 Bacteria 6477605
844 8005546995 8005542996 Bacteria 7077758
845 8005559072 8005556819 Bacteria 6908598
846 8005566870 8005563573 Bacteria 7153261
847 8005574855 8005570704 Bacteria 6957481
848 8005623105 8005619151 Bacteria 7030230
849 8005631587 8005626139 Bacteria 6534237
850 8005648873 8005645114 Bacteria 6950293
851 8005661694 8005658619 Bacteria 4500593
852 8005673173 8005668836 Bacteria 6953162
853 8005682110 8005682033 Bacteria 6726518
854 8005693712 8005688590 Bacteria 6610080
855 8005700954 8005695170 Bacteria 6912330
856 8018133531 8018127388 Bacteria 7351159
857 8018154686 8018150411 Bacteria 5549903
858 8018170312 8018163183 Bacteria 7277977
859 8023687451 8023680758 Bacteria 7729763
860 8024482037 8024479707 Bacteria 6954785
861 8024505851 8024501048 Bacteria 6427847
862 8049296536 8049293176 Bacteria 6128433
863 8054463533 8054460903 Bacteria 4872905
864 8056387110 8056382006 Bacteria 6408074
865 8056876248 8056875544 Bacteria 4355797
866 8057877086 8057874678 Bacteria 7494653
867 JGI24740J21852_10006141
868 JGI25158J39367_1000067
869 JGI25152J39213_1000617
870 JGI25152J39213_1001046
871 JGI25152J39213_1007830
872 JGI25159J45721_1000023
873 JGI25159J45721_1000690
874 JGI25151J46595_10003849
875 JGI25151J46595_10013034
876 JGI25151J46595_10019779
877 JGI25165J46597_1003966
878 JGI25153J46596_10000837
879 rootH1_10070514
880 rootH1_10070669
881 rootL2_10106171
882 rootL2_10173186
883 rootH1_10012212
884 rootH1_10188506
885 JGI25160J50197_1000061
886 JGI25160J50197_1003385
887 JGI25161J50226_1000103
888 JGI25161J50226_1004258
889 Ga0055526_1000562
890 Ga0055526_1001848
891 Ga0055526_1004244
892 Ga0055526_1015494
893 Ga0055526_1049235
894 Ga0055524_1006120
895 Ga0055524_1009115
896 Ga0055524_1042435
897 Ga0055524_1044318
898 Ga0055528_1000581
899 Ga0055528_1000777
900 Ga0055528_1000954
901 Ga0055528_1018148
902 Ga0055540_1014273
903 Ga0058692_1027301
904 Ga0055543_1000029
905 Ga0055543_1000247
906 Ga0065165_1000047
907 Ga0065165_1003871
908 Ga0065165_1005227
909 Ga0070669_100211128
910 Ga0070665_100031575
911 Ga0070665_100064304
912 Ga0070665_100072449
913 Ga0070665_100181096
914 Ga0068854_100131282
915 Ga0068856_100073835
916 Ga0068856_100337400
917 Ga0081455_10336886
918 Ga0075365_10003524
919 Ga0075365_10117922
920 Ga0075368_10095261
921 Ga0075363_100025707
922 Ga0075362_10004298
923 Ga0075367_10031713
924 Ga0075369_10034102
925 Ga0075366_10194290
926 Ga0075370_10281206
927 Ga0079104_1000063
928 Ga0079104_1003920
929 Ga0079104_1007819
930 Ga0099826_10031887
931 Ga0105240_10000019
932 Ga0105243_10009838
933 Ga0105248_10578310
934 Ga0105237_10002910
935 Ga0123341_1061718
936 Ga0123342_1017862
937 Ga0105033_101349
938 Ga0105239_10006284
939 Ga0105246_10241300
940 Ga0157373_10011904
941 Ga0157373_10167766
942 Ga0157371_10000005
943 Ga0157370_10000036
944 Ga0157370_10003629
945 Ga0157369_10423168
946 Ga0171463_1001
947 Ga0182007_10003737
948 Ga0182005_1005785
949 Ga0183363_1069
950 Ga0163161_10225970
951 Ga0214544_1000652
952 Ga0214542_1000146
953 Ga0214543_1000054
954 Ga0228711_1000006
955 Ga0228710_1000004
956 Ga0209436_100026
957 Ga0209436_101144
958 Ga0209437_104045
959 Ga0207425_1025107
960 Ga0209646_1004280
961 Ga0209677_100155
962 Ga0209129_1000203
963 Ga0209129_1002674
964 Ga0209233_1000459
965 Ga0209673_1000037
966 Ga0209673_1000320
967 Ga0209673_1003729
968 Ga0209673_1005902
969 Ga0209673_1026708
970 Ga0209673_1046747
971 Ga0209130_1000005
972 Ga0209130_1000030
973 Ga0209676_1001526
974 Ga0209025_1000037
975 Ga0209025_1000445
976 Ga0209025_1000566
977 Ga0209025_1000777
978 Ga0209025_1044100
979 Ga0209564_1000113
980 Ga0209564_1000207
981 Ga0209564_1000345
982 Ga0209564_1013159
983 Ga0209564_1046400
984 Ga0209758_1000561
985 Ga0209758_1001098
986 Ga0209758_1001230
987 Ga0209758_1004194
988 Ga0209050_1006048
989 Ga0209256_1000343
990 Ga0209256_1001345
991 Ga0209256_1001773
992 Ga0209256_1002948
993 Ga0209256_1006537
994 Ga0207426_1000015
995 Ga0207426_1000047
996 Ga0209051_1000900
997 Ga0209051_1012578
998 Ga0209051_1016583
999 Ga0209051_1040409
1000 Ga0209051_1048253
1001 Ga0207695_10000049
1002 Ga0207671_10000107
1003 Ga0207681_10226437
1004 Ga0207681_10233765
1005 Ga0207709_10009993
1006 Ga0207702_10079070
1007 Ga0207702_10789618
1008 Ga0209281_1000102
1009 Ga0209281_1000110
1010 Ga0209281_1002636
1011 Ga0209371_1001449
1012 Ga0209282_1000013
1013 Ga0209282_1058003
1014 Ga0268266_10021832
1015 Ga0268266_10185595
1016 Ga0268266_10240447
1017 Ga0268256_1007425
1018 Ga0268256_1007696
1019 Ga0316181_1082338
1020 Ga0307408_100344821
1021 Ga0307405_10265698
1022 Ga0307410_10116073
1023 Ga0307406_10027412
1024 Ga0307412_10136755
1025 Ga0315914_1000004
1026 Ga0307416_100670239
1027 Ga0307414_10297086
1028 Ga0315913_1000011
1029 Ga0315915_1000003
1030 Ga0439436_0029616
1031 Ga0439439_0044887
1032 Ga0439466_0051517
1033 Ga0439465_0004511
1034 Ga0451798_1165102
1035 Ga0451833_0841414
1036 Ga0451835_0025022
1037 Ga0451839_0537862
1038 Ga0451840_20407
1039 Ga0451841_0362176
1040 Ga0451845_0189690
1041 Ga0451846_59899
1042 Ga0451847_0407225
1043 Ga0451851_0589931
1044 Ga0451854_17764
1045 Ga0451855_1428311
1046 Ga0451853_2604503
1047 Ga0439432_012345
1048 Ga0439449_0007873
1049 Ga0466970_0008760
1050 Ga0466958_0084385
1051 Ga0466967_0248948
1052 Ga0495638_0001560
1053 Ga0495638_0022297
1054 Ga0495651_0281639
1055 Ga0495650_0045045
1056 Ga0495605_0001581
1057 Ga0495605_0015928
1058 Ga0495664_0218446
1059 Ga0495585_0015731
1060 Ga0495585_0137905
1061 Ga0495607_0021784
1062 Ga0495607_0024359
1063 Ga0495607_0242805
1064 Ga0495583_0004102
1065 Ga0495583_0046252
1066 Ga0495583_0077553
1067 Ga0495606_0020019
1068 Ga0495606_0078858
1069 Ga0495610_0004323
1070 Ga0495610_0058561
1071 Ga0495610_0130056
1072 Ga0495616_0034897
1073 Ga0495616_0107212
1074 Ga0495618_0047231
1075 Ga0495620_0020442
1076 Ga0495620_0028388
1077 Ga0495620_0030713
1078 Ga0495631_0005801
1079 Ga0495631_0083975
1080 Ga0495632_0006694
1081 Ga0495632_0009273
1082 Ga0495632_0010663
1083 Ga0495632_0041251
1084 Ga0495643_0024954
1085 Ga0495643_0025371
1086 Ga0495643_0052037
1087 Ga0495643_0067686
1088 Ga0495648_0045422
1089 Ga0495648_0091538
1090 Ga0495663_0074003
1091 Ga0495654_0000408
1092 Ga0495654_0124005
1093 Ga0495587_0143795
1094 Ga0495609_0021789
1095 Ga0495597_0018144
1096 Ga0495633_0007601
1097 Ga0495633_0038569
1098 Ga0495633_0050071
1099 Ga0495633_0057257
1100 Ga0495633_0078683
1101 Ga0495668_0005353
1102 Ga0495634_0258148
1103 Ga0495625_0003067
1104 Ga0495625_0025045
1105 Ga0495625_0036744
1106 Ga0495635_0208520
1107 Ga0495588_0022538
1108 Ga0495588_0052821
1109 Ga0495588_0138507
1110 Ga0495658_0108399
1111 Ga0495613_0318582
1112 Ga0495624_0046648
1113 Ga0495670_0006590
1114 Ga0495671_0017731
1115 Ga0495649_0038046
1116 Ga0495649_0129950
1117 Ga0495660_0048323
1118 Ga0495660_0181854
1119 Ga0495604_0017151
1120 Ga0495672_0016425
1121 Ga0495687_018606
1122 Ga0495681_0006830
1123 Ga0495681_0101250
1124 Ga0495686_0054771
1125 Ga0495602_0215024
1126 Ga0495615_0009826
1127 Ga0495615_0022902
1128 Ga0495626_0068646
1129 Ga0496100_0007627
1130 Ga0496102_0012555
1131 Ga0496103_0016980
1132 Ga0496106_0003583
1133 Ga0496106_0156112
1134 Ga0496107_0070478
1135 Ga0496113_0024768
1136 Ga0496116_0010063
1137 Ga0496116_0016495
1138 Ga0496116_0184986
1139 Ga0496117_0000030
1140 Ga0496117_0006839
1141 Ga0496117_0135370
1142 Ga0496118_0007677
1143 Ga0496118_0014905
1144 Ga0496118_0034452
1145 Ga0496118_0037803
1146 Ga0496118_0047915
1147 Ga0496119_0029300
1148 Ga0496120_0000148
1149 Ga0496120_0021592
1150 Ga0496121_0000180
1151 Ga0496121_0008349
1152 Ga0496121_0010414
1153 Ga0496121_0011115
1154 Ga0496121_0017230
1155 Ga0496121_0110756
1156 Ga0496121_0426630
1157 Ga0496122_0000050
1158 Ga0496122_0000107
1159 Ga0496122_0011226
1160 Ga0496122_0012504
1161 Ga0496123_0000023
1162 Ga0496123_0000063
1163 Ga0496123_0008789
1164 Ga0496123_0011979
1165 Ga0496123_0049612
1166 Ga0496124_0000239
1167 Ga0496124_0014927
1168 Ga0496124_0015123
1169 Ga0496124_0039121
1170 Ga0496124_0048499
1171 Ga0496124_0064978
1172 Ga0496124_0096370
1173 Ga0496124_0108345
1174 Ga0496124_0165566
1175 Ga0496124_0287709
1176 Ga0496125_0007031
1177 Ga0496125_0023453
1178 Ga0496125_0035442
1179 Ga0496126_0038574
1180 Ga0496126_0189724
1181 Ga0495678_005327
1182 Ga0495678_014668
1183 Ga0495678_108921
1184 Ga0495682_0102137
1185 Ga0501032_0228711
1186 Ga0501033_0000396
1187 Ga0501033_0109279
1188 Ga0501034_0107266
1189 Ga0501036_0139702
1190 Ga0501036_0445591
1191 Ga0501037_0303348
1192 Ga0501038_0282515
1193 Ga0501047_0059391
1194 Ga0501068_0050894
1195 Ga0501073_0054307
1196 Ga0501080_0059988
1197 Ga0501083_0043269
1198 Ga0501083_0058872
1199 Ga0501280_001541
1200 Ga0501035_0000647
1201 Ga0501044_0196867
1202 nmdc:mga03n38_58670_c1
1203 nmdc:mga00v17_78_c1
1204 nmdc:mga00v17_873_c1
1205 nmdc:mga0yw44_1126_c1
1206 nmdc:mga0yw44_849_c2
1207 nmdc:mga0k408_12534_c1
1208 nmdc:mga07m45_229797_c1
1209 nmdc:mga0sz30_7278_c1
1210 Ga0500610_0029659
1211 Ga0495619_0317561
1212 Ga0500651_0070257
1213 Ga0500651_0194612
1214 Ga0500556_0040022
1215 Ga0500557_000419
1216 Ga0500560_023540
1217 Ga0500560_070726
1218 Ga0500569_001099
1219 Ga0500569_001580
1220 Ga0500572_003518
1221 Ga0500594_0001893
1222 Ga0500607_097855
1223 Ga0500618_016104
1224 Ga0500658_0006087
1225 Ga0500561_0000626
1226 Ga0500568_0002693
1227 Ga0500568_0012784
1228 Ga0500588_0017592
1229 Ga0500590_053858
1230 Ga0500604_0027115
1231 Ga0500616_0000402
1232 Ga0500616_0000944
1233 Ga0500622_0001576
1234 Ga0500624_000722
1235 Ga0500633_0000642
1236 Ga0500634_0005454
1237 Ga0500634_0006057
1238 Ga0500636_0000005
1239 Ga0500636_0002277
1240 Ga0500645_011390
1241 Ga0501082_0033964
1242 Ga0466962_0109891
1243 2854897367
1244 2509379590
1245 2509447992
1246 2510134930
1247 2510843047
1248 2510896351
1249 2511135959
1250 2511169829
1251 2511183859
1252 2511197347
1253 2511498805
1254 2512534947
1255 2512973233
1256 2513580066
1257 2513587275
1258 2513599818
1259 2513603589
1260 2513619020
1261 2513631224
1262 2513710881
1263 2513867057
1264 2513880567
1265 2513904293
1266 2513908096
1267 2513983294
1268 2514001569
1269 2514005829
1270 2514023240
1271 2515114016
1272 2515637148
1273 2515642928
1274 2515656676
1275 2515743620
1276 2516895083
1277 2517037653
1278 2517077941
1279 2517096735
1280 2517410448
1281 2517571766
1282 2524452505
1283 2524459977
1284 2530647049
1285 2535483954
1286 2535519318
1287 2551678063
1288 2551685788
1289 2551695554
1290 2551700270
1291 2551710198
1292 2551721184
1293 2551725021
1294 2551738855
1295 2551740662
1296 2558862892
1297 2559297598
1298 2585224683
1299 2585255491
1300 2585264463
1301 2585274382
1302 2585282947
1303 2585322487
1304 2585335101
1305 2585389827
1306 2585396488
1307 2585402335
1308 2585528981
1309 2585532440
1310 2585540926
1311 2585547239
1312 2585554543
1313 2585560831
1314 2585822365
1315 2585839688
1316 2585899030
1317 2585903373
1318 2585997245
1319 2586001852
1320 2587981508
1321 2599332382
1322 2599606182
1323 2599720016
1324 2600195218
1325 2616295648
1326 2616307490
1327 2616555036
1328 2643805725
1329 2643813318
1330 2643917564
1331 2644006556
1332 2644051840
1333 2644065900
1334 2644196001
1335 2644201647
1336 2644299337
1337 2644380205
1338 2644417231
1339 2644450627
1340 2644480708
1341 2644495763
1342 2644498581
1343 2644522747
1344 2644657565
1345 2644671414
1346 2644692948
1347 2657682721
1348 2671112269
1349 2692319616
1350 2719182684
1351 2719387353
1352 2719666998
1353 2719733402
1354 2720493418
1355 2720614889
1356 2720621660
1357 2720632988
1358 2720776712
1359 2721148797
1360 2721160181
1361 2721165610
1362 2721400988
1363 2722841780
1364 2723028302
1365 2723561930
1366 2723568560
1367 2724039801
1368 2724046158
1369 2724091319
1370 2724105825
1371 2724111653
1372 2725950821
1373 2730109238
1374 2730165919
1375 2730299813
1376 2739035482
1377 2766065227
1378 2770196557
1379 2776269340
1380 2776283521
1381 2778176100
1382 2792620931
1383 2792625147
1384 2792637561
1385 2793293537
1386 2793312990
1387 2793319637
1388 2793333479
1389 2793347458
1390 2793353788
1391 2793359607
1392 2802720872
1393 2802724476
1394 2802729858
1395 2802737203
1396 2802746331
1397 2802751820
1398 2804753943
1399 2805929492
1400 2805935327
1401 2806044469
1402 2806052670
1403 2806058970
1404 2806068367
1405 2806074487
1406 2808989107
1407 2819243905
1408 2819609512
1409 2819639610
1410 2819686532
1411 2821126262
1412 2838019195
1413 2838024215
1414 2838034712
1415 2838047454
1416 2838051087
1417 2838063935
1418 2838073418
1419 2838674636
1420 2838679974
1421 2838684868
1422 2838691223
1423 2838699295
1424 2838707006
1425 2838712776
1426 2838717771
1427 2838724545
1428 2838729513
1429 2838735706
1430 2838737262
1431 2838748608
1432 2840766557
1433 2841842369
1434 2841849949
1435 2841853957
1436 2841864284
1437 2842082253
1438 2842113338
1439 2842123178
1440 2842128421
1441 2842134656
1442 2842142149
1443 2842151696
1444 2842156512
1445 2842162525
1446 2842170047
1447 2842174016
1448 2842180133
1449 2842184962
1450 2842192132
1451 2842198629
1452 2842199757
1453 2842208404
1454 2842216588
1455 2842219982
1456 2842229168
1457 2842235665
1458 2842241922
1459 2842249301
1460 2842256785
1461 2842263562
1462 2842269914
1463 2842275698
1464 2842281587
1465 2842296254
1466 2842298798
1467 2842308318
1468 2842316409
1469 2842321297
1470 2842359333
1471 2842375544
1472 2842382654
1473 2842390055
1474 2842398422
1475 2842406622
1476 2842412951
1477 2842419594
1478 2842427053
1479 2842433841
1480 2842440127
1481 2842446862
1482 2842453636
1483 2842468210
1484 2842474736
1485 2842481395
1486 2842495546
1487 2842499063
1488 2842508359
1489 2842520969
1490 2842527168
1491 2842922650
1492 2844457397
1493 2847421161
1494 2848995999
1495 2850079374
1496 2854921499
1497 2855843093
1498 2855877714
1499 2857518808
1500 2857532823
1501 2858802049
1502 2891375245
1503 2894653489
1504 2899793167
1505 2899805232
1506 2899849633
1507 2913298433
1508 2915982726
1509 2915993087
1510 2915996805
1511 2916002295
1512 2916009329
1513 2916019641
1514 2916027306
1515 2916028899
1516 2916037049
1517 2916056696
1518 2916063888
1519 2916072144
1520 2919104665
1521 2919118051
1522 2919173541
1523 2919410756
1524 2920822777
1525 2921202061
1526 2921209896
1527 2921243062
1528 2921244407
1529 2921256299
1530 2921260038
1531 2921265864
1532 2921286401
1533 2921294767
1534 2921299181
1535 2923558673
1536 2924145353
1537 2924152344
1538 2924162481
1539 2924172149
1540 2924177634
1541 2924182746
1542 2924190356
1543 2924197329
1544 2924202108
1545 2924211029
1546 2924216635
1547 2924225162
1548 2924230432
1549 2926757816
1550 2926764559
1551 2933010434
1552 2933011619
1553 2933019889
1554 2933574767
1555 2933589371
1556 2933603452
1557 2935901193
1558 2935903375
1559 2936374781
1560 2936380473
1561 2936382364
1562 2937005771
1563 2937010476
1564 2937017346
1565 2937028289
1566 2937030612
1567 2937039082
1568 2937045652
1569 2937050849
1570 2937062514
1571 2937065750
1572 2937076195
1573 2937083953
1574 2937090786
1575 2937096066
1576 2937104490
1577 2937108202
1578 2937115848
1579 2937122090
1580 2957378047
1581 2957383337
1582 2957390633
1583 2957401540
1584 2957405088
1585 2957409996
1586 2957421309
1587 2957426755
1588 2957430176
1589 2957442444
1590 2957450828
1591 2957451790
1592 2957460759
1593 2957468089
1594 2957475880
1595 2957481855
1596 2957490859
1597 2957492783
1598 2957499525
1599 2957510787
1600 2960585906
1601 2960593138
1602 2960600883
1603 2960607705
1604 2960620161
1605 2960635402
1606 2960640367
1607 2960650859
1608 2960655130
1609 2960660967
1610 2960670961
1611 2960677482
1612 2960682686
1613 2964610393
1614 2964621174
1615 2964628775
1616 2964631474
1617 2964642609
1618 2964645493
1619 2964651347
1620 2964660195
1621 2964667478
1622 2964672941
1623 2964684779
1624 2964686388
1625 2964695238
1626 2964699951
1627 2964706371
1628 2964714194
1629 2964726047
1630 2967666652
1631 2967676724
1632 2967683455
1633 2967688423
1634 2967694545
1635 2967701040
1636 2967714276
1637 2967716303
1638 2967725849
1639 2967733843
1640 2967740858
1641 2967744758
1642 2967751494
1643 2967756346
1644 2967766345
1645 2967771934
1646 2967776920
1647 2970020849
1648 2970032004
1649 2970034778
1650 2970046457
1651 2970052189
1652 2970055974
1653 2970064634
1654 2970074417
1655 2970077126
1656 2970087551
1657 2970091788
1658 2970099268
1659 2970104287
1660 2970112574
1661 2970118916
1662 2970122807
1663 2970130946
1664 2970139388
1665 2970145332
1666 2970153283
1667 2970160434
1668 2970165664
1669 2970177349
1670 2970186180
1671 2970194358
1672 2977525593
1673 2977530871
1674 2977538729
1675 2977546899
1676 2977556359
1677 2977561895
1678 2977570569
1679 2977576316
1680 2977581022
1681 2979090333
1682 2979095861
1683 2984604504
1684 2989352013
1685 2989774583
1686 2989780442
1687 3003931303
1688 3005415397
1689 3005418394
1690 3005455675
1691 639650089
1692 643827722
1693 648738240
1694 650844040
1695 8003573242
1696 8003995678
1697 8004003437
1698 8005248246
1699 8005282100
1700 8005285085
1701 8005294178
1702 8005306592
1703 8005309483
1704 8005318714
1705 8005378464
1706 8005434036
1707 8005464704
1708 8005488404
1709 8005501751
1710 8005546995
1711 8005559072
1712 8005566870
1713 8005574855
1714 8005623105
1715 8005631587
1716 8005648873
1717 8005661694
1718 8005673173
1719 8005682110
1720 8005693712
1721 8005700954
1722 8018133531
1723 8018154686
1724 8018170312
1725 8023687451
1726 8024482037
1727 8024505851
1728 8049296536
1729 8054463533
1730 8056387110
1731 8056876248
1732 8057877086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07264

EI24

Sulfate transporter CysZ/Etoposide-induced protein 2.4

22

231

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d79-assembly1.cif.gz_B structure of cysz, a sulfate permease from pseudomonas fragi 0.6082 4 218
6d79-assembly1.cif.gz_A structure of cysz, a sulfate permease from pseudomonas fragi 0.6079 4 218
6d79-assembly1.cif.gz_B structure of cysz, a sulfate permease from pseudomonas fragi 0.5988 4 218
6d79-assembly1.cif.gz_A structure of cysz, a sulfate permease from pseudomonas fragi 0.5987 4 218
6d9z-assembly1.cif.gz_B structure of cysz, a sulfate permease from pseudomonas denitrificans 0.5954 5 215
ID Description Score Start End Superfamily
3pqaB01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.483 72 134 3.40.605.10
af_Q54GA9_9_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.4081 76 195 1.20.120.550
af_I1JGN1_15_262_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.3944 76 134 3.40.605.10
af_O33340_2_231_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.3827 74 131 3.40.605.10
af_B6SQ48_46_188_1.20.1260.100 Mainly Alpha;Up-down Bundle;Ferritin;TspO/MBR protein 0.3797 79 220 1.20.1260.100
ID Description Score Start End GO Terms
AF-A0A529ZHJ2-F1-model_v4 deleted 0.9925 140 225
AF-A0A529ZHJ2-F1-model_v4 deleted 0.9487 140 225
AF-E0MP19-F1-model_v4 Carbamoyl-phosphate synthase large chain 0.915 2 219 GO:0016020
AF-A0A5B9FFH3-F1-model_v4 Sulfate transporter family protein 0.9132 1 228 GO:0016020
AF-A0A256F6Z0-F1-model_v4 Etoposide-induced 2.4 family protein 0.9083 1 228 GO:0016020

Map